F385823

General Info

Members Datasets Scaffolds Average Seq Length
283 172 566 147

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_1247423|Ga0496112_1247423_125_607
Length 160
Sequence MAPTRNHEQKGSPVDAVLVLNADLGPLHRVSLRHAIRMLCRQVAVVHEAEPDIRLGIWPLPRVVRLVQYVVTRWRYTSGPAWSRSGVMARDRRRCGYCGGTATTVDHITPRSRGGRNTWLNTVAACGGCNQRKGDRTPAEARMPLRTTPQAPTWAALAQR

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
166 2855683550 Micromonospora sp. RP3T Isolate Unclassified
167 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
168 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
169 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
170 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
171 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
172 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.41
Metatranscriptomes 1.77
Isolates 2.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 0.35
Rhizoplane 4.24
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_1247423 3300048915 Bacteria 660
2 rootH2_10149731 3300003320 Unclassified 1738
3 Ga0070683_100014523 3300005329 Bacteria 6892
4 Ga0070683_100767770 3300005329 Bacteria 924
5 Ga0070690_100588164 3300005330 Bacteria 843
6 Ga0070670_100761761 3300005331 Bacteria 873
7 Ga0068869_100049254 3300005334 Bacteria 3049
8 Ga0070680_100990041 3300005336 Bacteria 726
9 Ga0070689_100000027 3300005340 Bacteria 100047
10 Ga0070689_100832872 3300005340 Bacteria 813
11 Ga0070661_100624269 3300005344 Bacteria 873
12 Ga0070692_10023584 3300005345 Bacteria 3016
13 Ga0070688_100085783 3300005365 Unclassified 2047
14 Ga0070709_10175998 3300005434 Bacteria 1499
15 Ga0070709_10858411 3300005434 Bacteria 716
16 Ga0070713_100307022 3300005436 Bacteria 1462
17 Ga0070710_10859988 3300005437 Bacteria 652
18 Ga0070701_10241114 3300005438 Bacteria 1087
19 Ga0070711_100231835 3300005439 Bacteria 1440
20 Ga0070694_100455184 3300005444 Bacteria 1011
21 Ga0070663_101921758 3300005455 Bacteria 532
22 Ga0070681_10203062 3300005458 Bacteria 1900
23 Ga0070681_10841038 3300005458 Bacteria 835
24 Ga0070685_10224948 3300005466 Bacteria 1231
25 Ga0070685_10474040 3300005466 Bacteria 881
26 Ga0070684_100020172 3300005535 Bacteria 5530
27 Ga0070684_100094378 3300005535 Bacteria 2664
28 Ga0070684_100358572 3300005535 Bacteria 1342
29 Ga0070684_102245235 3300005535 Bacteria 515
30 Ga0068853_101037525 3300005539 Bacteria 790
31 Ga0070665_100083589 3300005548 Bacteria 3197
32 Ga0070665_100910192 3300005548 Bacteria 892
33 Ga0070665_101185595 3300005548 Bacteria 775
34 Ga0070704_100449587 3300005549 Bacteria 1109
35 Ga0070664_100261711 3300005564 Bacteria 1556
36 Ga0070664_101044608 3300005564 Bacteria 768
37 Ga0068857_100083023 3300005577 Bacteria 2862
38 Ga0068857_100187942 3300005577 Bacteria 1881
39 Ga0068857_100200195 3300005577 Bacteria 1820
40 Ga0068857_100458979 3300005577 Bacteria 1192
41 Ga0068856_102669471 3300005614 Bacteria 505
42 Ga0068852_101510164 3300005616 Bacteria 694
43 Ga0068859_100070764 3300005617 Bacteria 3524
44 Ga0068859_100404176 3300005617 Bacteria 1462
