F385818

General Info

Members Datasets Scaffolds Average Seq Length
283 170 566 115

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0027651|Ga0496108_0027651_3424_3846
Length 140
Sequence VVGAQPLQLGHRARLAVRFRALDRLPLVSRIFTTSVASVYPHYVAKVERKGRTQSELDEVIEWLTGFDEAALRRHLDAGTTFEDFFAEAHLNPGASSITGVVCGVRVEEVEDPLMQQIRYLDKLVDELARGRSMEKILRS

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
97 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
98 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.72
Nodule 0
Rhizoplane 16.61
Rhizosphere 68.2
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0027651 3300048911 Bacteria 4688
2 JGI24740J21852_10015986 3300001979 Bacteria 2724
3 JGI24739J22299_10023891 3300001989 Bacteria 2157
4 JGI24739J22299_10080477 3300001989 Bacteria 1001
5 JGI24739J22299_10173795 3300001989 Bacteria 634
6 JGI24737J22298_10020025 3300001990 Bacteria 2138
7 JGI24738J21930_10035040 3300002075 Bacteria 1022
8 Ga0070670_101746165 3300005331 Bacteria 573
9 Ga0070680_101833157 3300005336 Bacteria 526
10 Ga0070668_100752888 3300005347 Bacteria 862
11 Ga0070668_101023951 3300005347 Bacteria 743
12 Ga0070671_100067188 3300005355 Bacteria 2989
13 Ga0070659_101723544 3300005366 Bacteria 560
14 Ga0070667_100249162 3300005367 Bacteria 1588
15 Ga0070663_100969380 3300005455 Bacteria 738
16 Ga0070678_100135422 3300005456 Bacteria 1964
17 Ga0070678_101826341 3300005456 Bacteria 573
18 Ga0070662_100773448 3300005457 Bacteria 815
19 Ga0068853_100732923 3300005539 Bacteria 944
20 Ga0070696_101541726 3300005546 Bacteria 570
21 Ga0068857_100171916 3300005577 Bacteria 1970
22 Ga0068857_100219913 3300005577 Bacteria 1735
23 Ga0068857_101421314 3300005577 Bacteria 675
24 Ga0068854_101846115 3300005578 Bacteria 555
25 Ga0070702_100032651 3300005615 Bacteria 2857
26 Ga0068852_100997464 3300005616 Bacteria 856
27 Ga0068852_102318456 3300005616 Bacteria 558
28 Ga0068864_100513298 3300005618 Bacteria 1154
29 Ga0068866_10591352 3300005718 Bacteria 748
30 Ga0068861_100730918 3300005719 Bacteria 923
31 Ga0068858_100164693 3300005842 Bacteria 2089
32 Ga0081455_10164901 3300005937 Bacteria 1694
33 Ga0075365_10195245 3300006038 Bacteria 1417
34 Ga0075365_10418623 3300006038 Bacteria 946
35 Ga0075365_10586035 3300006038 Bacteria 789
36 Ga0075365_10706762 3300006038 Bacteria 712
37 Ga0075365_11034686 3300006038 Bacteria 578
38 Ga0075368_10157246 3300006042 Bacteria 951
39 Ga0075363_100050488 3300006048 Bacteria 2216
40 Ga0075363_100177172 3300006048 Bacteria 1212
41 Ga0075364_10365407 3300006051 Bacteria 984
42 Ga0075364_10433797 3300006051 Bacteria 897
43 Ga0075364_10644111 3300006051 Bacteria 724
44 Ga0075367_10068738 3300006178 Bacteria 2126
45 Ga0075367_10119709 3300006178 Bacteria 1622
46 Ga0075367_10262848 3300006178 Bacteria 1084
47 Ga0075367_10449332 3300006178 Bacteria 817
48 Ga0075428_100176875 3300006844 Bacteria 2311
49 Ga0075430_101022842 3300006846 Bacteria 681
50 Ga0075431_100114322 3300006847 Bacteria 2786
51 Ga0075429_100313249 3300006880 Bacteria 1374
52 Ga0068865_101966728 3300006881 Bacteria 530
53 Ga0105244_10416658 3300009036 Bacteria 618
