F385807
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 283 | 192 | 283 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0065202|Ga0495684_0065202_645_1523 |
| Length | 292 |
| Sequence | MYDIHYWPTPNGKKVTILLEELGVQYKVVPCNIGRGDQFTPEFLKMNPNHRMPVLVDHNPAGGGEPIAIFESGAMMLYIAEKEGRFFPQALRPRYQVMQWLIWQMANQGPKSGECGHFRRLDASKGDQTYAVTRFTDEVNRLFGVLNNRLYESRYLAGDEYTIADMISYPWTVNWKAQGQDIEEFKYFKRWFEELGARPGVQRGMAVGADLPGDPSAVTPEEQARPAGAGVAGAGGCHVRHRMLLRLLEPVDLFCLPQPAAHAEGVGHRHRLAADPGRRRVQRGQSQRAQFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 68 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 69 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 105 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 112 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 114 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 132 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 133 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 174 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 175 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 189 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 190 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 191 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 192 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 1.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.01 |
| Nodule | 0 |
| Rhizoplane | 2.12 |
| Rhizosphere | 85.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058862_12216272 | 3300004803 | Bacteria | 982 |
| 2 | Ga0065712_10263036 | 3300005290 | Bacteria | 932 |
| 3 | Ga0065715_10209667 | 3300005293 | Bacteria | 1320 |
| 4 | Ga0065707_10292074 | 3300005295 | Bacteria | 1023 |
| 5 | Ga0070658_10058094 | 3300005327 | Bacteria | 3148 |
| 6 | Ga0070690_100620202 | 3300005330 | Bacteria | 823 |
| 7 | Ga0070660_100552513 | 3300005339 | Bacteria | 961 |
| 8 | Ga0070668_100126536 | 3300005347 | Bacteria | 2047 |
| 9 | Ga0070659_100284596 | 3300005366 | Bacteria | 1376 |
| 10 | Ga0070714_100458563 | 3300005435 | Bacteria | 1211 |
| 11 | Ga0070713_100006755 | 3300005436 | Bacteria | 7995 |
| 12 | Ga0070713_100140810 | 3300005436 | Bacteria | 2136 |
| 13 | Ga0070710_10038810 | 3300005437 | Bacteria | 2617 |
| 14 | Ga0070710_10082579 | 3300005437 | Bacteria | 1879 |
| 15 | Ga0070710_10373336 | 3300005437 | Bacteria | 950 |
| 16 | Ga0070711_100009303 | 3300005439 | Bacteria | 6045 |
| 17 | Ga0070711_100165230 | 3300005439 | Bacteria | 1682 |
| 18 | Ga0070708_100476843 | 3300005445 | Bacteria | 1177 |
| 19 | Ga0070681_10024498 | 3300005458 | Bacteria | 6074 |
| 20 | Ga0070681_10036226 | 3300005458 | Bacteria | 4955 |
| 21 | Ga0070706_100111258 | 3300005467 | Bacteria | 2548 |
| 22 | Ga0070707_100028915 | 3300005468 | Bacteria | 5275 |
| 23 | Ga0070698_100124719 | 3300005471 | Bacteria | 2533 |
| 24 | Ga0070698_100251283 | 3300005471 | Bacteria | 1701 |
| 25 | Ga0070699_100157937 | 3300005518 | Bacteria | 2007 |
| 26 | Ga0070699_100281063 | 3300005518 | Bacteria | 1491 |
| 27 | Ga0070679_100016699 | 3300005530 | Bacteria | 7090 |
| 28 | Ga0070697_100049027 | 3300005536 | Bacteria | 3426 |
| 29 | Ga0070695_100000711 | 3300005545 | Bacteria | 17788 |
| 30 | Ga0070704_100281018 | 3300005549 | Bacteria | 1379 |
| 31 | Ga0070704_100726667 | 3300005549 | Bacteria | 882 |
| 32 | Ga0068855_100186595 | 3300005563 | Bacteria | 2342 |
| 33 | Ga0068856_100335603 | 3300005614 | Bacteria | 1530 |
| 34 | Ga0068852_100119076 | 3300005616 | Bacteria | 2414 |
| 35 | Ga0068861_100271951 | 3300005719 | Bacteria | 1455 |
| 36 | Ga0068861_100285576 | 3300005719 | Bacteria | 1423 |
| 37 | Ga0068858_100604710 | 3300005842 | Unclassified | 1064 |
| 38 | Ga0068862_100435460 | 3300005844 | Bacteria | 1233 |
| 39 | Ga0081455_10000302 | 3300005937 | Bacteria | 65101 |
| 40 | Ga0081455_10149166 | 3300005937 | Bacteria | 1805 |
| 41 | Ga0081540_1000338 | 3300005983 | Bacteria | 48150 |
| 42 | Ga0081540_1028334 | 3300005983 | Bacteria | 3148 |
| 43 | Ga0081539_10030530 | 3300005985 | Bacteria | 3343 |
| 44 | Ga0070717_10089701 | 3300006028 | Bacteria | 2593 |
| 45 | Ga0070717_10360305 | 3300006028 | Bacteria | 1301 |
| 46 | Ga0070717_10595472 | 3300006028 | Bacteria | 1003 |
| 47 | Ga0075363_100009164 | 3300006048 | Bacteria | 4647 |
| 48 | Ga0070716_100105010 | 3300006173 | Bacteria | 1740 |
| 49 | Ga0070712_100096135 | 3300006175 | Bacteria | 2180 |
| 50 | Ga0070712_100232790 | 3300006175 | Bacteria | 1464 |
| 51 | Ga0075362_10059905 | 3300006177 | Bacteria | 1720 |
| 52 | Ga0075367_10032629 | 3300006178 | Bacteria | 2998 |
| 53 | Ga0075369_10091784 | 3300006186 | Bacteria | 1356 |
| 54 | Ga0075366_10039884 | 3300006195 | Bacteria | 2776 |
| 55 | Ga0075428_100054329 | 3300006844 | Bacteria | 4389 |
| 56 | Ga0075428_100155336 | 3300006844 | Bacteria | 2486 |
| 57 | Ga0075433_10163995 | 3300006852 | Bacteria | 1978 |
| 58 | Ga0075434_100004320 | 3300006871 | Bacteria | 12779 |
| 59 | Ga0075434_100260794 | 3300006871 | Bacteria | 1752 |
| 60 | Ga0075429_100398126 | 3300006880 | Bacteria | 1206 |