45 Ga0068864_100000084 3300005618 Bacteria 100513
46 Ga0068864_100001616 3300005618 Bacteria 18561
47 Ga0068864_100119377 3300005618 Bacteria 2356
48 Ga0068870_10627933 3300005840 Bacteria 733
49 Ga0068863_100594323 3300005841 Bacteria 1095
50 Ga0068863_100737141 3300005841 Bacteria 981
51 Ga0068858_100007908 3300005842 Bacteria 10246
52 Ga0068858_100421361 3300005842 Bacteria 1284
53 Ga0068860_101470294 3300005843 Bacteria 703
54 Ga0068862_100118385 3300005844 Unclassified 2332
55 Ga0068862_100255822 3300005844 Bacteria 1597
56 Ga0081455_10310124 3300005937 Unclassified 1128
57 Ga0081540_1033848 3300005983 Bacteria 2766
58 Ga0081540_1035322 3300005983 Bacteria 2682
59 Ga0081540_1167246 3300005983 Bacteria 843
60 Ga0081539_10000217 3300005985 Bacteria 134597
61 Ga0075365_10032813 3300006038 Bacteria 3342
62 Ga0075363_100149306 3300006048 Archaea 1319
63 Ga0075363_100409716 3300006048 Archaea 797
64 Ga0075364_10017343 3300006051 Bacteria 4497
65 Ga0070716_100513144 3300006173 Unclassified 887
66 Ga0070712_100000017 3300006175 Bacteria 103389
67 Ga0070712_100879042 3300006175 Bacteria 772
68 Ga0075367_10589693 3300006178 Archaea 706
69 Ga0075428_100002231 3300006844 Bacteria 20981
70 Ga0075428_100027708 3300006844 Bacteria 6268
71 Ga0075428_100414423 3300006844 Bacteria 1443
72 Ga0075428_100510711 3300006844 Bacteria 1286
73 Ga0075428_100555841 3300006844 Bacteria 1227
74 Ga0075428_101577060 3300006844 Bacteria 687
75 Ga0075428_101862270 3300006844 Unclassified 625
76 Ga0075430_100000074 3300006846 Bacteria 54548
77 Ga0075430_100053414 3300006846 Bacteria 3402
78 Ga0075430_100301545 3300006846 Bacteria 1325
79 Ga0075430_101175026 3300006846 Bacteria 632
80 Ga0075431_100094923 3300006847 Bacteria 3078
81 Ga0075433_10731074 3300006852 Bacteria 866
82 Ga0075433_11203378 3300006852 Unclassified 657
83 Ga0075429_100000193 3300006880 Bacteria 40215
84 Ga0075429_100155599 3300006880 Bacteria 2002
85 Ga0075429_100187165 3300006880 Bacteria 1814
86 Ga0075429_100632270 3300006880 Bacteria 938
87 Ga0075436_100616879 3300006914 Bacteria 800
88 Ga0075436_100769250 3300006914 Bacteria 716
89 Ga0097620_100070764 3300006931 Bacteria 3524
90 Ga0097620_100404152 3300006931 Bacteria 1462
91 Ga0075435_100028797 3300007076 Viruses 4358
92 Ga0105250_10273022 3300009092 Bacteria 726
93 Ga0111539_10387864 3300009094 Bacteria 1626
94 Ga0111539_10900874 3300009094 Bacteria 1029
95 Ga0111539_10935666 3300009094 Bacteria 1008
96 Ga0114129_10175338 3300009147 Bacteria 2920
97 Ga0114129_10578968 3300009147 Bacteria 1457
98 Ga0114129_10725083 3300009147 Bacteria 1275
99 Ga0105241_10208067 3300009174 Bacteria 1638
100 Ga0105248_10116284 3300009177 Bacteria 3016
101 Ga0105237_10643033 3300009545 Bacteria 1067
102 Ga0105238_10613147 3300009551 Bacteria 1097
103 Ga0105238_11459951 3300009551 Bacteria 712
104 Ga0105239_10108542 3300010375 Bacteria 3075
105 Ga0105239_10199623 3300010375 Bacteria 2241
106 Ga0157369_10084581 3300013105 Bacteria 3391
107 Ga0157372_10225313 3300013307 Bacteria 2173
