F386132

General Info

Members Datasets Scaffolds Average Seq Length
284 181 568 189

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100307673|Ga0075431_1003076732
Length 217
Sequence LTPQPRPGIVADQAPRSPQRAEAPGTAMTPPLSHHVTKLLRAWSQGDRSALDELLPLVYRELHQQAERFMRAQPAGHTLQATALVHEVYLRLVDREGVEWQNRAHFFGVAGKAMRSILVDHARARGAAKRGGAARQLTLAAAGVAGKAEPAVDVLALDEALGRLADLDPEQCRLVELRYFAGLGIEETAEVLGVSPATVKRHWRVARAWLKRELGAS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
136 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.93
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 20.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100307673 3300006847 Bacteria 1600
2 JGI25406J46586_10005447 3300003203 Bacteria 5904
3 Ga0065704_10117866 3300005289 Unclassified 1827
4 Ga0065715_10011366 3300005293 Bacteria 2894
5 Ga0065715_10321560 3300005293 Bacteria 1001
6 Ga0070690_100039687 3300005330 Bacteria 2975
7 Ga0070690_100218247 3300005330 Bacteria 1335
8 Ga0070690_100218397 3300005330 Bacteria 1335
9 Ga0070670_100000216 3300005331 Bacteria 53372
10 Ga0070670_100037499 3300005331 Bacteria 4171
11 Ga0070670_100150071 3300005331 Bacteria 2017
12 Ga0070677_10283800 3300005333 Bacteria 835
13 Ga0070680_100085498 3300005336 Bacteria 2606
14 Ga0070680_100391954 3300005336 Unclassified 1183
15 Ga0070691_10190981 3300005341 Bacteria 1071
16 Ga0070669_100000002 3300005353 Bacteria 506497
17 Ga0070669_100040560 3300005353 Bacteria 3384
18 Ga0070669_100396589 3300005353 Unclassified 1128
19 Ga0070673_100108712 3300005364 Bacteria 2296
20 Ga0070688_100660592 3300005365 Bacteria 806
21 Ga0070714_100162644 3300005435 Bacteria 2021
22 Ga0070713_100005650 3300005436 Bacteria 8577
23 Ga0070711_100130434 3300005439 Bacteria 1871
24 Ga0070711_100133478 3300005439 Bacteria 1852
25 Ga0070700_100068836 3300005441 Bacteria 2252
26 Ga0070700_100435505 3300005441 Bacteria 994
27 Ga0070708_100000345 3300005445 Bacteria 35019
28 Ga0070708_100038597 3300005445 Bacteria 4173
29 Ga0070708_100095802 3300005445 Bacteria 2710
30 Ga0070708_100172800 3300005445 Unclassified 2018
31 Ga0070681_10126960 3300005458 Bacteria 2483
32 Ga0070681_10238045 3300005458 Unclassified 1734
33 Ga0070707_100286040 3300005468 Bacteria 1602
34 Ga0070707_100342339 3300005468 Bacteria 1453
35 Ga0070707_100457589 3300005468 Bacteria 1237
36 Ga0070698_100013090 3300005471 Bacteria 8782
37 Ga0070698_100143716 3300005471 Bacteria 2336
38 Ga0070698_100283266 3300005471 Bacteria 1589
39 Ga0070698_100976046 3300005471 Bacteria 794
40 Ga0070699_100012272 3300005518 Bacteria 7391
41 Ga0070699_100079373 3300005518 Bacteria 2859
42 Ga0070699_100103888 3300005518 Bacteria 2492
43 Ga0070699_100403025 3300005518 Bacteria 1237
44 Ga0070697_100263065 3300005536 Bacteria 1477
45 Ga0068853_100775391 3300005539 Unclassified 917
46 Ga0070696_100002862 3300005546 Bacteria 11473
47 Ga0070664_100004923 3300005564 Bacteria 10697
48 Ga0070664_100068187 3300005564 Bacteria 3041
49 Ga0070664_100272737 3300005564 Bacteria 1524
50 Ga0068854_100785862 3300005578 Unclassified 829
51 Ga0070702_100495246 3300005615 Bacteria 896
52 Ga0068852_100402260 3300005616 Unclassified 1347
53 Ga0068859_100079246 3300005617 Bacteria 3324
54 Ga0068864_100102082 3300005618 Bacteria 2545
