F386006

General Info

Members Datasets Scaffolds Average Seq Length
284 193 568 134

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100318148|Ga0068869_1003181482
Length 132
Sequence MTAVVAVTDAPDLRESRRAFVMAEDRVGHYPEFRAFFDRTFDLARVGLSQPGYVAVSNSIYELVFIGRSGEAFPAGVEINAIVPALEPIDEDRVDRDLWAILRWMIAGVGAPWTVQDLDATGRLYRVPAAAP

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
187 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
188 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
189 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
190 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
191 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
192 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
193 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0
Isolates 2.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 2.82
Rhizoplane 2.46
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 21.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100318148 3300005334 Bacteria 1261
2 Ga0070670_100680103 3300005331 Unclassified 924
3 Ga0068869_100531200 3300005334 Bacteria 986
4 Ga0070666_10340322 3300005335 Unclassified 1072
5 Ga0068868_100183120 3300005338 Bacteria 1739
6 Ga0068868_100324851 3300005338 Bacteria 1312
7 Ga0070692_10125227 3300005345 Bacteria 1438
8 Ga0070668_100302370 3300005347 Bacteria 1342
9 Ga0070675_100020366 3300005354 Bacteria 5295
10 Ga0070675_100184286 3300005354 Bacteria 1806
11 Ga0070673_100046100 3300005364 Bacteria 3384
12 Ga0070659_100529434 3300005366 Bacteria 1007
13 Ga0070709_10561957 3300005434 Unclassified 874
14 Ga0070709_10732325 3300005434 Bacteria 771
15 Ga0070709_11733532 3300005434 Unclassified 510
16 Ga0070714_100484733 3300005435 Bacteria 1178
17 Ga0070714_101219935 3300005435 Bacteria 734
18 Ga0070713_100525967 3300005436 Bacteria 1118
19 Ga0070713_100562177 3300005436 Bacteria 1081
20 Ga0070713_101741136 3300005436 Bacteria 605
21 Ga0070701_10304232 3300005438 Unclassified 981
22 Ga0070711_100025868 3300005439 Bacteria 3841
23 Ga0070711_100048781 3300005439 Bacteria 2897
24 Ga0070711_100194817 3300005439 Bacteria 1560
25 Ga0070711_100484101 3300005439 Bacteria 1018
26 Ga0070700_100529512 3300005441 Bacteria 912
27 Ga0070708_100251821 3300005445 Bacteria 1659
28 Ga0070678_100161517 3300005456 Bacteria 1816
29 Ga0070681_10013426 3300005458 Bacteria 8138
30 Ga0068867_100167997 3300005459 Unclassified 1735
31 Ga0070706_100025392 3300005467 Bacteria 5452
32 Ga0070707_100660647 3300005468 Bacteria 1008
33 Ga0070698_100397606 3300005471 Bacteria 1311
34 Ga0070698_101020517 3300005471 Bacteria 775
35 Ga0070698_101158542 3300005471 Bacteria 722
36 Ga0070699_100357655 3300005518 Bacteria 1316
37 Ga0070699_100377205 3300005518 Bacteria 1280
38 Ga0070679_100238197 3300005530 Bacteria 1778
39 Ga0070697_100749268 3300005536 Bacteria 863
40 Ga0070697_101134372 3300005536 Bacteria 696
41 Ga0068853_100006554 3300005539 Bacteria 9272
42 Ga0070672_101296789 3300005543 Unclassified 650
43 Ga0070672_101990095 3300005543 Unclassified 523
44 Ga0070686_100469425 3300005544 Bacteria 971
45 Ga0070696_100745268 3300005546 Bacteria 802
46 Ga0070665_100084617 3300005548 Bacteria 3177
47 Ga0070704_100193848 3300005549 Bacteria 1635