108 Ga0163163_10446606 3300014325 Bacteria 1353
109 Ga0163163_12279489 3300014325 Bacteria 600
110 Ga0157379_10053356 3300014968 Bacteria 3611
111 Ga0157379_10607451 3300014968 Bacteria 1021
112 Ga0206351_10870993 3300020077 Bacteria 580
113 Ga0206350_11089667 3300020080 Bacteria 639
114 Ga0206353_10435908 3300020082 Bacteria 933
115 Ga0224712_10039607 3300022467 Bacteria 1768
116 Ga0224712_10397709 3300022467 Bacteria 656
117 Ga0207710_10000841 3300025900 Bacteria 16558
118 Ga0207710_10232921 3300025900 Bacteria 917
119 Ga0207699_10191091 3300025906 Bacteria 1382
120 Ga0207699_10747017 3300025906 Bacteria 718
121 Ga0207705_10253239 3300025909 Bacteria 1343
122 Ga0207654_10000117 3300025911 Bacteria 51431
123 Ga0207707_10192713 3300025912 Bacteria 1778
124 Ga0207693_10000043 3300025915 Bacteria 103378
125 Ga0207693_10269702 3300025915 Bacteria 1334
126 Ga0207663_11187440 3300025916 Bacteria 614
127 Ga0207660_10029518 3300025917 Bacteria 3763
128 Ga0207660_10431270 3300025917 Bacteria 1064
129 Ga0207649_10779828 3300025920 Bacteria 745
130 Ga0207652_10060479 3300025921 Bacteria 3268
131 Ga0207681_10002803 3300025923 Bacteria 11030
132 Ga0207700_10599149 3300025928 Bacteria 980
133 Ga0207670_10000038 3300025936 Bacteria 104655
134 Ga0207670_11146899 3300025936 Bacteria 657
135 Ga0207665_10317338 3300025939 Bacteria 1168
136 Ga0207711_10035882 3300025941 Bacteria 4204
137 Ga0207711_10386294 3300025941 Bacteria 1299
138 Ga0207689_10927234 3300025942 Bacteria 735
139 Ga0207661_10065700 3300025944 Bacteria 2945
140 Ga0207679_10294145 3300025945 Bacteria 1397
141 Ga0207679_10379909 3300025945 Bacteria 1238
142 Ga0207667_10407754 3300025949 Bacteria 1384
143 Ga0207651_11871610 3300025960 Bacteria 540
144 Ga0207703_10342207 3300026035 Bacteria 1375
145 Ga0207703_10593316 3300026035 Bacteria 1047
146 Ga0207703_10749775 3300026035 Bacteria 930
147 Ga0207678_11122425 3300026067 Bacteria 696
148 Ga0207708_10246111 3300026075 Bacteria 1439
149 Ga0207702_11015308 3300026078 Bacteria 823
150 Ga0207641_10032338 3300026088 Bacteria 4343
151 Ga0207641_10439009 3300026088 Bacteria 1260
152 Ga0207676_10000346 3300026095 Bacteria 39698
153 Ga0207676_10056499 3300026095 Bacteria 3086
154 Ga0207676_10135003 3300026095 Bacteria 2104
155 Ga0207676_11359728 3300026095 Bacteria 706
156 Ga0207674_10039251 3300026116 Bacteria 4909
157 Ga0207674_10054128 3300026116 Bacteria 4087
158 Ga0207674_10101178 3300026116 Bacteria 2863
159 Ga0207674_10189590 3300026116 Bacteria 2006
160 Ga0207674_10814933 3300026116 Bacteria 901
161 Ga0207428_10011365 3300027907 Bacteria 7871
162 Ga0268266_10364987 3300028379 Bacteria 1359
163 Ga0268266_11104553 3300028379 Bacteria 767
164 Ga0268265_10014819 3300028380 Bacteria 5322
165 Ga0268265_10206590 3300028380 Bacteria 1708
166 Ga0307513_10025061 3300031456 Bacteria 6923
167 Ga0307408_100022861 3300031548 Bacteria 4254
168 Ga0307408_101019749 3300031548 Bacteria 764
169 Ga0307508_10131635 3300031616 Bacteria 2105
170 Ga0307405_10001477 3300031731 Bacteria 9924