55 Ga0068851_10220562 3300005834 Unclassified 1065
56 Ga0068863_100929949 3300005841 Unclassified 871
57 Ga0068858_100081443 3300005842 Bacteria 3009
58 Ga0068858_100449939 3300005842 Unclassified 1241
59 Ga0081540_1097292 3300005983 Bacteria 1278
60 Ga0081539_10001510 3300005985 Bacteria 39264
61 Ga0081539_10075648 3300005985 Bacteria 1787
62 Ga0070717_10140881 3300006028 Bacteria 2080
63 Ga0070717_10248666 3300006028 Unclassified 1570
64 Ga0070715_10042613 3300006163 Bacteria 1909
65 Ga0070712_100218868 3300006175 Bacteria 1506
66 Ga0070712_100665126 3300006175 Bacteria 886
67 Ga0070712_100788362 3300006175 Unclassified 815
68 Ga0097621_100218199 3300006237 Bacteria 1661
69 Ga0097621_100332435 3300006237 Bacteria 1348
70 Ga0075428_100017783 3300006844 Bacteria 7855
71 Ga0075428_100058832 3300006844 Bacteria 4208
72 Ga0075428_100064050 3300006844 Bacteria 4026
73 Ga0075428_100376309 3300006844 Bacteria 1522
74 Ga0075428_100385228 3300006844 Bacteria 1503
75 Ga0075430_100092852 3300006846 Bacteria 2523
76 Ga0075430_100280741 3300006846 Unclassified 1378
77 Ga0075431_100029310 3300006847 Bacteria 5663
78 Ga0075431_100083297 3300006847 Bacteria 3302
79 Ga0075431_100177497 3300006847 Bacteria 2187
80 Ga0075431_100207462 3300006847 Bacteria 2003
81 Ga0075433_10382984 3300006852 Bacteria 1242
82 Ga0075434_100186358 3300006871 Bacteria 2095
83 Ga0075434_100230062 3300006871 Unclassified 1873
84 Ga0075429_100003201 3300006880 Bacteria 13926
85 Ga0068865_100143829 3300006881 Unclassified 1801
86 Ga0097620_100079245 3300006931 Bacteria 3324
87 Ga0075435_100363147 3300007076 Unclassified 1242
88 Ga0075435_100452549 3300007076 Bacteria 1107
89 Ga0105240_10144419 3300009093 Bacteria 2841
90 Ga0105240_10166951 3300009093 Unclassified 2610
91 Ga0105240_10504986 3300009093 Bacteria 1344
92 Ga0111539_10004920 3300009094 Bacteria 17383
93 Ga0111539_10632269 3300009094 Unclassified 1246
94 Ga0105245_10493088 3300009098 Bacteria 1240
95 Ga0105247_10010146 3300009101 Bacteria 5706
96 Ga0114129_10029828 3300009147 Bacteria 7724
97 Ga0114129_10763123 3300009147 Unclassified 1237
98 Ga0105241_10375379 3300009174 Bacteria 1241
99 Ga0105248_10199365 3300009177 Bacteria 2255
100 Ga0105248_10364356 3300009177 Unclassified 1627
101 Ga0105237_10407865 3300009545 Bacteria 1364
102 Ga0105237_10415551 3300009545 Bacteria 1350
103 Ga0105237_10418596 3300009545 Bacteria 1345
104 Ga0105238_10090400 3300009551 Unclassified 3049
105 Ga0105238_10375415 3300009551 Bacteria 1413
106 Ga0105249_10005323 3300009553 Bacteria 11104
107 Ga0105249_10025079 3300009553 Bacteria 5366
108 Ga0105249_11013253 3300009553 Bacteria 899
109 Ga0105239_10093722 3300010375 Bacteria 3316
110 Ga0105239_10211333 3300010375 Unclassified 2175
111 Ga0157374_10149818 3300013296 Bacteria 2268
112 Ga0157378_10057794 3300013297 Bacteria 3458
113 Ga0157378_10122015 3300013297 Unclassified 2403
114 Ga0157378_10391049 3300013297 Unclassified 1368
115 Ga0163162_10502087 3300013306 Unclassified 1343
116 Ga0157375_10133123 3300013308 Unclassified 2607
117 Ga0163163_10000250 3300014325 Bacteria 54990
118 Ga0157380_10089161 3300014326 Bacteria 2540
119 Ga0157380_10954574 3300014326 Bacteria 888
120 Ga0157379_10311759 3300014968 Bacteria 1435