| 61 | Ga0075436_100079970 | 3300006914 | Bacteria | 2264 |
| 62 | Ga0075435_100014130 | 3300007076 | Bacteria | 5958 |
| 63 | Ga0075435_100154210 | 3300007076 | Bacteria | 1932 |
| 64 | Ga0099794_10163121 | 3300007265 | Bacteria | 1134 |
| 65 | Ga0099795_10110623 | 3300007788 | Bacteria | 1088 |
| 66 | Ga0105240_10003036 | 3300009093 | Bacteria | 26403 |
| 67 | Ga0105240_10025347 | 3300009093 | Bacteria | 7795 |
| 68 | Ga0105240_10258434 | 3300009093 | Bacteria | 2010 |
| 69 | Ga0105240_10336213 | 3300009093 | Bacteria | 1717 |
| 70 | Ga0111539_10023877 | 3300009094 | Bacteria | 7511 |
| 71 | Ga0111539_10149299 | 3300009094 | Bacteria | 2736 |
| 72 | Ga0114129_10027883 | 3300009147 | Bacteria | 7997 |
| 73 | Ga0114129_10845407 | 3300009147 | Bacteria | 1164 |
| 74 | Ga0105242_10135783 | 3300009176 | Bacteria | 2128 |
| 75 | Ga0105238_10011178 | 3300009551 | Bacteria | 9031 |
| 76 | Ga0105238_10391735 | 3300009551 | Bacteria | 1382 |
| 77 | Ga0099796_10055231 | 3300010159 | Bacteria | 1390 |
| 78 | Ga0105239_10849277 | 3300010375 | Bacteria | 1047 |
| 79 | Ga0105246_10500555 | 3300011119 | Bacteria | 1032 |
| 80 | Ga0157373_10406519 | 3300013100 | Bacteria | 976 |
| 81 | Ga0157374_10522403 | 3300013296 | Bacteria | 1193 |
| 82 | Ga0163162_10551795 | 3300013306 | Bacteria | 1280 |
| 83 | Ga0163162_10567544 | 3300013306 | Bacteria | 1262 |
| 84 | Ga0163162_10783820 | 3300013306 | Bacteria | 1071 |
| 85 | Ga0157372_10039606 | 3300013307 | Bacteria | 5201 |
| 86 | Ga0157372_10759291 | 3300013307 | Bacteria | 1127 |
| 87 | Ga0157375_10299507 | 3300013308 | Bacteria | 1772 |
| 88 | Ga0157375_10901378 | 3300013308 | Bacteria | 1028 |
| 89 | Ga0163163_10076811 | 3300014325 | Bacteria | 3335 |
| 90 | Ga0163163_10350762 | 3300014325 | Bacteria | 1532 |
| 91 | Ga0163163_11024820 | 3300014325 | Bacteria | 889 |
| 92 | Ga0157380_10727009 | 3300014326 | Bacteria | 1001 |
| 93 | Ga0157377_10213100 | 3300014745 | Bacteria | 1233 |
| 94 | Ga0157376_10028940 | 3300014969 | Bacteria | 4410 |
| 95 | Ga0157376_10166182 | 3300014969 | Bacteria | 2005 |
| 96 | Ga0163161_10194905 | 3300017792 | Bacteria | 1559 |
| 97 | Ga0213872_10060345 | 3300021361 | Bacteria | 1715 |
| 98 | Ga0213874_10089466 | 3300021377 | Bacteria | 1009 |
| 99 | Ga0213875_10000198 | 3300021388 | Bacteria | 61683 |
| 100 | Ga0213875_10000530 | 3300021388 | Bacteria | 31543 |
| 101 | Ga0207692_10329993 | 3300025898 | Bacteria | 936 |
| 102 | Ga0207688_10306232 | 3300025901 | Bacteria | 972 |
| 103 | Ga0207699_10061748 | 3300025906 | Bacteria | 2256 |
| 104 | Ga0207707_10026437 | 3300025912 | Bacteria | 5073 |
| 105 | Ga0207707_10037172 | 3300025912 | Bacteria | 4254 |
| 106 | Ga0207707_10315018 | 3300025912 | Bacteria | 1351 |
| 107 | Ga0207707_10413120 | 3300025912 | Bacteria | 1158 |
| 108 | Ga0207695_10000939 | 3300025913 | Bacteria | 51994 |
| 109 | Ga0207695_10009429 | 3300025913 | Bacteria | 12074 |
| 110 | Ga0207695_10189120 | 3300025913 | Bacteria | 1977 |
| 111 | Ga0207693_10003109 | 3300025915 | Bacteria | 14279 |
| 112 | Ga0207693_10053360 | 3300025915 | Bacteria | 3172 |
| 113 | Ga0207693_10074517 | 3300025915 | Bacteria | 2658 |
| 114 | Ga0207693_10179658 | 3300025915 | Bacteria | 1665 |
| 115 | Ga0207663_10481098 | 3300025916 | Bacteria | 962 |
| 116 | Ga0207657_10047483 | 3300025919 | Bacteria | 3754 |
| 117 | Ga0207652_10082002 | 3300025921 | Bacteria | 2821 |
| 118 | Ga0207646_10018288 | 3300025922 | Bacteria | 6540 |
| 119 | Ga0207694_10033633 | 3300025924 | Bacteria | 3927 |
| 120 | Ga0207700_10065878 | 3300025928 | Bacteria | 2766 |
| 121 | Ga0207700_10155689 | 3300025928 | Bacteria | 1893 |
| 122 | Ga0207664_10262677 | 3300025929 | Bacteria | 1510 |
| 123 | Ga0207644_10380386 | 3300025931 | Bacteria | 1151 |
| 124 | Ga0207690_10001563 | 3300025932 | Bacteria | 14344 |
| 125 | Ga0207670_10446587 | 3300025936 | Bacteria | 1042 |
| 126 | Ga0207665_10113140 | 3300025939 | Bacteria | 1909 |
| 127 | Ga0207665_10220979 | 3300025939 | Bacteria | 1388 |
| 128 | Ga0207679_10688293 | 3300025945 | Bacteria | 927 |
| 129 | Ga0207667_10035837 | 3300025949 | Bacteria | 5322 |
| 130 | Ga0207668_10124877 | 3300025972 | Bacteria | 1955 |
| 131 | Ga0207677_10425509 | 3300026023 | Bacteria | 1132 |
| 132 | Ga0207639_10119559 | 3300026041 | Bacteria | 2162 |
| 133 | Ga0207702_10038821 | 3300026078 | Bacteria | 3988 |
| 134 | Ga0207702_10203901 | 3300026078 | Bacteria | 1835 |
| 135 | Ga0207641_11072633 | 3300026088 | Bacteria | 804 |
| 136 | Ga0207675_100063620 | 3300026118 | Bacteria | 3447 |
| 137 | Ga0207675_100397215 | 3300026118 | Bacteria | 1358 |
| 138 | Ga0207698_10120749 | 3300026142 | Bacteria | 2217 |
| 139 | Ga0207428_10034164 | 3300027907 | Bacteria | 4170 |
| 140 | Ga0265338_10020869 | 3300028800 | Bacteria | 6864 |
| 141 | Ga0265338_10185108 | 3300028800 | Bacteria | 1584 |
| 142 | Ga0265339_10005853 | 3300031249 | Bacteria | 8152 |
| 143 | Ga0265331_10011169 | 3300031250 | Bacteria | 4926 |
| 144 | Ga0265327_10000275 | 3300031251 | Bacteria | 101668 |
| 145 | Ga0265316_10079226 | 3300031344 | Bacteria | 2521 |