171 Ga0307405_10387613 3300031731 Bacteria 1090
172 Ga0307405_11041976 3300031731 Bacteria 700
173 Ga0307413_10012545 3300031824 Bacteria 4221
174 Ga0307413_10071211 3300031824 Bacteria 2190
175 Ga0307410_10065841 3300031852 Bacteria 2494
176 Ga0307406_10007054 3300031901 Bacteria 6221
177 Ga0307412_10456076 3300031911 Bacteria 1054
178 Ga0307409_100000424 3300031995 Bacteria 17956
179 Ga0307409_100249092 3300031995 Bacteria 1623
180 Ga0307409_100552264 3300031995 Bacteria 1131
181 Ga0307409_100936489 3300031995 Bacteria 881
182 Ga0307416_100011127 3300032002 Bacteria 5984
183 Ga0307416_100244709 3300032002 Bacteria 1741
184 Ga0307416_100427224 3300032002 Bacteria 1371
185 Ga0307411_10843490 3300032005 Bacteria 810
186 Ga0307415_100000092 3300032126 Bacteria 37950
187 Ga0307415_100046841 3300032126 Bacteria 2907
188 Ga0307415_100069734 3300032126 Bacteria 2466
189 Ga0307415_100111393 3300032126 Bacteria 2032
190 Ga0307507_10078549 3300033179 Bacteria 2925
191 Ga0373923_0154809 3300035111 Bacteria 1043
192 Ga0373953_0164722 3300035117 Bacteria 953
193 Ga0373954_0229627 3300035118 Bacteria 913
194 Ga0373943_0883018 3300035170 Bacteria 534
195 Ga0373931_0942075 3300035691 Bacteria 582
196 Ga0373937_0056605 3300036401 Bacteria 3602
197 Ga0373937_0245360 3300036401 Bacteria 1688
198 Ga0451804_0908213 3300041463 Bacteria 593
199 Ga0451577_0000248 3300042876 Bacteria 106299
200 Ga0453684_0000812 3300044712 Bacteria 106285
201 Ga0466957_0267944 3300044842 Bacteria 1140
202 Ga0495629_0329146 3300046459 Bacteria 1044
203 Ga0495629_1090531 3300046459 Bacteria 516
204 Ga0495580_0894489 3300046472 Bacteria 571
205 Ga0495606_0007633 3300046507 Bacteria 9609
206 Ga0495630_0379392 3300046517 Bacteria 1083
207 Ga0495630_0810816 3300046517 Bacteria 714
208 Ga0495668_0000907 3300046616 Bacteria 33233
209 Ga0495625_0001756 3300046660 Bacteria 25058
210 Ga0495635_1021073 3300046663 Bacteria 526
211 Ga0495658_0187280 3300046683 Bacteria 1286
212 Ga0495600_0743281 3300046809 Bacteria 588
213 Ga0495581_0122918 3300047315 Bacteria 1511
214 Ga0495674_0143602 3300047319 Bacteria 2005
215 Ga0495593_0108999 3300047673 Bacteria 1415
216 Ga0495626_0000687 3300048091 Bacteria 32458
217 Ga0496104_0017251 3300048907 Bacteria 6570
218 Ga0496104_0502434 3300048907 Bacteria 1124
219 Ga0496105_0025325 3300048908 Bacteria 4829
220 Ga0496108_0012832 3300048911 Bacteria 6823
221 Ga0496109_0064642 3300048912 Bacteria 3348
222 Ga0496111_0552262 3300048914 Bacteria 845
223 Ga0496112_0148508 3300048915 Bacteria 2312
224 Ga0496112_0254471 3300048915 Bacteria 1706
225 Ga0496112_0657532 3300048915 Bacteria 977
226 Ga0496113_0001696 3300048916 Bacteria 12485
227 Ga0501034_0417172 3300049571 Bacteria 1264
228 Ga0501034_1379930 3300049571 Bacteria 580
229 Ga0501038_0077442 3300049574 Bacteria 2807
230 Ga0501038_0743379 3300049574 Bacteria 732
231 Ga0501039_0025207 3300049575 Bacteria 4569
232 Ga0501047_0010301 3300049581 Bacteria 8841
233 Ga0501047_0174171 3300049581 Bacteria 2020
234 Ga0501069_0073107 3300049585 Bacteria 1922