54 Ga0111539_10007385 3300009094 Bacteria 14077
55 Ga0111539_12762689 3300009094 Bacteria 569
56 Ga0114129_10403973 3300009147 Bacteria 1800
57 Ga0105243_10429498 3300009148 Bacteria 1234
58 Ga0105243_10962270 3300009148 Bacteria 854
59 Ga0105242_10554350 3300009176 Bacteria 1103
60 Ga0105238_10595623 3300009551 Bacteria 1113
61 Ga0105238_11140309 3300009551 Bacteria 803
62 Ga0105238_11528062 3300009551 Bacteria 697
63 Ga0105249_10272733 3300009553 Bacteria 1686
64 Ga0105249_10680387 3300009553 Bacteria 1088
65 Ga0105249_11724889 3300009553 Bacteria 699
66 Ga0105246_10602215 3300011119 Bacteria 950
67 Ga0157369_11854740 3300013105 Bacteria 612
68 Ga0171462_1004 3300013250 Bacteria 678877
69 Ga0157378_10179363 3300013297 Bacteria 1991
70 Ga0163162_10059153 3300013306 Bacteria 3863
71 Ga0163162_12434377 3300013306 Bacteria 602
72 Ga0163162_12842640 3300013306 Bacteria 557
73 Ga0157372_10207942 3300013307 Bacteria 2268
74 Ga0157372_12280495 3300013307 Bacteria 622
75 Ga0157375_10204534 3300013308 Bacteria 2131
76 Ga0157375_10359443 3300013308 Bacteria 1622
77 Ga0157375_12097117 3300013308 Bacteria 673
78 Ga0157380_10033030 3300014326 Bacteria 3983
79 Ga0157380_12022624 3300014326 Bacteria 638
80 Ga0157380_13464875 3300014326 Bacteria 505
81 Ga0157377_10717289 3300014745 Bacteria 728
82 Ga0157379_11215847 3300014968 Bacteria 725
83 Ga0157379_11657467 3300014968 Bacteria 626
84 Ga0157379_12340218 3300014968 Bacteria 532
85 Ga0163161_12117500 3300017792 Bacteria 500
86 Ga0206356_11859321 3300020070 Bacteria 614
87 Ga0206353_11298665 3300020082 Bacteria 1671
88 Ga0207656_10442762 3300025321 Bacteria 656
89 Ga0207647_10045022 3300025904 Bacteria 2754
90 Ga0207705_10184059 3300025909 Bacteria 1578
91 Ga0207707_10384496 3300025912 Bacteria 1206
92 Ga0207652_10296160 3300025921 Bacteria 1460
93 Ga0207694_10232579 3300025924 Bacteria 1505
94 Ga0207644_11187285 3300025931 Bacteria 641
95 Ga0207661_10382040 3300025944 Bacteria 1275
96 Ga0207712_10528090 3300025961 Bacteria 1012
97 Ga0207712_10974351 3300025961 Bacteria 752
98 Ga0207668_11434174 3300025972 Bacteria 623
99 Ga0207668_12022759 3300025972 Bacteria 519
100 Ga0207640_11510590 3300025981 Bacteria 604
101 Ga0207658_10155026 3300025986 Bacteria 1871
102 Ga0207703_10321785 3300026035 Bacteria 1416
103 Ga0207639_10440015 3300026041 Bacteria 1182
104 Ga0207678_11585880 3300026067 Bacteria 577
105 Ga0207678_11934441 3300026067 Bacteria 514
106 Ga0207708_11525750 3300026075 Bacteria 587
107 Ga0207648_11354614 3300026089 Bacteria 669
108 Ga0207674_11234673 3300026116 Bacteria 717
109 Ga0207675_101105243 3300026118 Bacteria 812
110 Ga0207683_10386583 3300026121 Bacteria 1287
111 Ga0207698_10272104 3300026142 Bacteria 1562
112 Ga0207698_11858410 3300026142 Bacteria 617
113 Ga0209813_10153237 3300027866 Bacteria 827
114 Ga0209813_10312307 3300027866 Bacteria 613
115 Ga0209813_10443948 3300027866 Bacteria 530
116 Ga0207428_10011789 3300027907 Bacteria 7706
117 Ga0268265_10262490 3300028380 Bacteria 1536
118 Ga0307408_100434006 3300031548 Bacteria 1136
119 Ga0307408_100928941 3300031548 Bacteria 798
120 Ga0307408_101286509 3300031548 Bacteria 685