| 146 | Ga0265313_10000079 | 3300031595 | Bacteria | 95515 |
| 147 | Ga0265342_10051506 | 3300031712 | Bacteria | 2456 |
| 148 | Ga0373958_0049288 | 3300034819 | Bacteria | 885 |
| 149 | Ga0373934_0006346 | 3300035086 | Bacteria | 4385 |
| 150 | Ga0373923_0150195 | 3300035111 | Bacteria | 1058 |
| 151 | Ga0373932_0110285 | 3300035112 | Bacteria | 906 |
| 152 | Ga0373936_0046603 | 3300035113 | Bacteria | 1748 |
| 153 | Ga0373945_0049149 | 3300035116 | Bacteria | 1547 |
| 154 | Ga0373953_0012310 | 3300035117 | Bacteria | 3026 |
| 155 | Ga0373953_0113331 | 3300035117 | Bacteria | 1148 |
| 156 | Ga0373954_0005687 | 3300035118 | Bacteria | 5407 |
| 157 | Ga0373954_0153427 | 3300035118 | Bacteria | 1126 |
| 158 | Ga0373956_0064168 | 3300035119 | Bacteria | 1667 |
| 159 | Ga0373957_0015184 | 3300035120 | Bacteria | 2647 |
| 160 | Ga0373957_0047412 | 3300035120 | Bacteria | 1634 |
| 161 | Ga0373943_0145355 | 3300035170 | Bacteria | 1281 |
| 162 | Ga0373946_0077706 | 3300035171 | Bacteria | 1447 |
| 163 | Ga0373955_0064234 | 3300035172 | Bacteria | 2034 |
| 164 | Ga0373955_0247149 | 3300035172 | Bacteria | 1069 |
| 165 | Ga0373961_0061780 | 3300035241 | Bacteria | 1139 |
| 166 | Ga0373924_0041109 | 3300035410 | Bacteria | 1894 |
| 167 | Ga0373931_0000929 | 3300035691 | Bacteria | 12312 |
| 168 | Ga0373931_0193621 | 3300035691 | Bacteria | 1211 |
| 169 | Ga0373935_0039458 | 3300035692 | Bacteria | 2961 |
| 170 | Ga0373935_0049845 | 3300035692 | Bacteria | 2656 |
| 171 | Ga0373935_0208252 | 3300035692 | Bacteria | 1354 |
| 172 | Ga0373935_0271825 | 3300035692 | Bacteria | 1191 |
| 173 | Ga0373927_0099679 | 3300035695 | Bacteria | 1889 |
| 174 | Ga0373933_0006031 | 3300035724 | Bacteria | 6591 |
| 175 | Ga0373933_0062635 | 3300035724 | Bacteria | 2247 |
| 176 | Ga0373947_0016990 | 3300035725 | Bacteria | 4181 |
| 177 | Ga0373937_0022330 | 3300036401 | Bacteria | 5689 |
| 178 | Ga0373937_0025566 | 3300036401 | Bacteria | 5331 |
| 179 | Ga0373937_0071551 | 3300036401 | Bacteria | 3198 |
| 180 | Ga0373937_0210271 | 3300036401 | Bacteria | 1830 |
| 181 | Ga0265778_024193 | 3300036457 | Bacteria | 763 |
| 182 | Ga0373925_0076178 | 3300037068 | Bacteria | 2543 |
| 183 | Ga0373925_0211371 | 3300037068 | Bacteria | 1545 |
| 184 | Ga0373925_0274166 | 3300037068 | Bacteria | 1357 |
| 185 | Ga0373925_0414261 | 3300037068 | Bacteria | 1100 |
| 186 | Ga0373925_0434231 | 3300037068 | Bacteria | 1074 |
| 187 | Ga0436364_0022735 | 3300037853 | Bacteria | 162985 |
| 188 | Ga0436364_0072060 | 3300037853 | Bacteria | 2319 |
| 189 | Ga0436364_1070807 | 3300037853 | Bacteria | 80692 |
| 190 | Ga0436365_0071266 | 3300039437 | Bacteria | 1249 |
| 191 | Ga0436365_0755142 | 3300039437 | Bacteria | 1242 |
| 192 | Ga0436365_1109782 | 3300039437 | Bacteria | 1664 |
| 193 | Ga0436365_1396677 | 3300039437 | Bacteria | 1979 |
| 194 | Ga0436360_0564101 | 3300039438 | Bacteria | 1472 |
| 195 | Ga0436360_0657821 | 3300039438 | Bacteria | 2982 |
| 196 | Ga0436361_0310288 | 3300039447 | Bacteria | 6871 |
| 197 | Ga0436361_0699975 | 3300039447 | Bacteria | 3493 |
| 198 | Ga0436363_1079299 | 3300039450 | Bacteria | 865 |
| 199 | Ga0436363_1259167 | 3300039450 | Bacteria | 1368 |
| 200 | Ga0436363_1341696 | 3300039450 | Bacteria | 1316 |
| 201 | Ga0436363_1502795 | 3300039450 | Bacteria | 2354 |
| 202 | Ga0436363_1505184 | 3300039450 | Bacteria | 1833 |
| 203 | Ga0436362_1076623 | 3300039453 | Bacteria | 2304 |
| 204 | Ga0436362_1292843 | 3300039453 | Bacteria | 1768 |
| 205 | Ga0466963_0090473 | 3300044694 | Bacteria | 2084 |
| 206 | Ga0466967_0750081 | 3300045976 | Bacteria | 968 |
| 207 | Ga0495592_0045481 | 3300046454 | Bacteria | 3276 |
| 208 | Ga0495592_0199694 | 3300046454 | Bacteria | 1350 |
| 209 | Ga0495629_0212238 | 3300046459 | Bacteria | 1337 |
| 210 | Ga0495629_0227338 | 3300046459 | Bacteria | 1286 |
| 211 | Ga0495638_0005990 | 3300046460 | Bacteria | 8912 |
| 212 | Ga0495651_0127627 | 3300046462 | Bacteria | 1861 |
| 213 | Ga0495580_0064209 | 3300046472 | Bacteria | 2574 |
| 214 | Ga0495639_0061726 | 3300046475 | Bacteria | 1719 |
| 215 | Ga0495639_0258563 | 3300046475 | Bacteria | 862 |
| 216 | Ga0495662_0055118 | 3300046476 | Bacteria | 1921 |
| 217 | Ga0495664_0000595 | 3300046477 | Bacteria | 18303 |
| 218 | Ga0495594_0179837 | 3300046499 | Bacteria | 1204 |
| 219 | Ga0495618_0115566 | 3300046514 | Bacteria | 1718 |
| 220 | Ga0495630_0118304 | 3300046517 | Bacteria | 2010 |
| 221 | Ga0495630_0433062 | 3300046517 | Bacteria | 1008 |
| 222 | Ga0495652_0287581 | 3300046529 | Bacteria | 1201 |
| 223 | Ga0495640_0051028 | 3300046533 | Bacteria | 2846 |
| 224 | Ga0495640_0133305 | 3300046533 | Bacteria | 1606 |
| 225 | Ga0495586_0017143 | 3300046535 | Bacteria | 3851 |
| 226 | Ga0495587_0004538 | 3300046536 | Bacteria | 9121 |
| 227 | Ga0495667_0243746 | 3300046559 | Bacteria | 1144 |
| 228 | Ga0495667_0273276 | 3300046559 | Bacteria | 1073 |
| 229 | Ga0495634_0270801 | 3300046642 | Bacteria | 1034 |
| 230 | Ga0495635_0038535 | 3300046663 | Bacteria | 3309 |
| 231 | Ga0495599_0028271 | 3300046678 | Bacteria | 3514 |