235 Ga0501069_0624158 3300049585 Unclassified 648
236 Ga0501074_0115758 3300049590 Bacteria 1918
237 Ga0501035_0381152 3300049822 Bacteria 1176
238 Ga0501044_0452996 3300049823 Bacteria 1189
239 nmdc:mga03n38_226384_c1 3300050490 Unclassified 978
240 nmdc:mga03n38_415625_c1 3300050490 Bacteria 743
241 nmdc:mga03n38_46666_c1 3300050490 Bacteria 1913
242 nmdc:mga00v17_22598_c1 3300050491 Bacteria 3630
243 nmdc:mga0yw44_100550_c1 3300050492 Bacteria 1841
244 nmdc:mga06z11_431844_c1 3300050494 Archaea 795
245 nmdc:mga05p37_117684_c1 3300050507 Bacteria 3265
246 nmdc:mga05p37_223523_c1 3300050507 Bacteria 2271
247 nmdc:mga05p37_36597_c1 3300050507 Bacteria 6020
248 nmdc:mga05p37_721130_c1 3300050507 Bacteria 1104
249 nmdc:mga05p37_789787_c1 3300050507 Bacteria 1040
250 nmdc:mga05p37_839605_c1 3300050507 Bacteria 999
251 nmdc:mga09592_11193_c1 3300050508 Bacteria 7300
252 nmdc:mga09592_149670_c1 3300050508 Bacteria 2013
253 nmdc:mga09592_241569_c1 3300050508 Bacteria 1565
254 nmdc:mga09592_672921_c1 3300050508 Bacteria 882
255 nmdc:mga0qj67_17283_c1 3300050509 Bacteria 5482
256 nmdc:mga0qj67_26185_c1 3300050509 Bacteria 4513
257 nmdc:mga0qj67_716857_c1 3300050509 Bacteria 795
258 nmdc:mga0qj67_78_c1 3300050509 Bacteria 67236
259 nmdc:mga06r32_18855_c1 3300050510 Bacteria 6325
260 nmdc:mga06r32_45343_c1 3300050510 Bacteria 4190
261 nmdc:mga06r32_697190_c1 3300050510 Bacteria 981
262 nmdc:mga08y16_1022039_c1 3300050511 Bacteria 805
263 nmdc:mga08y16_41061_c1 3300050511 Bacteria 4847
264 nmdc:mga0n895_322090_c1 3300050512 Bacteria 1567
265 nmdc:mga0n895_763023_c1 3300050512 Bacteria 959
266 nmdc:mga08x19_1250722_c1 3300050514 Unclassified 526
267 nmdc:mga08x19_152675_c1 3300050514 Bacteria 1565
268 nmdc:mga0a205_272112_c1 3300050515 Bacteria 1571
269 nmdc:mga0a205_77510_c1 3300050515 Viruses 3212
270 Ga0495612_0408793 3300053078 Bacteria 617
271 Ga0495619_0057250 3300053085 Bacteria 2586
272 Ga0495619_0568079 3300053085 Bacteria 777
273 Ga0500646_0000989 3300053090 Bacteria 7760
274 Ga0500646_0170637 3300053090 Bacteria 731
275 Ga0501084_0220971 3300054114 Bacteria 1599
276 2623585333 2622736626 Bacteria 7181580
277 2855687513 2855683550 Bacteria 7134265
278 2858902665 2858902515 Bacteria 7086037
279 2887484405 2887478801 Bacteria 8972725
280 2996221988 2996221748 Bacteria 6799777
281 8001789701 8001781756 Bacteria 9586736
282 8003860268 8003856774 Bacteria 7675274
283 8055413510 8055412473 Bacteria 6257500
284 Ga0496112_1247423
285 rootH2_10149731
286 Ga0070683_100014523
287 Ga0070683_100767770
288 Ga0070690_100588164
289 Ga0070670_100761761
290 Ga0068869_100049254
291 Ga0070680_100990041
292 Ga0070689_100000027
293 Ga0070689_100832872
294 Ga0070661_100624269
295 Ga0070692_10023584
296 Ga0070688_100085783
297 Ga0070709_10175998
298 Ga0070709_10858411
299 Ga0070713_100307022
300 Ga0070710_10859988
301 Ga0070701_10241114
302 Ga0070711_100231835
303 Ga0070694_100455184
304 Ga0070663_101921758
305 Ga0070681_10203062
306 Ga0070681_10841038
307 Ga0070685_10224948
308 Ga0070685_10474040
309 Ga0070684_100020172