48 Ga0068855_100943034 3300005563 Bacteria 909
49 Ga0070664_100154508 3300005564 Bacteria 2027
50 Ga0068857_100126626 3300005577 Unclassified 2302
51 Ga0068854_100235560 3300005578 Bacteria 1455
52 Ga0068856_100057464 3300005614 Bacteria 3841
53 Ga0068859_100012319 3300005617 Bacteria 8604
54 Ga0068859_100238514 3300005617 Unclassified 1907
55 Ga0068864_100040216 3300005618 Bacteria 4000
56 Ga0068866_10641023 3300005718 Bacteria 722
57 Ga0068861_100599465 3300005719 Bacteria 1011
58 Ga0068863_100153339 3300005841 Bacteria 2205
59 Ga0068858_100038142 3300005842 Bacteria 4456
60 Ga0068858_101277946 3300005842 Unclassified 722
61 Ga0068860_100572338 3300005843 Bacteria 1133
62 Ga0068860_100587568 3300005843 Unclassified 1118
63 Ga0068860_101404713 3300005843 Bacteria 719
64 Ga0081538_10170695 3300005981 Unclassified 949
65 Ga0070717_10017653 3300006028 Bacteria 5556
66 Ga0070717_10198113 3300006028 Bacteria 1758
67 Ga0070717_10535513 3300006028 Unclassified 1060
68 Ga0070717_10563288 3300006028 Bacteria 1032
69 Ga0070717_10573506 3300006028 Bacteria 1023
70 Ga0070717_11023801 3300006028 Bacteria 752
71 Ga0070717_11042672 3300006028 Bacteria 745
72 Ga0070717_11282579 3300006028 Unclassified 666
73 Ga0070715_10182630 3300006163 Bacteria 1053
74 Ga0070715_10406748 3300006163 Bacteria 758
75 Ga0070715_10812335 3300006163 Unclassified 568
76 Ga0070716_100078616 3300006173 Bacteria 1962
77 Ga0070716_100265305 3300006173 Bacteria 1177
78 Ga0070716_100658945 3300006173 Bacteria 795
79 Ga0070716_100699865 3300006173 Bacteria 774
80 Ga0070712_100459757 3300006175 Bacteria 1061
81 Ga0070712_100578099 3300006175 Bacteria 949
82 Ga0070712_100602244 3300006175 Bacteria 930
83 Ga0075367_11067461 3300006178 Unclassified 516
84 Ga0075369_10280998 3300006186 Unclassified 775
85 Ga0097621_100444936 3300006237 Bacteria 1166
86 Ga0075370_10779848 3300006353 Bacteria 582
87 Ga0068871_100102272 3300006358 Bacteria 2402
88 Ga0075428_100019760 3300006844 Bacteria 7454
89 Ga0075430_100003357 3300006846 Bacteria 13408
90 Ga0075431_100019449 3300006847 Bacteria 6924
91 Ga0075433_10055551 3300006852 Bacteria 3457
92 Ga0075429_100013110 3300006880 Bacteria 7192
93 Ga0068865_100199263 3300006881 Bacteria 1553
94 Ga0075436_100326549 3300006914 Bacteria 1103
95 Ga0097620_100012318 3300006931 Bacteria 8604
96 Ga0097620_100238512 3300006931 Unclassified 1907
97 Ga0099794_10057294 3300007265 Bacteria 1888
98 Ga0099794_10089778 3300007265 Bacteria 1524
99 Ga0105240_10113386 3300009093 Bacteria 3276
100 Ga0105245_10083068 3300009098 Bacteria 2931
101 Ga0105245_11078703 3300009098 Unclassified 849
102 Ga0105245_11239352 3300009098 Unclassified 794
103 Ga0114129_10017974 3300009147 Bacteria 10067
104 Ga0114129_10281171 3300009147 Bacteria 2223
105 Ga0114129_12129470 3300009147 Unclassified 676
106 Ga0105243_10119233 3300009148 Bacteria 2222
107 Ga0105241_10004141 3300009174 Bacteria 10703
108 Ga0105242_10192123 3300009176 Unclassified 1808
109 Ga0105248_10033776 3300009177 Bacteria 5716
110 Ga0105248_10356864 3300009177 Bacteria 1646
111 Ga0105237_10064091 3300009545 Bacteria 3672
112 Ga0105237_10251568 3300009545 Unclassified 1769
113 Ga0105238_10622485 3300009551 Bacteria 1088
114 Ga0105249_10404112 3300009553 Bacteria 1397