| 232 | Ga0495623_0156071 | 3300046679 | Bacteria | 1345 |
| 233 | Ga0495646_0005725 | 3300046680 | Bacteria | 7871 |
| 234 | Ga0495600_0040777 | 3300046809 | Bacteria | 3025 |
| 235 | Ga0495600_0076961 | 3300046809 | Bacteria | 2179 |
| 236 | Ga0495604_0018987 | 3300047317 | Bacteria | 5505 |
| 237 | Ga0495674_0128247 | 3300047319 | Bacteria | 2138 |
| 238 | Ga0495672_0217613 | 3300047320 | Bacteria | 945 |
| 239 | Ga0495680_0041766 | 3300047322 | Bacteria | 3644 |
| 240 | Ga0495675_0132671 | 3300047444 | Bacteria | 1547 |
| 241 | Ga0495684_0065202 | 3300047471 | Bacteria | 2769 |
| 242 | Ga0495684_0121613 | 3300047471 | Bacteria | 1966 |
| 243 | Ga0495684_0266887 | 3300047471 | Bacteria | 1240 |
| 244 | Ga0495602_0000574 | 3300048088 | Bacteria | 34217 |
| 245 | Ga0496110_0016881 | 3300048913 | Bacteria | 6101 |
| 246 | Ga0496110_0106080 | 3300048913 | Bacteria | 2521 |
| 247 | Ga0496111_0236198 | 3300048914 | Bacteria | 1358 |
| 248 | Ga0496112_0195241 | 3300048915 | Bacteria | 1985 |
| 249 | Ga0496112_0283498 | 3300048915 | Bacteria | 1603 |
| 250 | Ga0496113_0026789 | 3300048916 | Bacteria | 4126 |
| 251 | Ga0496121_0101548 | 3300048924 | Bacteria | 2218 |
| 252 | Ga0496126_0091836 | 3300048929 | Bacteria | 2669 |
| 253 | Ga0501047_0666152 | 3300049581 | Bacteria | 859 |
| 254 | Ga0501048_0502497 | 3300049582 | Bacteria | 869 |
| 255 | Ga0501070_0301279 | 3300049586 | Bacteria | 1306 |
| 256 | nmdc:mga03683_91029_c1 | 3300050489 | Bacteria | 1330 |
| 257 | nmdc:mga03n38_3767_c1 | 3300050490 | Bacteria | 4917 |
| 258 | nmdc:mga0yw44_274_c1 | 3300050492 | Bacteria | 17652 |
| 259 | nmdc:mga0yw44_57680_c2 | 3300050492 | Bacteria | 1564 |
| 260 | nmdc:mga0k408_43501_c1 | 3300050493 | Bacteria | 2588 |
| 261 | nmdc:mga06z11_154623_c1 | 3300050494 | Bacteria | 1307 |
| 262 | nmdc:mga07m45_47896_c1 | 3300050496 | Bacteria | 2403 |
| 263 | nmdc:mga05p37_1176751_c1 | 3300050507 | Bacteria | 795 |
| 264 | nmdc:mga08y16_335342_c1 | 3300050511 | Bacteria | 1555 |
| 265 | nmdc:mga08y16_527811_c1 | 3300050511 | Bacteria | 1197 |
| 266 | nmdc:mga08y16_99026_c1 | 3300050511 | Bacteria | 3036 |
| 267 | nmdc:mga0rr50_62192_c1 | 3300050513 | Bacteria | 2815 |
| 268 | nmdc:mga0rr50_9450_c1 | 3300050513 | Bacteria | 6131 |
| 269 | nmdc:mga0a205_264522_c1 | 3300050515 | Bacteria | 1597 |
| 270 | nmdc:mga0sz30_70160_c1 | 3300050516 | Bacteria | 1507 |
| 271 | Ga0495601_0010161 | 3300053077 | Bacteria | 5594 |
| 272 | Ga0495601_0021627 | 3300053077 | Bacteria | 3940 |
| 273 | Ga0495601_0184681 | 3300053077 | Bacteria | 1363 |
| 274 | Ga0495612_0004207 | 3300053078 | Bacteria | 5967 |
| 275 | Ga0495595_0021092 | 3300053084 | Bacteria | 2843 |
| 276 | Ga0495619_0017025 | 3300053085 | Bacteria | 4607 |
| 277 | Ga0495619_0033424 | 3300053085 | Bacteria | 3340 |
| 278 | Ga0495619_0067073 | 3300053085 | Bacteria | 2395 |
| 279 | Ga0500643_000050 | 3300053087 | Bacteria | 147005 |
| 280 | Ga0500595_018677 | 3300053119 | Bacteria | 2531 |
| 281 | Ga0500559_0044281 | 3300053136 | Bacteria | 1946 |
| 282 | Ga0500568_0040215 | 3300053139 | Bacteria | 1884 |
| 283 | Ga0587128_008573 | 3300059630 | Bacteria | 1325 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0666152 | Ga0501047_0666152_45_788 | 229 |
| 2 | 3300049582 | Ga0501048_0502497 | Ga0501048_0502497_94_837 | 229 |
| 3 | 3300013308 | Ga0157375_10299507 | Ga0157375_102995072 | 234 |
| 4 | 3300047471 | Ga0495684_0065202 | Ga0495684_0065202_645_1523 | 238 |
| 5 | 3300005330 | Ga0070690_100620202 | Ga0070690_1006202021 | 239 |
| 6 | 3300005347 | Ga0070668_100126536 | Ga0070668_1001265363 | 239 |
| 7 | 3300005536 | Ga0070697_100049027 | Ga0070697_1000490272 | 239 |
| 8 | 3300005545 | Ga0070695_100000711 | Ga0070695_10000071114 | 239 |
| 9 | 3300005549 | Ga0070704_100726667 | Ga0070704_1007266671 | 239 |
| 10 | 3300005719 | Ga0068861_100271951 | Ga0068861_1002719512 | 239 |
| 11 | 3300005719 | Ga0068861_100285576 | Ga0068861_1002855762 | 239 |
| 12 | 3300005937 | Ga0081455_10000302 | Ga0081455_1000030218 | 239 |
| 13 | 3300005983 | Ga0081540_1000338 | Ga0081540_100033818 | 239 |
| 14 | 3300005985 | Ga0081539_10030530 | Ga0081539_100305301 | 239 |
| 15 | 3300006844 | Ga0075428_100054329 | Ga0075428_1000543296 | 239 |
| 16 | 3300006844 | Ga0075428_100155336 | Ga0075428_1001553362 | 239 |
| 17 | 3300006852 | Ga0075433_10163995 | Ga0075433_101639952 | 239 |
| 18 | 3300006871 | Ga0075434_100004320 | Ga0075434_1000043203 | 239 |
| 19 | 3300006880 | Ga0075429_100398126 | Ga0075429_1003981263 | 239 |
| 20 | 3300007076 | Ga0075435_100014130 | Ga0075435_1000141304 | 239 |
| 21 | 3300009094 | Ga0111539_10023877 | Ga0111539_100238771 | 239 |
| 22 | 3300009094 | Ga0111539_10149299 | Ga0111539_101492993 | 239 |
| 23 | 3300009147 | Ga0114129_10027883 | Ga0114129_100278837 | 239 |
| 24 | 3300013306 | Ga0163162_10783820 | Ga0163162_107838202 | 239 |
| 25 | 3300013308 | Ga0157375_10901378 | Ga0157375_109013782 | 239 |
| 26 | 3300014326 | Ga0157380_10727009 | Ga0157380_107270091 | 239 |
| 27 | 3300017792 | Ga0163161_10194905 | Ga0163161_101949052 | 239 |