121 Ga0157379_11058336 3300014968 Bacteria 776
122 Ga0157376_10175797 3300014969 Unclassified 1953
123 Ga0157376_11135475 3300014969 Bacteria 808
124 Ga0182007_10035134 3300015262 Bacteria 1690
125 Ga0213876_10043340 3300021384 Bacteria 2378
126 Ga0213875_10254213 3300021388 Unclassified 829
127 Ga0207710_10001700 3300025900 Bacteria 10680
128 Ga0207647_10104175 3300025904 Bacteria 1682
129 Ga0207699_10054250 3300025906 Unclassified 2380
130 Ga0207707_10159617 3300025912 Bacteria 1971
131 Ga0207707_10488825 3300025912 Unclassified 1051
132 Ga0207695_10116049 3300025913 Bacteria 2651
133 Ga0207695_10118191 3300025913 Bacteria 2622
134 Ga0207671_10028064 3300025914 Bacteria 4207
135 Ga0207671_10285887 3300025914 Bacteria 1301
136 Ga0207671_10287646 3300025914 Bacteria 1297
137 Ga0207693_10041670 3300025915 Unclassified 3614
138 Ga0207663_10258518 3300025916 Bacteria 1285
139 Ga0207660_10065282 3300025917 Bacteria 2630
140 Ga0207657_10228968 3300025919 Bacteria 1487
141 Ga0207646_10397570 3300025922 Bacteria 1245
142 Ga0207681_10000009 3300025923 Bacteria 410736
143 Ga0207681_10014708 3300025923 Bacteria 4872
144 Ga0207681_10448964 3300025923 Bacteria 1049
145 Ga0207650_10000269 3300025925 Bacteria 54998
146 Ga0207650_10025464 3300025925 Bacteria 4214
147 Ga0207650_10142477 3300025925 Bacteria 1885
148 Ga0207687_10217898 3300025927 Bacteria 1501
149 Ga0207700_10016557 3300025928 Bacteria 4901
150 Ga0207664_10311849 3300025929 Bacteria 1386
151 Ga0207706_10089613 3300025933 Bacteria 2704
152 Ga0207706_10342260 3300025933 Bacteria 1301
153 Ga0207670_10703637 3300025936 Unclassified 836
154 Ga0207704_10274699 3300025938 Unclassified 1278
155 Ga0207711_10489878 3300025941 Bacteria 1145
156 Ga0207661_10352041 3300025944 Unclassified 1329
157 Ga0207679_10068529 3300025945 Bacteria 2666
158 Ga0207679_10162263 3300025945 Bacteria 1831
159 Ga0207651_10620520 3300025960 Bacteria 947
160 Ga0207640_10655578 3300025981 Unclassified 895
161 Ga0207677_10237701 3300026023 Bacteria 1472
162 Ga0207703_10071430 3300026035 Bacteria 2867
163 Ga0207703_11320187 3300026035 Bacteria 694
164 Ga0207639_10440836 3300026041 Unclassified 1181
165 Ga0207708_10141652 3300026075 Bacteria 1887
166 Ga0207641_10212815 3300026088 Bacteria 1788
167 Ga0207641_10929617 3300026088 Unclassified 864
168 Ga0207676_10125637 3300026095 Bacteria 2172
169 Ga0207674_10004162 3300026116 Bacteria 17499
170 Ga0207674_10019420 3300026116 Bacteria 7358
171 Ga0207674_10761769 3300026116 Unclassified 934
172 Ga0207698_10306447 3300026142 Bacteria 1481
173 Ga0207698_11314767 3300026142 Bacteria 738
174 Ga0207428_10010643 3300027907 Bacteria 8207
175 Ga0268265_10135957 3300028380 Bacteria 2051
176 Ga0268264_10219756 3300028381 Bacteria 1749
177 Ga0268264_10393120 3300028381 Bacteria 1331
178 Ga0265338_10527157 3300028800 Bacteria 829
179 Ga0265325_10157476 3300031241 Bacteria 1070
180 Ga0307513_10004341 3300031456 Bacteria 18942
181 Ga0307408_100001103 3300031548 Bacteria 20589
182 Ga0307408_100190954 3300031548 Bacteria 1650
183 Ga0307410_10072414 3300031852 Bacteria 2393
184 Ga0307406_10001516 3300031901 Bacteria 12819
185 Ga0307412_10707277 3300031911 Bacteria 865
186 Ga0307409_100051014 3300031995 Bacteria 3164