115 Ga0105249_10553848 3300009553 Bacteria 1201
116 Ga0105249_10810299 3300009553 Bacteria 1001
117 Ga0105249_11496890 3300009553 Bacteria 747
118 Ga0105239_10082144 3300010375 Bacteria 3548
119 Ga0105239_10156581 3300010375 Bacteria 2544
120 Ga0105239_10194482 3300010375 Bacteria 2271
121 Ga0105246_10229708 3300011119 Bacteria 1460
122 Ga0157374_10485827 3300013296 Bacteria 1238
123 Ga0157374_12023535 3300013296 Unclassified 602
124 Ga0157378_10501232 3300013297 Bacteria 1213
125 Ga0157378_10653635 3300013297 Unclassified 1067
126 Ga0157378_11178325 3300013297 Unclassified 805
127 Ga0157378_12147337 3300013297 Unclassified 609
128 Ga0163162_10585032 3300013306 Bacteria 1243
129 Ga0157375_10079898 3300013308 Bacteria 3307
130 Ga0157375_10152190 3300013308 Bacteria 2450
131 Ga0157375_10259025 3300013308 Bacteria 1901
132 Ga0163163_11512078 3300014325 Bacteria 733
133 Ga0163163_11623213 3300014325 Bacteria 707
134 Ga0157380_11796956 3300014326 Bacteria 672
135 Ga0157380_12956219 3300014326 Unclassified 541
136 Ga0157377_10226747 3300014745 Unclassified 1199
137 Ga0157377_10371792 3300014745 Bacteria 965
138 Ga0157379_10853904 3300014968 Unclassified 861
139 Ga0157376_10008562 3300014969 Bacteria 7390
140 Ga0163161_10978356 3300017792 Bacteria 721
141 Ga0213874_10167306 3300021377 Unclassified 776
142 Ga0213876_10004643 3300021384 Bacteria 7654
143 Ga0213876_10710106 3300021384 Unclassified 535
144 Ga0213875_10000053 3300021388 Bacteria 141791
145 Ga0213871_10174955 3300021441 Bacteria 662
146 Ga0209564_1011929 3300025295 Bacteria 3840
147 Ga0207642_10081668 3300025899 Bacteria 1571
148 Ga0207642_10416476 3300025899 Bacteria 807
149 Ga0207680_10065214 3300025903 Bacteria 2235
150 Ga0207699_10093064 3300025906 Bacteria 1896
151 Ga0207699_10195527 3300025906 Bacteria 1367
152 Ga0207699_11100017 3300025906 Bacteria 588
153 Ga0207684_10106942 3300025910 Bacteria 2393
154 Ga0207695_10438644 3300025913 Bacteria 1189
155 Ga0207671_10049364 3300025914 Bacteria 3115
156 Ga0207693_10492195 3300025915 Bacteria 957
157 Ga0207693_10649013 3300025915 Bacteria 820
158 Ga0207693_10902503 3300025915 Bacteria 678
159 Ga0207663_10219249 3300025916 Bacteria 1383
160 Ga0207663_10515178 3300025916 Bacteria 931
161 Ga0207663_11438096 3300025916 Bacteria 555
162 Ga0207657_10809701 3300025919 Bacteria 724
163 Ga0207652_10299279 3300025921 Bacteria 1452
164 Ga0207646_11161638 3300025922 Bacteria 678
165 Ga0207694_10462852 3300025924 Unclassified 1059
166 Ga0207650_10459523 3300025925 Unclassified 1060
167 Ga0207659_10430556 3300025926 Unclassified 1108
168 Ga0207687_10473185 3300025927 Bacteria 1042
169 Ga0207687_10800124 3300025927 Unclassified 804
170 Ga0207700_11045998 3300025928 Bacteria 730
171 Ga0207664_10367271 3300025929 Bacteria 1276
172 Ga0207664_10476827 3300025929 Bacteria 1116
173 Ga0207669_10299194 3300025937 Bacteria 1222
174 Ga0207704_10103232 3300025938 Bacteria 1906
175 Ga0207665_10066197 3300025939 Bacteria 2459
176 Ga0207665_10122662 3300025939 Bacteria 1837
177 Ga0207665_10449401 3300025939 Bacteria 989
178 Ga0207665_10585383 3300025939 Bacteria 870
179 Ga0207711_10023604 3300025941 Bacteria 5149
180 Ga0207711_10728911 3300025941 Bacteria 924
181 Ga0207689_10006979 3300025942 Bacteria 9930