121 Ga0316576_10025261 3300031727 Bacteria 4157
122 Ga0316578_10218932 3300031728 Bacteria 1145
123 Ga0307405_11319749 3300031731 Bacteria 628
124 Ga0307410_10009914 3300031852 Bacteria 5372
125 Ga0307407_10065078 3300031903 Bacteria 2145
126 Ga0307409_100022753 3300031995 Bacteria 4326
127 Ga0307416_100045430 3300032002 Bacteria 3459
128 Ga0307416_100110614 3300032002 Bacteria 2420
129 Ga0307416_100211694 3300032002 Bacteria 1850
130 Ga0307415_100191796 3300032126 Bacteria 1613
131 Ga0307415_101188199 3300032126 Bacteria 718
132 Ga0316574_0669967 3300035398 Bacteria 638
133 Ga0395900_0549190 3300037418 Bacteria 1100
134 Ga0395901_0042738 3300038443 Bacteria 4700
135 Ga0451797_0556366 3300041453 Bacteria 792
136 Ga0451797_0822222 3300041453 Bacteria 719
137 Ga0451798_0508641 3300041458 Bacteria 716
138 Ga0451800_0855009 3300041459 Bacteria 615
139 Ga0451802_2003394 3300041460 Bacteria 735
140 Ga0451806_057091 3300041462 Bacteria 1093
141 Ga0451833_1110567 3300041491 Bacteria 660
142 Ga0451847_0173223 3300041503 Bacteria 671
143 Ga0451843_0860346 3300041509 Bacteria 529
144 Ga0451853_1290141 3300041512 Bacteria 523
145 Ga0451853_2314575 3300041512 Bacteria 1130
146 Ga0451853_3864184 3300041512 Bacteria 687
147 Ga0466966_0053316 3300044684 Bacteria 2566
148 Ga0453684_0662146 3300044712 Unclassified 1138
149 Ga0466960_0009292 3300044901 Bacteria 4048
150 Ga0466960_0112354 3300044901 Bacteria 1417
151 Ga0495629_0290779 3300046459 Bacteria 1120
152 Ga0495641_0081423 3300046461 Bacteria 1450
153 Ga0495582_0029579 3300046473 Bacteria 3007
154 Ga0495608_0701928 3300046511 Bacteria 602
155 Ga0495656_0025166 3300046615 Bacteria 2357
156 Ga0495634_0187801 3300046642 Bacteria 1291
157 Ga0495670_0820303 3300046691 Bacteria 508
158 Ga0495581_0443829 3300047315 Bacteria 756
159 Ga0495614_0084537 3300048089 Bacteria 1377
160 Ga0496100_0043626 3300048903 Bacteria 2869
161 Ga0496100_0639164 3300048903 Bacteria 828
162 Ga0496101_0079021 3300048904 Bacteria 2428
163 Ga0496101_0093527 3300048904 Bacteria 2239
164 Ga0496102_0108100 3300048905 Bacteria 2590
165 Ga0496102_0143774 3300048905 Bacteria 2237
166 Ga0496102_0270803 3300048905 Bacteria 1601
167 Ga0496102_1457968 3300048905 Bacteria 603
168 Ga0496103_0057010 3300048906 Bacteria 2425
169 Ga0496104_0012832 3300048907 Bacteria 7545
170 Ga0496104_0357266 3300048907 Bacteria 1373
171 Ga0496105_0000625 3300048908 Bacteria 23668
172 Ga0496105_0024312 3300048908 Bacteria 4922
173 Ga0496105_0095916 3300048908 Bacteria 2449
174 Ga0496105_0446166 3300048908 Bacteria 1022
175 Ga0496105_0586525 3300048908 Bacteria 866
176 Ga0496105_1162357 3300048908 Bacteria 570
177 Ga0496106_0086114 3300048909 Bacteria 2420
178 Ga0496107_0048679 3300048910 Bacteria 3054
179 Ga0496107_0329221 3300048910 Bacteria 1137
180 Ga0496107_0331814 3300048910 Bacteria 1132
181 Ga0496109_0031871 3300048912 Bacteria 4735
182 Ga0496109_0072535 3300048912 Bacteria 3163
183 Ga0496109_0329657 3300048912 Bacteria 1441
184 Ga0496109_0352031 3300048912 Bacteria 1391
185 Ga0496110_0092849 3300048913 Bacteria 2701
186 Ga0496110_0550363 3300048913 Bacteria 1049