| 28 | 3300025936 | Ga0207670_10446587 | Ga0207670_104465871 | 239 |
| 29 | 3300025972 | Ga0207668_10124877 | Ga0207668_101248771 | 239 |
| 30 | 3300026118 | Ga0207675_100063620 | Ga0207675_1000636203 | 239 |
| 31 | 3300026118 | Ga0207675_100397215 | Ga0207675_1003972152 | 239 |
| 32 | 3300034819 | Ga0373958_0049288 | Ga0373958_0049288_52_771 | 239 |
| 33 | 3300035241 | Ga0373961_0061780 | Ga0373961_0061780_291_1010 | 239 |
| 34 | 3300035691 | Ga0373931_0000929 | Ga0373931_0000929_2576_3295 | 239 |
| 35 | 3300035691 | Ga0373931_0193621 | Ga0373931_0193621_280_999 | 239 |
| 36 | 3300037068 | Ga0373925_0434231 | Ga0373925_0434231_116_835 | 239 |
| 37 | 3300046459 | Ga0495629_0227338 | Ga0495629_0227338_375_1094 | 239 |
| 38 | 3300046475 | Ga0495639_0258563 | Ga0495639_0258563_46_765 | 239 |
| 39 | 3300048913 | Ga0496110_0016881 | Ga0496110_0016881_1008_1727 | 239 |
| 40 | 3300048915 | Ga0496112_0195241 | Ga0496112_0195241_781_1500 | 239 |
| 41 | 3300050507 | nmdc:mga05p37_1176751_c1 | nmdc:mga05p37_1176751_c1_28_747 | 239 |
| 42 | 3300050511 | nmdc:mga08y16_335342_c1 | nmdc:mga08y16_335342_c1_537_1256 | 239 |
| 43 | 3300050511 | nmdc:mga08y16_527811_c1 | nmdc:mga08y16_527811_c1_64_783 | 239 |
| 44 | 3300050513 | nmdc:mga0rr50_9450_c1 | nmdc:mga0rr50_9450_c1_3453_4172 | 239 |
| 45 | 3300050515 | nmdc:mga0a205_264522_c1 | nmdc:mga0a205_264522_c1_134_853 | 239 |
| 46 | 3300004803 | Ga0058862_12216272 | Ga0058862_122162721 | 240 |
| 47 | 3300005290 | Ga0065712_10263036 | Ga0065712_102630361 | 240 |
| 48 | 3300005293 | Ga0065715_10209667 | Ga0065715_102096672 | 240 |
| 49 | 3300005295 | Ga0065707_10292074 | Ga0065707_102920742 | 240 |
| 50 | 3300005327 | Ga0070658_10058094 | Ga0070658_100580942 | 240 |
| 51 | 3300005339 | Ga0070660_100552513 | Ga0070660_1005525131 | 240 |
| 52 | 3300005366 | Ga0070659_100284596 | Ga0070659_1002845961 | 240 |
| 53 | 3300005435 | Ga0070714_100458563 | Ga0070714_1004585632 | 240 |
| 54 | 3300005436 | Ga0070713_100006755 | Ga0070713_1000067557 | 240 |
| 55 | 3300005436 | Ga0070713_100140810 | Ga0070713_1001408103 | 240 |
| 56 | 3300005437 | Ga0070710_10038810 | Ga0070710_100388102 | 240 |
| 57 | 3300005437 | Ga0070710_10082579 | Ga0070710_100825792 | 240 |
| 58 | 3300005437 | Ga0070710_10373336 | Ga0070710_103733361 | 240 |
| 59 | 3300005439 | Ga0070711_100009303 | Ga0070711_1000093031 | 240 |
| 60 | 3300005439 | Ga0070711_100165230 | Ga0070711_1001652302 | 240 |
| 61 | 3300005445 | Ga0070708_100476843 | Ga0070708_1004768432 | 240 |
| 62 | 3300005458 | Ga0070681_10024498 | Ga0070681_100244983 | 240 |
| 63 | 3300005458 | Ga0070681_10036226 | Ga0070681_100362262 | 240 |
| 64 | 3300005467 | Ga0070706_100111258 | Ga0070706_1001112581 | 240 |
| 65 | 3300005468 | Ga0070707_100028915 | Ga0070707_1000289155 | 240 |
| 66 | 3300005471 | Ga0070698_100124719 | Ga0070698_1001247193 | 240 |
| 67 | 3300005471 | Ga0070698_100251283 | Ga0070698_1002512831 | 240 |
| 68 | 3300005518 | Ga0070699_100157937 | Ga0070699_1001579372 | 240 |
| 69 | 3300005518 | Ga0070699_100281063 | Ga0070699_1002810631 | 240 |
| 70 | 3300005530 | Ga0070679_100016699 | Ga0070679_1000166999 | 240 |
| 71 | 3300005549 | Ga0070704_100281018 | Ga0070704_1002810181 | 240 |
| 72 | 3300005563 | Ga0068855_100186595 | Ga0068855_1001865952 | 240 |
| 73 | 3300005614 | Ga0068856_100335603 | Ga0068856_1003356032 | 240 |
| 74 | 3300005616 | Ga0068852_100119076 | Ga0068852_1001190762 | 240 |
| 75 | 3300005842 | Ga0068858_100604710 | Ga0068858_1006047102 | 240 |
| 76 | 3300005844 | Ga0068862_100435460 | Ga0068862_1004354602 | 240 |
| 77 | 3300005937 | Ga0081455_10149166 | Ga0081455_101491661 | 240 |
| 78 | 3300005983 | Ga0081540_1028334 | Ga0081540_10283343 | 240 |
| 79 | 3300006028 | Ga0070717_10089701 | Ga0070717_100897012 | 240 |
| 80 | 3300006028 | Ga0070717_10360305 | Ga0070717_103603051 | 240 |
| 81 | 3300006028 | Ga0070717_10595472 | Ga0070717_105954721 | 240 |
| 82 | 3300006048 | Ga0075363_100009164 | Ga0075363_1000091641 | 240 |
| 83 | 3300006173 | Ga0070716_100105010 | Ga0070716_1001050102 | 240 |
| 84 | 3300006175 | Ga0070712_100096135 | Ga0070712_1000961352 | 240 |
| 85 | 3300006175 | Ga0070712_100232790 | Ga0070712_1002327901 | 240 |
| 86 | 3300006177 | Ga0075362_10059905 | Ga0075362_100599052 | 240 |
| 87 | 3300006178 | Ga0075367_10032629 | Ga0075367_100326292 | 240 |
| 88 | 3300006186 | Ga0075369_10091784 | Ga0075369_100917842 | 240 |
| 89 | 3300006195 | Ga0075366_10039884 | Ga0075366_100398842 | 240 |
| 90 | 3300006871 | Ga0075434_100260794 | Ga0075434_1002607942 | 240 |
| 91 | 3300006914 | Ga0075436_100079970 | Ga0075436_1000799702 | 240 |
| 92 | 3300007076 | Ga0075435_100154210 | Ga0075435_1001542102 | 240 |
| 93 | 3300007265 | Ga0099794_10163121 | Ga0099794_101631211 | 240 |
| 94 | 3300007788 | Ga0099795_10110623 | Ga0099795_101106231 | 240 |
| 95 | 3300009093 | Ga0105240_10003036 | Ga0105240_100030366 | 240 |
| 96 | 3300009093 | Ga0105240_10025347 | Ga0105240_100253478 | 240 |
| 97 | 3300009093 | Ga0105240_10258434 | Ga0105240_102584342 | 240 |