310 Ga0070684_100094378
311 Ga0070684_100358572
312 Ga0070684_102245235
313 Ga0068853_101037525
314 Ga0070665_100083589
315 Ga0070665_100910192
316 Ga0070665_101185595
317 Ga0070704_100449587
318 Ga0070664_100261711
319 Ga0070664_101044608
320 Ga0068857_100083023
321 Ga0068857_100187942
322 Ga0068857_100200195
323 Ga0068857_100458979
324 Ga0068856_102669471
325 Ga0068852_101510164
326 Ga0068859_100070764
327 Ga0068859_100404176
328 Ga0068864_100000084
329 Ga0068864_100001616
330 Ga0068864_100119377
331 Ga0068870_10627933
332 Ga0068863_100594323
333 Ga0068863_100737141
334 Ga0068858_100007908
335 Ga0068858_100421361
336 Ga0068860_101470294
337 Ga0068862_100118385
338 Ga0068862_100255822
339 Ga0081455_10310124
340 Ga0081540_1033848
341 Ga0081540_1035322
342 Ga0081540_1167246
343 Ga0081539_10000217
344 Ga0075365_10032813
345 Ga0075363_100149306
346 Ga0075363_100409716
347 Ga0075364_10017343
348 Ga0070716_100513144
349 Ga0070712_100000017
350 Ga0070712_100879042
351 Ga0075367_10589693
352 Ga0075428_100002231
353 Ga0075428_100027708
354 Ga0075428_100414423
355 Ga0075428_100510711
356 Ga0075428_100555841
357 Ga0075428_101577060
358 Ga0075428_101862270
359 Ga0075430_100000074
360 Ga0075430_100053414
361 Ga0075430_100301545
362 Ga0075430_101175026
363 Ga0075431_100094923
364 Ga0075433_10731074
365 Ga0075433_11203378
366 Ga0075429_100000193
367 Ga0075429_100155599
368 Ga0075429_100187165
369 Ga0075429_100632270
370 Ga0075436_100616879
371 Ga0075436_100769250
372 Ga0097620_100070764
373 Ga0097620_100404152
374 Ga0075435_100028797
375 Ga0105250_10273022
376 Ga0111539_10387864
377 Ga0111539_10900874
378 Ga0111539_10935666
379 Ga0114129_10175338
380 Ga0114129_10578968
381 Ga0114129_10725083
382 Ga0105241_10208067
383 Ga0105248_10116284
384 Ga0105237_10643033
385 Ga0105238_10613147
386 Ga0105238_11459951
387 Ga0105239_10108542
388 Ga0105239_10199623
389 Ga0157369_10084581
390 Ga0157372_10225313
391 Ga0163163_10446606
392 Ga0163163_12279489
393 Ga0157379_10053356
394 Ga0157379_10607451
395 Ga0206351_10870993
396 Ga0206350_11089667
397 Ga0206353_10435908
398 Ga0224712_10039607
399 Ga0224712_10397709
400 Ga0207710_10000841
401 Ga0207710_10232921
402 Ga0207699_10191091
403 Ga0207699_10747017
404 Ga0207705_10253239
405 Ga0207654_10000117
406 Ga0207707_10192713
407 Ga0207693_10000043
408 Ga0207693_10269702
409 Ga0207663_11187440
410 Ga0207660_10029518
411 Ga0207660_10431270
412 Ga0207649_10779828
413 Ga0207652_10060479
414 Ga0207681_10002803
415 Ga0207700_10599149
416 Ga0207670_10000038
417 Ga0207670_11146899
418 Ga0207665_10317338
419 Ga0207711_10035882
420 Ga0207711_10386294
421 Ga0207689_10927234
422 Ga0207661_10065700
423 Ga0207679_10294145
424 Ga0207679_10379909
425 Ga0207667_10407754
426 Ga0207651_11871610
427 Ga0207703_10342207
428 Ga0207703_10593316
429 Ga0207703_10749775
430 Ga0207678_11122425
431 Ga0207708_10246111
432 Ga0207702_11015308
433 Ga0207641_10032338
434 Ga0207641_10439009
435 Ga0207676_10000346
436 Ga0207676_10056499
437 Ga0207676_10135003
438 Ga0207676_11359728