182 Ga0207689_10135240 3300025942 Bacteria 2029
183 Ga0207679_10202224 3300025945 Bacteria 1660
184 Ga0207667_10395192 3300025949 Bacteria 1408
185 Ga0207712_10795108 3300025961 Bacteria 831
186 Ga0207677_10135712 3300026023 Bacteria 1876
187 Ga0207703_10255216 3300026035 Bacteria 1582
188 Ga0207703_10877033 3300026035 Unclassified 859
189 Ga0207639_10114990 3300026041 Bacteria 2200
190 Ga0207708_10229993 3300026075 Bacteria 1488
191 Ga0207702_10069953 3300026078 Bacteria 3018
192 Ga0207641_10275603 3300026088 Bacteria 1580
193 Ga0207641_11207148 3300026088 Unclassified 756
194 Ga0207648_10039690 3300026089 Bacteria 4138
195 Ga0207676_10074836 3300026095 Bacteria 2730
196 Ga0207674_10893109 3300026116 Unclassified 856
197 Ga0207675_101462626 3300026118 Bacteria 704
198 Ga0207683_10090998 3300026121 Bacteria 2717
199 Ga0209588_1059596 3300027671 Bacteria 1234
200 Ga0268266_10401538 3300028379 Bacteria 1296
201 Ga0268266_11604550 3300028379 Unclassified 626
202 Ga0268265_11266612 3300028380 Bacteria 737
203 Ga0268264_10353667 3300028381 Bacteria 1399
204 Ga0268264_11361703 3300028381 Bacteria 720
205 Ga0265338_10071812 3300028800 Bacteria 2958
206 Ga0265330_10233731 3300031235 Bacteria 775
207 Ga0373926_0082132 3300035083 Unclassified 1193
208 Ga0373954_0257866 3300035118 Unclassified 859
209 Ga0373955_0286676 3300035172 Bacteria 991
210 Ga0373955_0829169 3300035172 Unclassified 569
211 Ga0373924_0101377 3300035410 Bacteria 1239
212 Ga0373931_0270027 3300035691 Unclassified 1041
213 Ga0373935_0241752 3300035692 Bacteria 1261
214 Ga0373935_0362931 3300035692 Bacteria 1034
215 Ga0373927_0255430 3300035695 Bacteria 1152
216 Ga0373927_0269654 3300035695 Bacteria 1119
217 Ga0373947_0479587 3300035725 Unclassified 844
218 Ga0373937_0068458 3300036401 Bacteria 3273
219 Ga0373937_0211476 3300036401 Bacteria 1825
220 Ga0373925_0056652 3300037068 Bacteria 2936
221 Ga0373925_0293589 3300037068 Bacteria 1311
222 Ga0395899_0002296 3300037312 Bacteria 15595
223 Ga0395900_0037511 3300037418 Bacteria 4996
224 Ga0395898_0008874 3300037466 Bacteria 10590
225 Ga0395898_0358766 3300037466 Unclassified 1390
226 Ga0436364_0933887 3300037853 Bacteria 8745
227 Ga0395901_0001682 3300038443 Bacteria 22826
228 Ga0395901_1935516 3300038443 Unclassified 537
229 Ga0436365_0140323 3300039437 Bacteria 788
230 Ga0436365_0339353 3300039437 Bacteria 4567
231 Ga0436365_1048685 3300039437 Bacteria 1356
232 Ga0436360_0259759 3300039438 Bacteria 733
233 Ga0436360_0349194 3300039438 Bacteria 697
234 Ga0436360_0769462 3300039438 Unclassified 3064
235 Ga0436360_1349178 3300039438 Unclassified 560
236 Ga0436361_0542895 3300039447 Unclassified 2205
237 Ga0436363_0484041 3300039450 Bacteria 1012
238 Ga0436363_0969149 3300039450 Bacteria 3600
239 Ga0436362_1292003 3300039453 Bacteria 1016
240 Ga0439441_167372 3300042001 Unclassified 524
241 Ga0466967_1408783 3300045976 Bacteria 694
242 Ga0495628_0735856 3300046516 Bacteria 694
243 Ga0495640_0246192 3300046533 Bacteria 1121
244 Ga0495667_0493618 3300046559 Bacteria 767
245 Ga0495668_0205609 3300046616 Bacteria 1078
246 Ga0495625_0516553 3300046660 Bacteria 728
247 Ga0495635_0344607 3300046663 Unclassified 995
248 Ga0495657_0883934 3300046675 Unclassified 508