187 Ga0496110_0584868 3300048913 Bacteria 1013
188 Ga0496111_0347330 3300048914 Bacteria 1098
189 Ga0496111_0364662 3300048914 Bacteria 1069
190 Ga0496111_0699062 3300048914 Bacteria 738
191 Ga0496111_1283645 3300048914 Bacteria 516
192 Ga0496112_0092793 3300048915 Bacteria 2989
193 Ga0496113_0194423 3300048916 Bacteria 1611
194 Ga0496113_1522470 3300048916 Bacteria 516
195 Ga0496114_0031487 3300048917 Bacteria 4364
196 Ga0496114_0041090 3300048917 Bacteria 3832
197 Ga0496114_0426102 3300048917 Bacteria 1175
198 Ga0496115_0001765 3300048918 Bacteria 15483
199 Ga0496115_1139670 3300048918 Bacteria 589
200 Ga0496126_0277681 3300048929 Bacteria 1389
201 Ga0501031_0032085 3300049568 Bacteria 3425
202 Ga0501031_0191958 3300049568 Bacteria 1334
203 Ga0501031_0755373 3300049568 Bacteria 624
204 Ga0501031_0925609 3300049568 Bacteria 558
205 Ga0501032_0110289 3300049569 Bacteria 1821
206 Ga0501033_0038375 3300049570 Bacteria 3581
207 Ga0501034_0453723 3300049571 Bacteria 1199
208 Ga0501036_0267182 3300049572 Bacteria 1433
209 Ga0501036_0508301 3300049572 Bacteria 1002
210 Ga0501036_0520603 3300049572 Bacteria 989
211 Ga0501036_1324599 3300049572 Bacteria 585
212 Ga0501037_0067721 3300049573 Bacteria 2599
213 Ga0501037_0311488 3300049573 Bacteria 1091
214 Ga0501038_0222885 3300049574 Bacteria 1504
215 Ga0501038_0484233 3300049574 Bacteria 948
216 Ga0501039_0033845 3300049575 Bacteria 3942
217 Ga0501039_0097372 3300049575 Bacteria 2294
218 Ga0501039_0982156 3300049575 Bacteria 656
219 Ga0501039_1262233 3300049575 Bacteria 570
220 Ga0501040_0266130 3300049576 Bacteria 1224
221 Ga0501040_1375980 3300049576 Bacteria 512
222 Ga0501041_0242581 3300049577 Bacteria 1132
223 Ga0501041_0499388 3300049577 Bacteria 774
224 Ga0501042_0111298 3300049578 Bacteria 1972
225 Ga0501046_0497727 3300049580 Bacteria 873
226 Ga0501047_0016667 3300049581 Bacteria 7018
227 Ga0501047_0063480 3300049581 Bacteria 3563
228 Ga0501047_0231875 3300049581 Bacteria 1699
229 Ga0501048_0163079 3300049582 Bacteria 1578
230 Ga0501048_0214157 3300049582 Bacteria 1366
231 Ga0501048_1129914 3300049582 Bacteria 564
232 Ga0501068_0261883 3300049584 Bacteria 1103
233 Ga0501068_0509765 3300049584 Bacteria 781
234 Ga0501068_1067127 3300049584 Bacteria 534
235 Ga0501069_0322331 3300049585 Bacteria 908
236 Ga0501069_0350701 3300049585 Bacteria 870
237 Ga0501070_0006565 3300049586 Bacteria 9900
238 Ga0501070_0121981 3300049586 Bacteria 2154
239 Ga0501070_0332027 3300049586 Bacteria 1236
240 Ga0501071_0074180 3300049587 Bacteria 2483
241 Ga0501072_0132535 3300049588 Bacteria 1987
242 Ga0501072_0378650 3300049588 Bacteria 1123
243 Ga0501073_0172145 3300049589 Bacteria 1499
244 Ga0501073_0948553 3300049589 Bacteria 592
245 Ga0501074_1269428 3300049590 Bacteria 516
246 Ga0501075_0046565 3300049591 Bacteria 3258
247 Ga0501075_0503726 3300049591 Bacteria 924
248 Ga0501076_0339438 3300049592 Bacteria 1233
249 Ga0501076_0347348 3300049592 Bacteria 1218
250 Ga0501080_0002518 3300049742 Bacteria 16060
251 Ga0501080_0329191 3300049742 Bacteria 1382
252 Ga0501035_0304662 3300049822 Bacteria 1342