439 Ga0207674_10039251
440 Ga0207674_10054128
441 Ga0207674_10101178
442 Ga0207674_10189590
443 Ga0207674_10814933
444 Ga0207428_10011365
445 Ga0268266_10364987
446 Ga0268266_11104553
447 Ga0268265_10014819
448 Ga0268265_10206590
449 Ga0307513_10025061
450 Ga0307408_100022861
451 Ga0307408_101019749
452 Ga0307508_10131635
453 Ga0307405_10001477
454 Ga0307405_10387613
455 Ga0307405_11041976
456 Ga0307413_10012545
457 Ga0307413_10071211
458 Ga0307410_10065841
459 Ga0307406_10007054
460 Ga0307412_10456076
461 Ga0307409_100000424
462 Ga0307409_100249092
463 Ga0307409_100552264
464 Ga0307409_100936489
465 Ga0307416_100011127
466 Ga0307416_100244709
467 Ga0307416_100427224
468 Ga0307411_10843490
469 Ga0307415_100000092
470 Ga0307415_100046841
471 Ga0307415_100069734
472 Ga0307415_100111393
473 Ga0307507_10078549
474 Ga0373923_0154809
475 Ga0373953_0164722
476 Ga0373954_0229627
477 Ga0373943_0883018
478 Ga0373931_0942075
479 Ga0373937_0056605
480 Ga0373937_0245360
481 Ga0451804_0908213
482 Ga0451577_0000248
483 Ga0453684_0000812
484 Ga0466957_0267944
485 Ga0495629_0329146
486 Ga0495629_1090531
487 Ga0495580_0894489
488 Ga0495606_0007633
489 Ga0495630_0379392
490 Ga0495630_0810816
491 Ga0495668_0000907
492 Ga0495625_0001756
493 Ga0495635_1021073
494 Ga0495658_0187280
495 Ga0495600_0743281
496 Ga0495581_0122918
497 Ga0495674_0143602
498 Ga0495593_0108999
499 Ga0495626_0000687
500 Ga0496104_0017251
501 Ga0496104_0502434
502 Ga0496105_0025325
503 Ga0496108_0012832
504 Ga0496109_0064642
505 Ga0496111_0552262
506 Ga0496112_0148508
507 Ga0496112_0254471
508 Ga0496112_0657532
509 Ga0496113_0001696
510 Ga0501034_0417172
511 Ga0501034_1379930
512 Ga0501038_0077442
513 Ga0501038_0743379
514 Ga0501039_0025207
515 Ga0501047_0010301
516 Ga0501047_0174171
517 Ga0501069_0073107
518 Ga0501069_0624158
519 Ga0501074_0115758
520 Ga0501035_0381152
521 Ga0501044_0452996
522 nmdc:mga03n38_226384_c1
523 nmdc:mga03n38_415625_c1
524 nmdc:mga03n38_46666_c1
525 nmdc:mga00v17_22598_c1
526 nmdc:mga0yw44_100550_c1
527 nmdc:mga06z11_431844_c1
528 nmdc:mga05p37_117684_c1
529 nmdc:mga05p37_223523_c1
530 nmdc:mga05p37_36597_c1
531 nmdc:mga05p37_721130_c1
532 nmdc:mga05p37_789787_c1
533 nmdc:mga05p37_839605_c1
534 nmdc:mga09592_11193_c1
535 nmdc:mga09592_149670_c1
536 nmdc:mga09592_241569_c1
537 nmdc:mga09592_672921_c1
538 nmdc:mga0qj67_17283_c1
539 nmdc:mga0qj67_26185_c1
540 nmdc:mga0qj67_716857_c1
541 nmdc:mga0qj67_78_c1
542 nmdc:mga06r32_18855_c1
543 nmdc:mga06r32_45343_c1
544 nmdc:mga06r32_697190_c1
545 nmdc:mga08y16_1022039_c1
546 nmdc:mga08y16_41061_c1
547 nmdc:mga0n895_322090_c1
548 nmdc:mga0n895_763023_c1
549 nmdc:mga08x19_1250722_c1
550 nmdc:mga08x19_152675_c1
551 nmdc:mga0a205_272112_c1
552 nmdc:mga0a205_77510_c1
553 Ga0495612_0408793
554 Ga0495619_0057250
555 Ga0495619_0568079
556 Ga0500646_0000989
557 Ga0500646_0170637
558 Ga0501084_0220971
559 2623585333
560 2855687513
561 2858902665
562 2887484405
563 2996221988
564 8001789701
565 8003860268
566 8055413510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

95

136

0.96

PF13395

HNH_4

HNH endonuclease

98

139

0.94

PF14279

HNH_5

HNH endonuclease

95

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s4x-assembly1.cif.gz_A cas9:grna in complex with 18-20mm dna, 1 minute time-point, kinked active conformation 0.8345 74 127
8f43-assembly1.cif.gz_A hnh nuclease domain from g. stearothermophilus cas9, k597a mutant 0.8222 74 128
6jdv-assembly1.cif.gz_A crystal structure of nme1cas9 in complex with sgrna and target dna (atatgatt pam) in catalytic state 0.8217 74 128
6m0w-assembly1.cif.gz_A crystal structure of streptococcus thermophilus cas9 in complex with the agaa pam 0.7992 74 128
7z4j-assembly1.cif.gz_B spcas9 bound to 18-nucleotide complementary dna substrate in the catalytic state 0.7958 70 128
ID Description Score Start End Superfamily
af_I1MTW9_33_119_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9305 92 124 1.10.30.50
af_I1MTU7_87_181_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.8353 92 128 1.10.30.50
af_P71806_355_434_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.817 68 120 2.30.29.30
af_Q2FWT2_22_114_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.7718 70 120 1.10.30.50
af_P52286_1_194_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.6994 1 29 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A7W8CEV7-F1-model_v4 5-methylcytosine-specific restriction endonuclease McrA 0.995 74 139 GO:0003676
GO:0004519
GO:0008270
AF-A0A3C1S2I9-F1-model_v4 Endonuclease 0.9835 71 125 GO:0004519
AF-A0A6J4LDZ0-F1-model_v4 HNH endonuclease family protein 0.976 70 145 GO:0004519
AF-Q7VEI1-F1-model_v4 McrA/HNH family nuclease 0.9723 71 128 GO:0003676
GO:0004519
GO:0008270
AF-A0A3D5DJ88-F1-model_v4 HNH endonuclease 0.9721 77 139 GO:0003676
GO:0004519
GO:0008270

Map