249 Ga0495613_0853502 3300046689 Unclassified 592
250 Ga0495604_0200950 3300047317 Unclassified 1383
251 Ga0495674_0998640 3300047319 Unclassified 641
252 Ga0495673_0195531 3300047469 Bacteria 759
253 Ga0495684_0084024 3300047471 Bacteria 2415
254 Ga0495686_0333276 3300047472 Bacteria 829
255 Ga0496102_0769206 3300048905 Bacteria 886
256 Ga0496106_0388769 3300048909 Bacteria 1121
257 Ga0496108_0992034 3300048911 Bacteria 718
258 Ga0496112_1078657 3300048915 Unclassified 722
259 Ga0496114_0250126 3300048917 Unclassified 1560
260 Ga0496114_1190805 3300048917 Bacteria 648
261 Ga0496115_0285817 3300048918 Bacteria 1354
262 Ga0501040_1025180 3300049576 Bacteria 598
263 Ga0501041_0102963 3300049577 Bacteria 1768
264 Ga0501042_0057679 3300049578 Bacteria 2771
265 Ga0501079_0062983 3300049741 Bacteria 2861
266 Ga0501081_0005803 3300049743 Bacteria 7995
267 nmdc:mga05p37_1109491_c1 3300050507 Bacteria 827
268 nmdc:mga05p37_54261_c1 3300050507 Bacteria 4931
269 nmdc:mga09592_6293_c1 3300050508 Bacteria 9669
270 nmdc:mga0qj67_1554_c1 3300050509 Bacteria 16114
271 nmdc:mga06r32_1416868_c1 3300050510 Bacteria 636
272 nmdc:mga06r32_7291_c1 3300050510 Bacteria 9960
273 nmdc:mga0a205_469268_c1 3300050515 Unclassified 1117
274 Ga0500636_0505882 3300053177 Bacteria 532
275 Ga0500645_010979 3300053730 Bacteria 2975
276 Ga0501084_0056622 3300054114 Bacteria 3280
277 2509148406 2508501128 Bacteria 8613869
278 2513894432 2513237141 Bacteria 8496279
279 2879104914 2879099564 Bacteria 10442239
280 2932817165 2932809354 Bacteria 9135765
281 2932825267 2932818245 Bacteria 9955613
282 2935883208 2935883170 Bacteria 7964738
283 8019556022 8019555841 Bacteria 9642137
284 8019569289 8019565922 Bacteria 9639779
285 Ga0068869_100318148
286 Ga0070670_100680103
287 Ga0068869_100531200
288 Ga0070666_10340322
289 Ga0068868_100183120
290 Ga0068868_100324851
291 Ga0070692_10125227
292 Ga0070668_100302370
293 Ga0070675_100020366
294 Ga0070675_100184286
295 Ga0070673_100046100
296 Ga0070659_100529434
297 Ga0070709_10561957
298 Ga0070709_10732325
299 Ga0070709_11733532
300 Ga0070714_100484733
301 Ga0070714_101219935
302 Ga0070713_100525967
303 Ga0070713_100562177
304 Ga0070713_101741136
305 Ga0070701_10304232
306 Ga0070711_100025868
307 Ga0070711_100048781
308 Ga0070711_100194817
309 Ga0070711_100484101
310 Ga0070700_100529512
311 Ga0070708_100251821
312 Ga0070678_100161517
313 Ga0070681_10013426
314 Ga0068867_100167997
315 Ga0070706_100025392
316 Ga0070707_100660647
317 Ga0070698_100397606
318 Ga0070698_101020517
319 Ga0070698_101158542
320 Ga0070699_100357655
321 Ga0070699_100377205
322 Ga0070679_100238197
323 Ga0070697_100749268
324 Ga0070697_101134372
325 Ga0068853_100006554
326 Ga0070672_101296789
327 Ga0070672_101990095
328 Ga0070686_100469425
329 Ga0070696_100745268
330 Ga0070665_100084617
331 Ga0070704_100193848
332 Ga0068855_100943034
333 Ga0070664_100154508
334 Ga0068857_100126626
335 Ga0068854_100235560
336 Ga0068856_100057464
337 Ga0068859_100012319
338 Ga0068859_100238514
339 Ga0068864_100040216
340 Ga0068866_10641023
341 Ga0068861_100599465
342 Ga0068863_100153339
343 Ga0068858_100038142
344 Ga0068858_101277946
345 Ga0068860_100572338
346 Ga0068860_100587568
347 Ga0068860_101404713
348 Ga0081538_10170695
349 Ga0070717_10017653