253 Ga0501044_0358991 3300049823 Bacteria 1375
254 Ga0501045_0437181 3300049824 Bacteria 973
255 nmdc:mga03n38_187420_c1 3300050490 Bacteria 1064
256 nmdc:mga03n38_376262_c1 3300050490 Bacteria 777
257 nmdc:mga00v17_148503_c1 3300050491 Bacteria 1505
258 nmdc:mga00v17_320519_c1 3300050491 Bacteria 1007
259 nmdc:mga00v17_497798_c1 3300050491 Bacteria 790
260 nmdc:mga00v17_51647_c1 3300050491 Bacteria 2500
261 nmdc:mga0yw44_329440_c1 3300050492 Bacteria 1026
262 nmdc:mga0yw44_86482_c1 3300050492 Bacteria 1974
263 nmdc:mga06z11_170428_c1 3300050494 Bacteria 1249
264 nmdc:mga06z11_206746_c1 3300050494 Bacteria 1142
265 nmdc:mga06z11_676104_c1 3300050494 Bacteria 629
266 nmdc:mga06z11_69669_c1 3300050494 Bacteria 1857
267 nmdc:mga04h51_177473_c1 3300050495 Bacteria 827
268 nmdc:mga04h51_209678_c1 3300050495 Bacteria 768
269 nmdc:mga04h51_479572_c1 3300050495 Bacteria 529
270 nmdc:mga07m45_241269_c1 3300050496 Bacteria 1051
271 nmdc:mga07m45_640611_c1 3300050496 Bacteria 613
272 nmdc:mga09592_1547829_c1 3300050508 Bacteria 538
273 nmdc:mga0qj67_404948_c1 3300050509 Bacteria 1101
274 nmdc:mga06r32_192984_c1 3300050510 Bacteria 2024
275 nmdc:mga08y16_1312418_c1 3300050511 Bacteria 690
276 nmdc:mga08y16_14252_c1 3300050511 Bacteria 8366
277 Ga0500559_0000719 3300053136 Bacteria 21761
278 Ga0501084_1519553 3300054114 Bacteria 560
279 Ga0587068_005234 3300059641 Bacteria 1760
280 Ga0501082_0753651 3300060353 Bacteria 852
281 Ga0501082_1663434 3300060353 Bacteria 557
282 Ga0530510_0416492 3300061734 Bacteria 1014
283 Ga0530510_1100531 3300061734 Bacteria 609
284 Ga0496108_0027651
285 JGI24740J21852_10015986
286 JGI24739J22299_10023891
287 JGI24739J22299_10080477
288 JGI24739J22299_10173795
289 JGI24737J22298_10020025
290 JGI24738J21930_10035040
291 Ga0070670_101746165
292 Ga0070680_101833157
293 Ga0070668_100752888
294 Ga0070668_101023951
295 Ga0070671_100067188
296 Ga0070659_101723544
297 Ga0070667_100249162
298 Ga0070663_100969380
299 Ga0070678_100135422
300 Ga0070678_101826341
301 Ga0070662_100773448
302 Ga0068853_100732923
303 Ga0070696_101541726
304 Ga0068857_100171916
305 Ga0068857_100219913
306 Ga0068857_101421314
307 Ga0068854_101846115
308 Ga0070702_100032651
309 Ga0068852_100997464
310 Ga0068852_102318456
311 Ga0068864_100513298
312 Ga0068866_10591352
313 Ga0068861_100730918
314 Ga0068858_100164693
315 Ga0081455_10164901
316 Ga0075365_10195245
317 Ga0075365_10418623
318 Ga0075365_10586035
319 Ga0075365_10706762
320 Ga0075365_11034686
321 Ga0075368_10157246
322 Ga0075363_100050488
323 Ga0075363_100177172
324 Ga0075364_10365407
325 Ga0075364_10433797
326 Ga0075364_10644111
327 Ga0075367_10068738
328 Ga0075367_10119709
329 Ga0075367_10262848
330 Ga0075367_10449332
331 Ga0075428_100176875
332 Ga0075430_101022842
333 Ga0075431_100114322
334 Ga0075429_100313249
335 Ga0068865_101966728
336 Ga0105244_10416658
337 Ga0111539_10007385
338 Ga0111539_12762689
339 Ga0114129_10403973
340 Ga0105243_10429498
341 Ga0105243_10962270
342 Ga0105242_10554350
343 Ga0105238_10595623
344 Ga0105238_11140309
345 Ga0105238_11528062
346 Ga0105249_10272733
347 Ga0105249_10680387
348 Ga0105249_11724889