187 Ga0307409_101247051 3300031995 Bacteria 768
188 Ga0307416_100060840 3300032002 Unclassified 3078
189 Ga0307416_100346201 3300032002 Bacteria 1502
190 Ga0307416_100601862 3300032002 Bacteria 1179
191 Ga0307415_100386720 3300032126 Bacteria 1190
192 Ga0373940_0032458 3300035088 Bacteria 1400
193 Ga0373952_0050409 3300035092 Bacteria 991
194 Ga0373939_0092029 3300035114 Bacteria 1026
195 Ga0373953_0095008 3300035117 Bacteria 1250
196 Ga0373957_0034492 3300035120 Bacteria 1874
197 Ga0373960_0020130 3300035121 Unclassified 1762
198 Ga0373955_0030533 3300035172 Bacteria 2814
199 Ga0373962_0044193 3300035242 Unclassified 1265
200 Ga0373931_0100784 3300035691 Bacteria 1624
201 Ga0373935_0355346 3300035692 Unclassified 1045
202 Ga0373927_0003403 3300035695 Bacteria 11443
203 Ga0373947_0052146 3300035725 Bacteria 2464
204 Ga0373937_0008024 3300036401 Bacteria 9152
205 Ga0373925_0318510 3300037068 Bacteria 1258
206 Ga0395899_0007012 3300037312 Bacteria 8721
207 Ga0395899_0049576 3300037312 Bacteria 3121
208 Ga0395899_0151392 3300037312 Bacteria 1644
209 Ga0395900_0067322 3300037418 Bacteria 3679
210 Ga0395900_0270420 3300037418 Bacteria 1694
211 Ga0395898_0117671 3300037466 Bacteria 2546
212 Ga0395898_0987725 3300037466 Bacteria 778
213 Ga0436364_0303101 3300037853 Unclassified 1116
214 Ga0395901_0033079 3300038443 Bacteria 5335
215 Ga0395901_0259791 3300038443 Bacteria 1808
216 Ga0395901_0445301 3300038443 Bacteria 1325
217 Ga0436365_0409323 3300039437 Bacteria 2758
218 Ga0436365_1619569 3300039437 Unclassified 1151
219 Ga0451787_628268 3300041441 Bacteria 797
220 Ga0450921_025529 3300042123 Bacteria 582
221 Ga0439435_0155003 3300042436 Unclassified 737
222 Ga0451577_0195731 3300042876 Unclassified 1824
223 Ga0451577_1506070 3300042876 Bacteria 595
224 Ga0453683_0001001 3300044673 Bacteria 26577
225 Ga0453684_0128390 3300044712 Unclassified 3047
226 Ga0451576_0082323 3300045051 Unclassified 3347
227 Ga0451576_0199360 3300045051 Unclassified 2090
228 Ga0451576_0406524 3300045051 Bacteria 1428
229 Ga0451576_1203520 3300045051 Unclassified 791
230 Ga0466967_0169245 3300045976 Bacteria 2055
231 Ga0495592_0085033 3300046454 Unclassified 2281
232 Ga0495629_0077632 3300046459 Bacteria 2318
233 Ga0495651_0019687 3300046462 Bacteria 5232
234 Ga0495580_0081678 3300046472 Bacteria 2252
235 Ga0495582_0165103 3300046473 Bacteria 1260
236 Ga0495639_0334655 3300046475 Unclassified 758
237 Ga0495585_0413159 3300046492 Bacteria 649
238 Ga0495594_0326426 3300046499 Bacteria 874
239 Ga0495628_0022410 3300046516 Bacteria 5188
240 Ga0495630_0083284 3300046517 Bacteria 2415
241 Ga0495586_0057428 3300046535 Bacteria 2112
242 Ga0495633_0040397 3300046558 Bacteria 2223
243 Ga0495667_0534416 3300046559 Unclassified 733
244 Ga0495599_0499976 3300046678 Bacteria 716
245 Ga0495623_0090402 3300046679 Bacteria 1880
246 Ga0495670_0104915 3300046691 Bacteria 1459
247 Ga0495671_0371123 3300046692 Bacteria 686
248 Ga0495604_0683467 3300047317 Bacteria 653
249 Ga0495636_0019551 3300047318 Bacteria 2724
250 Ga0495636_0242606 3300047318 Bacteria 831
251 Ga0495684_0098988 3300047471 Bacteria 2205
252 Ga0495602_0319377 3300048088 Bacteria 1130
253 Ga0496102_0313908 3300048905 Bacteria 1477
254 Ga0496104_0079575 3300048907 Bacteria 3124