| 98 | 3300009093 | Ga0105240_10336213 | Ga0105240_103362132 | 240 |
| 99 | 3300009147 | Ga0114129_10845407 | Ga0114129_108454071 | 240 |
| 100 | 3300009176 | Ga0105242_10135783 | Ga0105242_101357832 | 240 |
| 101 | 3300009551 | Ga0105238_10011178 | Ga0105238_100111788 | 240 |
| 102 | 3300009551 | Ga0105238_10391735 | Ga0105238_103917351 | 240 |
| 103 | 3300010159 | Ga0099796_10055231 | Ga0099796_100552312 | 240 |
| 104 | 3300010375 | Ga0105239_10849277 | Ga0105239_108492772 | 240 |
| 105 | 3300011119 | Ga0105246_10500555 | Ga0105246_105005552 | 240 |
| 106 | 3300013100 | Ga0157373_10406519 | Ga0157373_104065191 | 240 |
| 107 | 3300013296 | Ga0157374_10522403 | Ga0157374_105224031 | 240 |
| 108 | 3300013306 | Ga0163162_10551795 | Ga0163162_105517952 | 240 |
| 109 | 3300013306 | Ga0163162_10567544 | Ga0163162_105675442 | 240 |
| 110 | 3300013307 | Ga0157372_10039606 | Ga0157372_100396063 | 240 |
| 111 | 3300013307 | Ga0157372_10759291 | Ga0157372_107592912 | 240 |
| 112 | 3300014325 | Ga0163163_10076811 | Ga0163163_100768113 | 240 |
| 113 | 3300014325 | Ga0163163_10350762 | Ga0163163_103507622 | 240 |
| 114 | 3300014325 | Ga0163163_11024820 | Ga0163163_110248201 | 240 |
| 115 | 3300014745 | Ga0157377_10213100 | Ga0157377_102131002 | 240 |
| 116 | 3300014969 | Ga0157376_10028940 | Ga0157376_100289405 | 240 |
| 117 | 3300014969 | Ga0157376_10166182 | Ga0157376_101661822 | 240 |
| 118 | 3300021361 | Ga0213872_10060345 | Ga0213872_100603451 | 240 |
| 119 | 3300021377 | Ga0213874_10089466 | Ga0213874_100894661 | 240 |
| 120 | 3300021388 | Ga0213875_10000198 | Ga0213875_1000019814 | 240 |
| 121 | 3300021388 | Ga0213875_10000530 | Ga0213875_1000053024 | 240 |
| 122 | 3300025898 | Ga0207692_10329993 | Ga0207692_103299931 | 240 |
| 123 | 3300025901 | Ga0207688_10306232 | Ga0207688_103062321 | 240 |
| 124 | 3300025906 | Ga0207699_10061748 | Ga0207699_100617483 | 240 |
| 125 | 3300025912 | Ga0207707_10026437 | Ga0207707_100264376 | 240 |
| 126 | 3300025912 | Ga0207707_10037172 | Ga0207707_100371722 | 240 |
| 127 | 3300025912 | Ga0207707_10315018 | Ga0207707_103150182 | 240 |
| 128 | 3300025912 | Ga0207707_10413120 | Ga0207707_104131202 | 240 |
| 129 | 3300025913 | Ga0207695_10000939 | Ga0207695_1000093938 | 240 |
| 130 | 3300025913 | Ga0207695_10009429 | Ga0207695_100094298 | 240 |
| 131 | 3300025913 | Ga0207695_10189120 | Ga0207695_101891202 | 240 |
| 132 | 3300025915 | Ga0207693_10003109 | Ga0207693_100031097 | 240 |
| 133 | 3300025915 | Ga0207693_10053360 | Ga0207693_100533602 | 240 |
| 134 | 3300025915 | Ga0207693_10074517 | Ga0207693_100745172 | 240 |
| 135 | 3300025915 | Ga0207693_10179658 | Ga0207693_101796582 | 240 |
| 136 | 3300025916 | Ga0207663_10481098 | Ga0207663_104810981 | 240 |
| 137 | 3300025919 | Ga0207657_10047483 | Ga0207657_100474833 | 240 |
| 138 | 3300025921 | Ga0207652_10082002 | Ga0207652_100820024 | 240 |
| 139 | 3300025922 | Ga0207646_10018288 | Ga0207646_100182884 | 240 |
| 140 | 3300025924 | Ga0207694_10033633 | Ga0207694_100336332 | 240 |
| 141 | 3300025928 | Ga0207700_10065878 | Ga0207700_100658782 | 240 |
| 142 | 3300025928 | Ga0207700_10155689 | Ga0207700_101556891 | 240 |
| 143 | 3300025929 | Ga0207664_10262677 | Ga0207664_102626772 | 240 |
| 144 | 3300025931 | Ga0207644_10380386 | Ga0207644_103803862 | 240 |
| 145 | 3300025932 | Ga0207690_10001563 | Ga0207690_100015633 | 240 |
| 146 | 3300025939 | Ga0207665_10113140 | Ga0207665_101131401 | 240 |
| 147 | 3300025939 | Ga0207665_10220979 | Ga0207665_102209792 | 240 |
| 148 | 3300025945 | Ga0207679_10688293 | Ga0207679_106882931 | 240 |
| 149 | 3300025949 | Ga0207667_10035837 | Ga0207667_100358376 | 240 |
| 150 | 3300026023 | Ga0207677_10425509 | Ga0207677_104255092 | 240 |
| 151 | 3300026041 | Ga0207639_10119559 | Ga0207639_101195592 | 240 |
| 152 | 3300026078 | Ga0207702_10038821 | Ga0207702_100388214 | 240 |
| 153 | 3300026078 | Ga0207702_10203901 | Ga0207702_102039012 | 240 |
| 154 | 3300026088 | Ga0207641_11072633 | Ga0207641_110726331 | 240 |
| 155 | 3300026142 | Ga0207698_10120749 | Ga0207698_101207492 | 240 |
| 156 | 3300027907 | Ga0207428_10034164 | Ga0207428_100341645 | 240 |
| 157 | 3300028800 | Ga0265338_10020869 | Ga0265338_100208698 | 240 |
| 158 | 3300028800 | Ga0265338_10185108 | Ga0265338_101851083 | 240 |
| 159 | 3300031249 | Ga0265339_10005853 | Ga0265339_100058533 | 240 |
| 160 | 3300031250 | Ga0265331_10011169 | Ga0265331_100111692 | 240 |
| 161 | 3300031251 | Ga0265327_10000275 | Ga0265327_1000027558 | 240 |
| 162 | 3300031344 | Ga0265316_10079226 | Ga0265316_100792263 | 240 |
| 163 | 3300031595 | Ga0265313_10000079 | Ga0265313_1000007966 | 240 |
| 164 | 3300031712 | Ga0265342_10051506 | Ga0265342_100515062 | 240 |
| 165 | 3300035086 | Ga0373934_0006346 | Ga0373934_0006346_2192_2914 | 240 |
| 166 | 3300035111 | Ga0373923_0150195 | Ga0373923_0150195_308_1030 | 240 |
| 167 | 3300035112 | Ga0373932_0110285 | Ga0373932_0110285_111_833 | 240 |
| 168 | 3300035113 | Ga0373936_0046603 | Ga0373936_0046603_607_1329 | 240 |
| 169 | 3300035116 | Ga0373945_0049149 | Ga0373945_0049149_70_792 | 240 |