349 Ga0105246_10602215
350 Ga0157369_11854740
351 Ga0171462_1004
352 Ga0157378_10179363
353 Ga0163162_10059153
354 Ga0163162_12434377
355 Ga0163162_12842640
356 Ga0157372_10207942
357 Ga0157372_12280495
358 Ga0157375_10204534
359 Ga0157375_10359443
360 Ga0157375_12097117
361 Ga0157380_10033030
362 Ga0157380_12022624
363 Ga0157380_13464875
364 Ga0157377_10717289
365 Ga0157379_11215847
366 Ga0157379_11657467
367 Ga0157379_12340218
368 Ga0163161_12117500
369 Ga0206356_11859321
370 Ga0206353_11298665
371 Ga0207656_10442762
372 Ga0207647_10045022
373 Ga0207705_10184059
374 Ga0207707_10384496
375 Ga0207652_10296160
376 Ga0207694_10232579
377 Ga0207644_11187285
378 Ga0207661_10382040
379 Ga0207712_10528090
380 Ga0207712_10974351
381 Ga0207668_11434174
382 Ga0207668_12022759
383 Ga0207640_11510590
384 Ga0207658_10155026
385 Ga0207703_10321785
386 Ga0207639_10440015
387 Ga0207678_11585880
388 Ga0207678_11934441
389 Ga0207708_11525750
390 Ga0207648_11354614
391 Ga0207674_11234673
392 Ga0207675_101105243
393 Ga0207683_10386583
394 Ga0207698_10272104
395 Ga0207698_11858410
396 Ga0209813_10153237
397 Ga0209813_10312307
398 Ga0209813_10443948
399 Ga0207428_10011789
400 Ga0268265_10262490
401 Ga0307408_100434006
402 Ga0307408_100928941
403 Ga0307408_101286509
404 Ga0316576_10025261
405 Ga0316578_10218932
406 Ga0307405_11319749
407 Ga0307410_10009914
408 Ga0307407_10065078
409 Ga0307409_100022753
410 Ga0307416_100045430
411 Ga0307416_100110614
412 Ga0307416_100211694
413 Ga0307415_100191796
414 Ga0307415_101188199
415 Ga0316574_0669967
416 Ga0395900_0549190
417 Ga0395901_0042738
418 Ga0451797_0556366
419 Ga0451797_0822222
420 Ga0451798_0508641
421 Ga0451800_0855009
422 Ga0451802_2003394
423 Ga0451806_057091
424 Ga0451833_1110567
425 Ga0451847_0173223
426 Ga0451843_0860346
427 Ga0451853_1290141
428 Ga0451853_2314575
429 Ga0451853_3864184
430 Ga0466966_0053316
431 Ga0453684_0662146
432 Ga0466960_0009292
433 Ga0466960_0112354
434 Ga0495629_0290779
435 Ga0495641_0081423
436 Ga0495582_0029579
437 Ga0495608_0701928
438 Ga0495656_0025166
439 Ga0495634_0187801
440 Ga0495670_0820303
441 Ga0495581_0443829
442 Ga0495614_0084537
443 Ga0496100_0043626
444 Ga0496100_0639164
445 Ga0496101_0079021
446 Ga0496101_0093527
447 Ga0496102_0108100
448 Ga0496102_0143774
449 Ga0496102_0270803
450 Ga0496102_1457968
451 Ga0496103_0057010
452 Ga0496104_0012832
453 Ga0496104_0357266
454 Ga0496105_0000625
455 Ga0496105_0024312
456 Ga0496105_0095916
457 Ga0496105_0446166
458 Ga0496105_0586525
459 Ga0496105_1162357
460 Ga0496106_0086114
461 Ga0496107_0048679
462 Ga0496107_0329221
463 Ga0496107_0331814
464 Ga0496109_0031871
465 Ga0496109_0072535
466 Ga0496109_0329657
467 Ga0496109_0352031
468 Ga0496110_0092849
469 Ga0496110_0550363
470 Ga0496110_0584868
471 Ga0496111_0347330
472 Ga0496111_0364662
473 Ga0496111_0699062
474 Ga0496111_1283645
475 Ga0496112_0092793
476 Ga0496113_0194423
477 Ga0496113_1522470
478 Ga0496114_0031487
479 Ga0496114_0041090
480 Ga0496114_0426102
481 Ga0496115_0001765
482 Ga0496115_1139670
483 Ga0496126_0277681
484 Ga0501031_0032085
485 Ga0501031_0191958
486 Ga0501031_0755373