350 Ga0070717_10198113
351 Ga0070717_10535513
352 Ga0070717_10563288
353 Ga0070717_10573506
354 Ga0070717_11023801
355 Ga0070717_11042672
356 Ga0070717_11282579
357 Ga0070715_10182630
358 Ga0070715_10406748
359 Ga0070715_10812335
360 Ga0070716_100078616
361 Ga0070716_100265305
362 Ga0070716_100658945
363 Ga0070716_100699865
364 Ga0070712_100459757
365 Ga0070712_100578099
366 Ga0070712_100602244
367 Ga0075367_11067461
368 Ga0075369_10280998
369 Ga0097621_100444936
370 Ga0075370_10779848
371 Ga0068871_100102272
372 Ga0075428_100019760
373 Ga0075430_100003357
374 Ga0075431_100019449
375 Ga0075433_10055551
376 Ga0075429_100013110
377 Ga0068865_100199263
378 Ga0075436_100326549
379 Ga0097620_100012318
380 Ga0097620_100238512
381 Ga0099794_10057294
382 Ga0099794_10089778
383 Ga0105240_10113386
384 Ga0105245_10083068
385 Ga0105245_11078703
386 Ga0105245_11239352
387 Ga0114129_10017974
388 Ga0114129_10281171
389 Ga0114129_12129470
390 Ga0105243_10119233
391 Ga0105241_10004141
392 Ga0105242_10192123
393 Ga0105248_10033776
394 Ga0105248_10356864
395 Ga0105237_10064091
396 Ga0105237_10251568
397 Ga0105238_10622485
398 Ga0105249_10404112
399 Ga0105249_10553848
400 Ga0105249_10810299
401 Ga0105249_11496890
402 Ga0105239_10082144
403 Ga0105239_10156581
404 Ga0105239_10194482
405 Ga0105246_10229708
406 Ga0157374_10485827
407 Ga0157374_12023535
408 Ga0157378_10501232
409 Ga0157378_10653635
410 Ga0157378_11178325
411 Ga0157378_12147337
412 Ga0163162_10585032
413 Ga0157375_10079898
414 Ga0157375_10152190
415 Ga0157375_10259025
416 Ga0163163_11512078
417 Ga0163163_11623213
418 Ga0157380_11796956
419 Ga0157380_12956219
420 Ga0157377_10226747
421 Ga0157377_10371792
422 Ga0157379_10853904
423 Ga0157376_10008562
424 Ga0163161_10978356
425 Ga0213874_10167306
426 Ga0213876_10004643
427 Ga0213876_10710106
428 Ga0213875_10000053
429 Ga0213871_10174955
430 Ga0209564_1011929
431 Ga0207642_10081668
432 Ga0207642_10416476
433 Ga0207680_10065214
434 Ga0207699_10093064
435 Ga0207699_10195527
436 Ga0207699_11100017
437 Ga0207684_10106942
438 Ga0207695_10438644
439 Ga0207671_10049364
440 Ga0207693_10492195
441 Ga0207693_10649013
442 Ga0207693_10902503
443 Ga0207663_10219249
444 Ga0207663_10515178
445 Ga0207663_11438096
446 Ga0207657_10809701
447 Ga0207652_10299279
448 Ga0207646_11161638
449 Ga0207694_10462852
450 Ga0207650_10459523
451 Ga0207659_10430556
452 Ga0207687_10473185
453 Ga0207687_10800124
454 Ga0207700_11045998
455 Ga0207664_10367271
456 Ga0207664_10476827
457 Ga0207669_10299194
458 Ga0207704_10103232
459 Ga0207665_10066197
460 Ga0207665_10122662
461 Ga0207665_10449401
462 Ga0207665_10585383
463 Ga0207711_10023604
464 Ga0207711_10728911
465 Ga0207689_10006979
466 Ga0207689_10135240
467 Ga0207679_10202224
468 Ga0207667_10395192
469 Ga0207712_10795108
470 Ga0207677_10135712
471 Ga0207703_10255216
472 Ga0207703_10877033
473 Ga0207639_10114990
474 Ga0207708_10229993
475 Ga0207702_10069953
476 Ga0207641_10275603
477 Ga0207641_11207148
478 Ga0207648_10039690
479 Ga0207676_10074836
480 Ga0207674_10893109
481 Ga0207675_101462626
482 Ga0207683_10090998
483 Ga0209588_1059596
484 Ga0268266_10401538
485 Ga0268266_11604550
486 Ga0268265_11266612
487 Ga0268264_10353667
488 Ga0268264_11361703
489 Ga0265338_10071812
490 Ga0265330_10233731
491 Ga0373926_0082132
492 Ga0373954_0257866
493 Ga0373955_0286676
494 Ga0373955_0829169
495 Ga0373924_0101377
496 Ga0373931_0270027
497 Ga0373935_0241752
498 Ga0373935_0362931
499 Ga0373927_0255430
500 Ga0373927_0269654
501 Ga0373947_0479587
502 Ga0373937_0068458
503 Ga0373937_0211476
504 Ga0373925_0056652
505 Ga0373925_0293589
506 Ga0395899_0002296
507 Ga0395900_0037511
508 Ga0395898_0008874
509 Ga0395898_0358766
510 Ga0436364_0933887
511 Ga0395901_0001682
512 Ga0395901_1935516
513 Ga0436365_0140323
514 Ga0436365_0339353
515 Ga0436365_1048685
516 Ga0436360_0259759
517 Ga0436360_0349194
518 Ga0436360_0769462
519 Ga0436360_1349178
520 Ga0436361_0542895
521 Ga0436363_0484041
522 Ga0436363_0969149
523 Ga0436362_1292003
524 Ga0439441_167372
525 Ga0466967_1408783
526 Ga0495628_0735856
527 Ga0495640_0246192
528 Ga0495667_0493618
529 Ga0495668_0205609
530 Ga0495625_0516553
531 Ga0495635_0344607
532 Ga0495657_0883934
533 Ga0495613_0853502
534 Ga0495604_0200950
535 Ga0495674_0998640
536 Ga0495673_0195531
537 Ga0495684_0084024
538 Ga0495686_0333276
539 Ga0496102_0769206
540 Ga0496106_0388769
541 Ga0496108_0992034
542 Ga0496112_1078657
543 Ga0496114_0250126
544 Ga0496114_1190805
545 Ga0496115_0285817
546 Ga0501040_1025180
547 Ga0501041_0102963
548 Ga0501042_0057679
549 Ga0501079_0062983
550 Ga0501081_0005803
551 nmdc:mga05p37_1109491_c1
552 nmdc:mga05p37_54261_c1
553 nmdc:mga09592_6293_c1
554 nmdc:mga0qj67_1554_c1
555 nmdc:mga06r32_1416868_c1
556 nmdc:mga06r32_7291_c1
557 nmdc:mga0a205_469268_c1
558 Ga0500636_0505882
559 Ga0500645_010979
560 Ga0501084_0056622
561 2509148406
562 2513894432
563 2879104914
564 2932817165
565 2932825267
566 2935883208
567 8019556022
568 8019569289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wr9-assembly2.cif.gz_C crystal structure of burkholderia cenocepacia lectin (bcla) complexed with aman1-3man disaccharide 0.5608 52 90
3ho5-assembly1.cif.gz_A crystal structure of hedgehog-interacting protein (hhip) and sonic hedgehog (shh) complex 0.55 55 94
6v8l-assembly2.cif.gz_B crystal structure of ara h 8.0201 0.5374 51 110
5vvh-assembly1.cif.gz_B crystal structure of the effector binding domain of lysr-type transcriptional regulator, occr from agrobacterium tumefaciens 0.5262 76 111
6v8j-assembly4.cif.gz_D crystal structure of ara h 8.0201 0.5261 51 110
ID Description Score Start End Superfamily
af_A0A1D6G952_102_177_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.6215 51 85 2.20.25.80
af_P22193_1_281_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.6041 51 88 3.70.10.10
af_Q6H462_289_427_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5996 51 71 2.30.29.30
af_A0A1D6L5F7_4_187_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.5954 51 90 2.40.128.20
5t3eB02 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Nonribosomal peptide synthetase, condensation domain 0.5892 62 110 3.30.559.30
ID Description Score Start End GO Terms
AF-A0A6N9BRN8-F1-model_v4 Uncharacterized protein 0.9615 4 123
AF-A0A841NB69-F1-model_v4 deleted 0.9228 6 129
AF-A0A1M7UQP9-F1-model_v4 Uncharacterized protein 0.9087 5 134
AF-A0A6N9BRN8-F1-model_v4 Uncharacterized protein 0.8954 4 123
AF-A0A841NB69-F1-model_v4 deleted 0.8876 6 129

Map