| 170 | 3300035117 | Ga0373953_0012310 | Ga0373953_0012310_1224_1946 | 240 |
| 171 | 3300035117 | Ga0373953_0113331 | Ga0373953_0113331_173_895 | 240 |
| 172 | 3300035118 | Ga0373954_0005687 | Ga0373954_0005687_4072_4794 | 240 |
| 173 | 3300035118 | Ga0373954_0153427 | Ga0373954_0153427_379_1101 | 240 |
| 174 | 3300035119 | Ga0373956_0064168 | Ga0373956_0064168_68_790 | 240 |
| 175 | 3300035120 | Ga0373957_0015184 | Ga0373957_0015184_518_1240 | 240 |
| 176 | 3300035120 | Ga0373957_0047412 | Ga0373957_0047412_171_893 | 240 |
| 177 | 3300035170 | Ga0373943_0145355 | Ga0373943_0145355_543_1265 | 240 |
| 178 | 3300035171 | Ga0373946_0077706 | Ga0373946_0077706_557_1279 | 240 |
| 179 | 3300035172 | Ga0373955_0064234 | Ga0373955_0064234_20_742 | 240 |
| 180 | 3300035172 | Ga0373955_0247149 | Ga0373955_0247149_85_807 | 240 |
| 181 | 3300035410 | Ga0373924_0041109 | Ga0373924_0041109_545_1267 | 240 |
| 182 | 3300035692 | Ga0373935_0039458 | Ga0373935_0039458_2064_2786 | 240 |
| 183 | 3300035692 | Ga0373935_0049845 | Ga0373935_0049845_219_941 | 240 |
| 184 | 3300035692 | Ga0373935_0208252 | Ga0373935_0208252_348_1070 | 240 |
| 185 | 3300035692 | Ga0373935_0271825 | Ga0373935_0271825_100_822 | 240 |
| 186 | 3300035695 | Ga0373927_0099679 | Ga0373927_0099679_575_1297 | 240 |
| 187 | 3300035724 | Ga0373933_0006031 | Ga0373933_0006031_5437_6159 | 240 |
| 188 | 3300035724 | Ga0373933_0062635 | Ga0373933_0062635_953_1675 | 240 |
| 189 | 3300035725 | Ga0373947_0016990 | Ga0373947_0016990_421_1143 | 240 |
| 190 | 3300036401 | Ga0373937_0022330 | Ga0373937_0022330_330_1052 | 240 |
| 191 | 3300036401 | Ga0373937_0025566 | Ga0373937_0025566_4550_5272 | 240 |
| 192 | 3300036401 | Ga0373937_0071551 | Ga0373937_0071551_2225_2947 | 240 |
| 193 | 3300036401 | Ga0373937_0210271 | Ga0373937_0210271_655_1377 | 240 |
| 194 | 3300036457 | Ga0265778_024193 | Ga0265778_024193_11_733 | 240 |
| 195 | 3300037068 | Ga0373925_0076178 | Ga0373925_0076178_1302_2024 | 240 |
| 196 | 3300037068 | Ga0373925_0211371 | Ga0373925_0211371_526_1248 | 240 |
| 197 | 3300037068 | Ga0373925_0274166 | Ga0373925_0274166_144_866 | 240 |
| 198 | 3300037068 | Ga0373925_0414261 | Ga0373925_0414261_37_762 | 240 |
| 199 | 3300037853 | Ga0436364_0022735 | Ga0436364_0022735_27122_27844 | 240 |
| 200 | 3300037853 | Ga0436364_0072060 | Ga0436364_0072060_1292_2014 | 240 |
| 201 | 3300037853 | Ga0436364_1070807 | Ga0436364_1070807_27086_27808 | 240 |
| 202 | 3300039437 | Ga0436365_0071266 | Ga0436365_0071266_290_1012 | 240 |
| 203 | 3300039437 | Ga0436365_0755142 | Ga0436365_0755142_459_1181 | 240 |
| 204 | 3300039437 | Ga0436365_1109782 | Ga0436365_1109782_128_850 | 240 |
| 205 | 3300039437 | Ga0436365_1396677 | Ga0436365_1396677_1176_1898 | 240 |
| 206 | 3300039438 | Ga0436360_0564101 | Ga0436360_0564101_366_1088 | 240 |
| 207 | 3300039438 | Ga0436360_0657821 | Ga0436360_0657821_997_1719 | 240 |
| 208 | 3300039447 | Ga0436361_0310288 | Ga0436361_0310288_282_1007 | 240 |
| 209 | 3300039447 | Ga0436361_0699975 | Ga0436361_0699975_2660_3385 | 240 |
| 210 | 3300039450 | Ga0436363_1079299 | Ga0436363_1079299_76_801 | 240 |
| 211 | 3300039450 | Ga0436363_1259167 | Ga0436363_1259167_241_981 | 240 |
| 212 | 3300039450 | Ga0436363_1341696 | Ga0436363_1341696_173_895 | 240 |
| 213 | 3300039450 | Ga0436363_1502795 | Ga0436363_1502795_623_1345 | 240 |
| 214 | 3300039450 | Ga0436363_1505184 | Ga0436363_1505184_497_1219 | 240 |
| 215 | 3300039453 | Ga0436362_1076623 | Ga0436362_1076623_1117_1839 | 240 |
| 216 | 3300039453 | Ga0436362_1292843 | Ga0436362_1292843_595_1350 | 240 |
| 217 | 3300044694 | Ga0466963_0090473 | Ga0466963_0090473_996_1718 | 240 |
| 218 | 3300045976 | Ga0466967_0750081 | Ga0466967_0750081_183_926 | 240 |
| 219 | 3300046454 | Ga0495592_0045481 | Ga0495592_0045481_1779_2501 | 240 |
| 220 | 3300046454 | Ga0495592_0199694 | Ga0495592_0199694_244_966 | 240 |
| 221 | 3300046459 | Ga0495629_0212238 | Ga0495629_0212238_401_1126 | 240 |
| 222 | 3300046460 | Ga0495638_0005990 | Ga0495638_0005990_7752_8474 | 240 |
| 223 | 3300046462 | Ga0495651_0127627 | Ga0495651_0127627_674_1396 | 240 |
| 224 | 3300046472 | Ga0495580_0064209 | Ga0495580_0064209_820_1542 | 240 |
| 225 | 3300046475 | Ga0495639_0061726 | Ga0495639_0061726_716_1438 | 240 |
| 226 | 3300046476 | Ga0495662_0055118 | Ga0495662_0055118_219_941 | 240 |
| 227 | 3300046477 | Ga0495664_0000595 | Ga0495664_0000595_4761_5483 | 240 |
| 228 | 3300046499 | Ga0495594_0179837 | Ga0495594_0179837_423_1145 | 240 |
| 229 | 3300046514 | Ga0495618_0115566 | Ga0495618_0115566_535_1257 | 240 |
| 230 | 3300046517 | Ga0495630_0118304 | Ga0495630_0118304_351_1073 | 240 |
| 231 | 3300046517 | Ga0495630_0433062 | Ga0495630_0433062_84_806 | 240 |
| 232 | 3300046529 | Ga0495652_0287581 | Ga0495652_0287581_421_1143 | 240 |
| 233 | 3300046533 | Ga0495640_0051028 | Ga0495640_0051028_1974_2696 | 240 |
| 234 | 3300046533 | Ga0495640_0133305 | Ga0495640_0133305_456_1178 | 240 |
| 235 | 3300046535 | Ga0495586_0017143 | Ga0495586_0017143_2616_3338 | 240 |