487 Ga0501031_0925609
488 Ga0501032_0110289
489 Ga0501033_0038375
490 Ga0501034_0453723
491 Ga0501036_0267182
492 Ga0501036_0508301
493 Ga0501036_0520603
494 Ga0501036_1324599
495 Ga0501037_0067721
496 Ga0501037_0311488
497 Ga0501038_0222885
498 Ga0501038_0484233
499 Ga0501039_0033845
500 Ga0501039_0097372
501 Ga0501039_0982156
502 Ga0501039_1262233
503 Ga0501040_0266130
504 Ga0501040_1375980
505 Ga0501041_0242581
506 Ga0501041_0499388
507 Ga0501042_0111298
508 Ga0501046_0497727
509 Ga0501047_0016667
510 Ga0501047_0063480
511 Ga0501047_0231875
512 Ga0501048_0163079
513 Ga0501048_0214157
514 Ga0501048_1129914
515 Ga0501068_0261883
516 Ga0501068_0509765
517 Ga0501068_1067127
518 Ga0501069_0322331
519 Ga0501069_0350701
520 Ga0501070_0006565
521 Ga0501070_0121981
522 Ga0501070_0332027
523 Ga0501071_0074180
524 Ga0501072_0132535
525 Ga0501072_0378650
526 Ga0501073_0172145
527 Ga0501073_0948553
528 Ga0501074_1269428
529 Ga0501075_0046565
530 Ga0501075_0503726
531 Ga0501076_0339438
532 Ga0501076_0347348
533 Ga0501080_0002518
534 Ga0501080_0329191
535 Ga0501035_0304662
536 Ga0501044_0358991
537 Ga0501045_0437181
538 nmdc:mga03n38_187420_c1
539 nmdc:mga03n38_376262_c1
540 nmdc:mga00v17_148503_c1
541 nmdc:mga00v17_320519_c1
542 nmdc:mga00v17_497798_c1
543 nmdc:mga00v17_51647_c1
544 nmdc:mga0yw44_329440_c1
545 nmdc:mga0yw44_86482_c1
546 nmdc:mga06z11_170428_c1
547 nmdc:mga06z11_206746_c1
548 nmdc:mga06z11_676104_c1
549 nmdc:mga06z11_69669_c1
550 nmdc:mga04h51_177473_c1
551 nmdc:mga04h51_209678_c1
552 nmdc:mga04h51_479572_c1
553 nmdc:mga07m45_241269_c1
554 nmdc:mga07m45_640611_c1
555 nmdc:mga09592_1547829_c1
556 nmdc:mga0qj67_404948_c1
557 nmdc:mga06r32_192984_c1
558 nmdc:mga08y16_1312418_c1
559 nmdc:mga08y16_14252_c1
560 Ga0500559_0000719
561 Ga0501084_1519553
562 Ga0587068_005234
563 Ga0501082_0753651
564 Ga0501082_1663434
565 Ga0530510_0416492
566 Ga0530510_1100531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

30

139

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.943 1 112
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9272 1 112
5cd4-assembly2.cif.gz_P the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.4033 6 112
3f6w-assembly1.cif.gz_A xre-family like protein from pseudomonas syringae pv. tomato str. dc3000 0.3788 10 68
3f6w-assembly1.cif.gz_A xre-family like protein from pseudomonas syringae pv. tomato str. dc3000 0.3088 10 68
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9169 2 112 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8941 2 112 1.10.8.290
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7942 7 112 1.10.8.10
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7759 8 112 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7676 8 112 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A200HG91-F1-model_v4 DUF2200 domain-containing protein 1.004 8 113
AF-A0A512HVD9-F1-model_v4 DUF2200 domain-containing protein 1.003 8 113
AF-A0A1R3W203-F1-model_v4 DUF2200 domain-containing protein 1.002 1 113
AF-A0A260R2A5-F1-model_v4 deleted 1.002 3 113
AF-A0A6J4P979-F1-model_v4 DUF2200 domain-containing protein 1.002 2 113

Map