255 Ga0496104_0514388 3300048907 Bacteria 1108
256 Ga0496106_0189624 3300048909 Bacteria 1634
257 Ga0496108_0005370 3300048911 Bacteria 10355
258 Ga0496108_0852669 3300048911 Bacteria 784
259 Ga0496109_0006935 3300048912 Bacteria 9561
260 Ga0496109_0202740 3300048912 Bacteria 1865
261 Ga0496110_0029401 3300048913 Bacteria 4729
262 Ga0496112_0002897 3300048915 Bacteria 13966
263 Ga0496112_0165976 3300048915 Bacteria 2174
264 Ga0496113_0002329 3300048916 Bacteria 10976
265 Ga0496113_0358840 3300048916 Bacteria 1169
266 Ga0501071_0113262 3300049587 Bacteria 2006
267 Ga0501076_0193399 3300049592 Bacteria 1661
268 Ga0501076_0791560 3300049592 Unclassified 782
269 Ga0501225_0044996 3300049705 Bacteria 1222
270 Ga0501080_0907450 3300049742 Bacteria 768
271 nmdc:mga05p37_10790_c1 3300050507 Bacteria 10845
272 nmdc:mga05p37_26715_c1 3300050507 Bacteria 5609
273 nmdc:mga05p37_429998_c1 3300050507 Bacteria 1534
274 nmdc:mga05p37_872702_c1 3300050507 Bacteria 974
275 nmdc:mga09592_3463_c1 3300050508 Bacteria 12747
276 nmdc:mga0qj67_564310_c1 3300050509 Unclassified 912
277 nmdc:mga06r32_197107_c1 3300050510 Bacteria 2001
278 nmdc:mga06r32_35324_c1 3300050510 Bacteria 4716
279 nmdc:mga06r32_6973_c1 3300050510 Bacteria 10166
280 nmdc:mga06r32_75001_c1 3300050510 Bacteria 3281
281 nmdc:mga08y16_158171_c1 3300050511 Bacteria 2354
282 nmdc:mga08y16_4442_c1 3300050511 Bacteria 14661
283 nmdc:mga0rr50_496546_c1 3300050513 Unclassified 1037
284 nmdc:mga0rr50_740489_c1 3300050513 Bacteria 839
285 Ga0075431_100307673
286 JGI25406J46586_10005447
287 Ga0065704_10117866
288 Ga0065715_10011366
289 Ga0065715_10321560
290 Ga0070690_100039687
291 Ga0070690_100218247
292 Ga0070690_100218397
293 Ga0070670_100000216
294 Ga0070670_100037499
295 Ga0070670_100150071
296 Ga0070677_10283800
297 Ga0070680_100085498
298 Ga0070680_100391954
299 Ga0070691_10190981
300 Ga0070669_100000002
301 Ga0070669_100040560
302 Ga0070669_100396589
303 Ga0070673_100108712
304 Ga0070688_100660592
305 Ga0070714_100162644
306 Ga0070713_100005650
307 Ga0070711_100130434
308 Ga0070711_100133478
309 Ga0070700_100068836
310 Ga0070700_100435505
311 Ga0070708_100000345
312 Ga0070708_100038597
313 Ga0070708_100095802
314 Ga0070708_100172800
315 Ga0070681_10126960
316 Ga0070681_10238045
317 Ga0070707_100286040
318 Ga0070707_100342339
319 Ga0070707_100457589
320 Ga0070698_100013090
321 Ga0070698_100143716
322 Ga0070698_100283266
323 Ga0070698_100976046
324 Ga0070699_100012272
325 Ga0070699_100079373
326 Ga0070699_100103888
327 Ga0070699_100403025
328 Ga0070697_100263065
329 Ga0068853_100775391
330 Ga0070696_100002862
331 Ga0070664_100004923
332 Ga0070664_100068187
333 Ga0070664_100272737
334 Ga0068854_100785862
335 Ga0070702_100495246
336 Ga0068852_100402260
337 Ga0068859_100079246
338 Ga0068864_100102082
339 Ga0068851_10220562
340 Ga0068863_100929949
341 Ga0068858_100081443
342 Ga0068858_100449939
343 Ga0081540_1097292
344 Ga0081539_10001510
345 Ga0081539_10075648
346 Ga0070717_10140881
347 Ga0070717_10248666
348 Ga0070715_10042613
349 Ga0070712_100218868
350 Ga0070712_100665126
351 Ga0070712_100788362
352 Ga0097621_100218199
353 Ga0097621_100332435
354 Ga0075428_100017783
355 Ga0075428_100058832
356 Ga0075428_100064050
357 Ga0075428_100376309
358 Ga0075428_100385228
359 Ga0075430_100092852
360 Ga0075430_100280741
361 Ga0075431_100029310
362 Ga0075431_100083297
363 Ga0075431_100177497
364 Ga0075431_100207462
365 Ga0075433_10382984
366 Ga0075434_100186358
367 Ga0075434_100230062
368 Ga0075429_100003201
369 Ga0068865_100143829
370 Ga0097620_100079245
371 Ga0075435_100363147
372 Ga0075435_100452549
373 Ga0105240_10144419
374 Ga0105240_10166951
375 Ga0105240_10504986
376 Ga0111539_10004920
377 Ga0111539_10632269
378 Ga0105245_10493088
379 Ga0105247_10010146
380 Ga0114129_10029828
381 Ga0114129_10763123
382 Ga0105241_10375379
383 Ga0105248_10199365
384 Ga0105248_10364356
385 Ga0105237_10407865
386 Ga0105237_10415551
387 Ga0105237_10418596
388 Ga0105238_10090400
389 Ga0105238_10375415
390 Ga0105249_10005323
391 Ga0105249_10025079
392 Ga0105249_11013253
393 Ga0105239_10093722
394 Ga0105239_10211333
395 Ga0157374_10149818
396 Ga0157378_10057794
397 Ga0157378_10122015
398 Ga0157378_10391049
399 Ga0163162_10502087
400 Ga0157375_10133123
401 Ga0163163_10000250
402 Ga0157380_10089161
403 Ga0157380_10954574
404 Ga0157379_10311759
405 Ga0157379_11058336
406 Ga0157376_10175797
407 Ga0157376_11135475
408 Ga0182007_10035134
409 Ga0213876_10043340
410 Ga0213875_10254213
411 Ga0207710_10001700
412 Ga0207647_10104175
413 Ga0207699_10054250
414 Ga0207707_10159617
415 Ga0207707_10488825
416 Ga0207695_10116049
417 Ga0207695_10118191
418 Ga0207671_10028064
419 Ga0207671_10285887
420 Ga0207671_10287646
421 Ga0207693_10041670
422 Ga0207663_10258518
423 Ga0207660_10065282
424 Ga0207657_10228968
425 Ga0207646_10397570
426 Ga0207681_10000009
427 Ga0207681_10014708
428 Ga0207681_10448964
429 Ga0207650_10000269
430 Ga0207650_10025464
431 Ga0207650_10142477
432 Ga0207687_10217898
433 Ga0207700_10016557
434 Ga0207664_10311849
435 Ga0207706_10089613
436 Ga0207706_10342260
437 Ga0207670_10703637
438 Ga0207704_10274699
439 Ga0207711_10489878
440 Ga0207661_10352041
441 Ga0207679_10068529
442 Ga0207679_10162263
443 Ga0207651_10620520
444 Ga0207640_10655578
445 Ga0207677_10237701
446 Ga0207703_10071430
447 Ga0207703_11320187
448 Ga0207639_10440836
449 Ga0207708_10141652
450 Ga0207641_10212815
451 Ga0207641_10929617
452 Ga0207676_10125637
453 Ga0207674_10004162
454 Ga0207674_10019420
455 Ga0207674_10761769
456 Ga0207698_10306447
457 Ga0207698_11314767
458 Ga0207428_10010643
459 Ga0268265_10135957
460 Ga0268264_10219756
461 Ga0268264_10393120
462 Ga0265338_10527157
463 Ga0265325_10157476
464 Ga0307513_10004341
465 Ga0307408_100001103
466 Ga0307408_100190954
467 Ga0307410_10072414
468 Ga0307406_10001516
469 Ga0307412_10707277
470 Ga0307409_100051014
471 Ga0307409_101247051
472 Ga0307416_100060840
473 Ga0307416_100346201
474 Ga0307416_100601862
475 Ga0307415_100386720
476 Ga0373940_0032458
477 Ga0373952_0050409
478 Ga0373939_0092029
479 Ga0373953_0095008
480 Ga0373957_0034492
481 Ga0373960_0020130
482 Ga0373955_0030533
483 Ga0373962_0044193
484 Ga0373931_0100784
485 Ga0373935_0355346
486 Ga0373927_0003403
487 Ga0373947_0052146
488 Ga0373937_0008024
489 Ga0373925_0318510
490 Ga0395899_0007012
491 Ga0395899_0049576
492 Ga0395899_0151392
493 Ga0395900_0067322
494 Ga0395900_0270420
495 Ga0395898_0117671
496 Ga0395898_0987725
497 Ga0436364_0303101
498 Ga0395901_0033079
499 Ga0395901_0259791
500 Ga0395901_0445301
501 Ga0436365_0409323
502 Ga0436365_1619569
503 Ga0451787_628268
504 Ga0450921_025529
505 Ga0439435_0155003
506 Ga0451577_0195731
507 Ga0451577_1506070
508 Ga0453683_0001001
509 Ga0453684_0128390
510 Ga0451576_0082323
511 Ga0451576_0199360
512 Ga0451576_0406524
513 Ga0451576_1203520
514 Ga0466967_0169245
515 Ga0495592_0085033
516 Ga0495629_0077632
517 Ga0495651_0019687
518 Ga0495580_0081678
519 Ga0495582_0165103
520 Ga0495639_0334655
521 Ga0495585_0413159
522 Ga0495594_0326426
523 Ga0495628_0022410
524 Ga0495630_0083284
525 Ga0495586_0057428
526 Ga0495633_0040397
527 Ga0495667_0534416
528 Ga0495599_0499976
529 Ga0495623_0090402
530 Ga0495670_0104915
531 Ga0495671_0371123
532 Ga0495604_0683467
533 Ga0495636_0019551
534 Ga0495636_0242606
535 Ga0495684_0098988
536 Ga0495602_0319377
537 Ga0496102_0313908
538 Ga0496104_0079575
539 Ga0496104_0514388
540 Ga0496106_0189624
541 Ga0496108_0005370
542 Ga0496108_0852669
543 Ga0496109_0006935
544 Ga0496109_0202740
545 Ga0496110_0029401
546 Ga0496112_0002897
547 Ga0496112_0165976
548 Ga0496113_0002329
549 Ga0496113_0358840
550 Ga0501071_0113262
551 Ga0501076_0193399
552 Ga0501076_0791560
553 Ga0501225_0044996
554 Ga0501080_0907450
555 nmdc:mga05p37_10790_c1
556 nmdc:mga05p37_26715_c1
557 nmdc:mga05p37_429998_c1
558 nmdc:mga05p37_872702_c1
559 nmdc:mga09592_3463_c1
560 nmdc:mga0qj67_564310_c1
561 nmdc:mga06r32_197107_c1
562 nmdc:mga06r32_35324_c1
563 nmdc:mga06r32_6973_c1
564 nmdc:mga06r32_75001_c1
565 nmdc:mga08y16_158171_c1
566 nmdc:mga08y16_4442_c1
567 nmdc:mga0rr50_496546_c1
568 nmdc:mga0rr50_740489_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07638

Sigma70_ECF

ECF sigma factor

33

216

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

163

212

0.92

PF08281

Sigma70_r4_2

Sigma-70, region 4

157

210

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8524 123 182
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8459 123 181
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.841 119 187
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8377 124 187
3vfz-assembly3.cif.gz_B crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8115 128 188
ID Description Score Start End Superfamily
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8459 123 181 1.10.10.10
4nqwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8358 121 185 1.10.10.10
3vdoA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8332 121 185 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8295 120 187 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.804 128 187 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A521ARL5-F1-model_v4 RNA polymerase, sigma subunit, ECF family 0.9043 3 186 GO:0006352
GO:0016987
AF-A0A521ARL5-F1-model_v4 RNA polymerase, sigma subunit, ECF family 0.8903 3 186 GO:0006352
GO:0016987
AF-A0A7W1R9X3-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8766 73 186 GO:0003700
GO:0006352
AF-A0A7X7PI21-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.875 25 186 GO:0006352
GO:0016987
AF-A0A1Q4FNM0-F1-model_v4 RNA polymerase sigma-70 ECF-like HTH domain-containing protein 0.8689 2 185 GO:0006352
GO:0016987

Map