| 236 | 3300046536 | Ga0495587_0004538 | Ga0495587_0004538_7467_8189 | 240 |
| 237 | 3300046559 | Ga0495667_0243746 | Ga0495667_0243746_46_768 | 240 |
| 238 | 3300046559 | Ga0495667_0273276 | Ga0495667_0273276_227_949 | 240 |
| 239 | 3300046642 | Ga0495634_0270801 | Ga0495634_0270801_230_1012 | 240 |
| 240 | 3300046663 | Ga0495635_0038535 | Ga0495635_0038535_85_807 | 240 |
| 241 | 3300046678 | Ga0495599_0028271 | Ga0495599_0028271_258_980 | 240 |
| 242 | 3300046679 | Ga0495623_0156071 | Ga0495623_0156071_264_986 | 240 |
| 243 | 3300046680 | Ga0495646_0005725 | Ga0495646_0005725_1961_2683 | 240 |
| 244 | 3300046809 | Ga0495600_0040777 | Ga0495600_0040777_1755_2477 | 240 |
| 245 | 3300046809 | Ga0495600_0076961 | Ga0495600_0076961_1378_2100 | 240 |
| 246 | 3300047317 | Ga0495604_0018987 | Ga0495604_0018987_3745_4467 | 240 |
| 247 | 3300047319 | Ga0495674_0128247 | Ga0495674_0128247_229_951 | 240 |
| 248 | 3300047320 | Ga0495672_0217613 | Ga0495672_0217613_82_807 | 240 |
| 249 | 3300047322 | Ga0495680_0041766 | Ga0495680_0041766_2218_2940 | 240 |
| 250 | 3300047444 | Ga0495675_0132671 | Ga0495675_0132671_625_1347 | 240 |
| 251 | 3300047471 | Ga0495684_0121613 | Ga0495684_0121613_726_1448 | 240 |
| 252 | 3300047471 | Ga0495684_0266887 | Ga0495684_0266887_405_1127 | 240 |
| 253 | 3300048088 | Ga0495602_0000574 | Ga0495602_0000574_2372_3094 | 240 |
| 254 | 3300048913 | Ga0496110_0106080 | Ga0496110_0106080_1659_2381 | 240 |
| 255 | 3300048914 | Ga0496111_0236198 | Ga0496111_0236198_115_837 | 240 |
| 256 | 3300048915 | Ga0496112_0283498 | Ga0496112_0283498_830_1552 | 240 |
| 257 | 3300048916 | Ga0496113_0026789 | Ga0496113_0026789_2956_3678 | 240 |
| 258 | 3300048924 | Ga0496121_0101548 | Ga0496121_0101548_51_776 | 240 |
| 259 | 3300048929 | Ga0496126_0091836 | Ga0496126_0091836_668_1393 | 240 |
| 260 | 3300049586 | Ga0501070_0301279 | Ga0501070_0301279_520_1257 | 240 |
| 261 | 3300050489 | nmdc:mga03683_91029_c1 | nmdc:mga03683_91029_c1_182_925 | 240 |
| 262 | 3300050490 | nmdc:mga03n38_3767_c1 | nmdc:mga03n38_3767_c1_44_787 | 240 |
| 263 | 3300050492 | nmdc:mga0yw44_274_c1 | nmdc:mga0yw44_274_c1_4807_5550 | 240 |
| 264 | 3300050492 | nmdc:mga0yw44_57680_c2 | nmdc:mga0yw44_57680_c2_752_1495 | 240 |
| 265 | 3300050493 | nmdc:mga0k408_43501_c1 | nmdc:mga0k408_43501_c1_649_1392 | 240 |
| 266 | 3300050494 | nmdc:mga06z11_154623_c1 | nmdc:mga06z11_154623_c1_71_814 | 240 |
| 267 | 3300050496 | nmdc:mga07m45_47896_c1 | nmdc:mga07m45_47896_c1_332_1075 | 240 |
| 268 | 3300050511 | nmdc:mga08y16_99026_c1 | nmdc:mga08y16_99026_c1_300_1022 | 240 |
| 269 | 3300050513 | nmdc:mga0rr50_62192_c1 | nmdc:mga0rr50_62192_c1_1320_2042 | 240 |
| 270 | 3300050516 | nmdc:mga0sz30_70160_c1 | nmdc:mga0sz30_70160_c1_223_966 | 240 |
| 271 | 3300053077 | Ga0495601_0010161 | Ga0495601_0010161_2841_3563 | 240 |
| 272 | 3300053077 | Ga0495601_0021627 | Ga0495601_0021627_2264_2986 | 240 |
| 273 | 3300053077 | Ga0495601_0184681 | Ga0495601_0184681_567_1349 | 240 |
| 274 | 3300053078 | Ga0495612_0004207 | Ga0495612_0004207_1464_2186 | 240 |
| 275 | 3300053084 | Ga0495595_0021092 | Ga0495595_0021092_481_1203 | 240 |
| 276 | 3300053085 | Ga0495619_0017025 | Ga0495619_0017025_244_966 | 240 |
| 277 | 3300053085 | Ga0495619_0033424 | Ga0495619_0033424_719_1441 | 240 |
| 278 | 3300053085 | Ga0495619_0067073 | Ga0495619_0067073_1567_2289 | 240 |
| 279 | 3300053087 | Ga0500643_000050 | Ga0500643_000050_12573_13325 | 240 |
| 280 | 3300053119 | Ga0500595_018677 | Ga0500595_018677_1739_2479 | 240 |
| 281 | 3300053136 | Ga0500559_0044281 | Ga0500559_0044281_1008_1730 | 240 |
| 282 | 3300053139 | Ga0500568_0040215 | Ga0500568_0040215_205_948 | 240 |
| 283 | 3300059630 | Ga0587128_008573 | Ga0587128_008573_267_1115 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9732 | 3 | 204 |
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9727 | 1 | 205 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9717 | 1 | 205 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9624 | 1 | 205 |
| 4ecj-assembly1.cif.gz_B | crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione | 0.9618 | 1 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9956 | 3 | 86 | 3.40.30.10 |
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9945 | 1 | 84 | 3.40.30.10 |
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9715 | 1 | 84 | 3.40.30.10 |
| 4eciA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9561 | 1 | 85 | 3.40.30.10 |
| 4mf6A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9536 | 2 | 84 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382KR11-F1-model_v4 | GST N-terminal domain-containing protein | 0.9973 | 1 | 208 |
|
| AF-A0A382KR11-F1-model_v4 | GST N-terminal domain-containing protein | 0.9925 | 1 | 208 |
|
| AF-A0A0S8AWI8-F1-model_v4 | Glutathione S-transferase | 0.9921 | 1 | 101 |
GO:0016740
|
| AF-A0A3C0KY15-F1-model_v4 | GST N-terminal domain-containing protein | 0.9911 | 12 | 164 |
|
| AF-A0A447N7A1-F1-model_v4 | Glutathione-S transferase | 0.9908 | 1 | 84 |
GO:0015036
GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar