F385807

General Info

Members Datasets Scaffolds Average Seq Length
283 192 283 241

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0065202|Ga0495684_0065202_645_1523
Length 292
Sequence MYDIHYWPTPNGKKVTILLEELGVQYKVVPCNIGRGDQFTPEFLKMNPNHRMPVLVDHNPAGGGEPIAIFESGAMMLYIAEKEGRFFPQALRPRYQVMQWLIWQMANQGPKSGECGHFRRLDASKGDQTYAVTRFTDEVNRLFGVLNNRLYESRYLAGDEYTIADMISYPWTVNWKAQGQDIEEFKYFKRWFEELGARPGVQRGMAVGADLPGDPSAVTPEEQARPAGAGVAGAGGCHVRHRMLLRLLEPVDLFCLPQPAAHAEGVGHRHRLAADPGRRRVQRGQSQRAQFA

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 2.12
Rhizosphere 85.87
Stem 0
Stem Tuber 0
Unclassified 6.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_12216272 3300004803 Bacteria 982
2 Ga0065712_10263036 3300005290 Bacteria 932
3 Ga0065715_10209667 3300005293 Bacteria 1320
4 Ga0065707_10292074 3300005295 Bacteria 1023
5 Ga0070658_10058094 3300005327 Bacteria 3148
6 Ga0070690_100620202 3300005330 Bacteria 823
7 Ga0070660_100552513 3300005339 Bacteria 961
8 Ga0070668_100126536 3300005347 Bacteria 2047
9 Ga0070659_100284596 3300005366 Bacteria 1376
10 Ga0070714_100458563 3300005435 Bacteria 1211
11 Ga0070713_100006755 3300005436 Bacteria 7995
12 Ga0070713_100140810 3300005436 Bacteria 2136
13 Ga0070710_10038810 3300005437 Bacteria 2617
14 Ga0070710_10082579 3300005437 Bacteria 1879
15 Ga0070710_10373336 3300005437 Bacteria 950
16 Ga0070711_100009303 3300005439 Bacteria 6045
17 Ga0070711_100165230 3300005439 Bacteria 1682
18 Ga0070708_100476843 3300005445 Bacteria 1177
19 Ga0070681_10024498 3300005458 Bacteria 6074
20 Ga0070681_10036226 3300005458 Bacteria 4955
21 Ga0070706_100111258 3300005467 Bacteria 2548
22 Ga0070707_100028915 3300005468 Bacteria 5275
23 Ga0070698_100124719 3300005471 Bacteria 2533
24 Ga0070698_100251283 3300005471 Bacteria 1701
25 Ga0070699_100157937 3300005518 Bacteria 2007
26 Ga0070699_100281063 3300005518 Bacteria 1491
27 Ga0070679_100016699 3300005530 Bacteria 7090
28 Ga0070697_100049027 3300005536 Bacteria 3426
29 Ga0070695_100000711 3300005545 Bacteria 17788
30 Ga0070704_100281018 3300005549 Bacteria 1379
31 Ga0070704_100726667 3300005549 Bacteria 882
32 Ga0068855_100186595 3300005563 Bacteria 2342
33 Ga0068856_100335603 3300005614 Bacteria 1530
34 Ga0068852_100119076 3300005616 Bacteria 2414
35 Ga0068861_100271951 3300005719 Bacteria 1455
36 Ga0068861_100285576 3300005719 Bacteria 1423
37 Ga0068858_100604710 3300005842 Unclassified 1064
38 Ga0068862_100435460 3300005844 Bacteria 1233
39 Ga0081455_10000302 3300005937 Bacteria 65101
40 Ga0081455_10149166 3300005937 Bacteria 1805
41 Ga0081540_1000338 3300005983 Bacteria 48150
42 Ga0081540_1028334 3300005983 Bacteria 3148
43 Ga0081539_10030530 3300005985 Bacteria 3343
44 Ga0070717_10089701 3300006028 Bacteria 2593
45 Ga0070717_10360305 3300006028 Bacteria 1301
46 Ga0070717_10595472 3300006028 Bacteria 1003
47 Ga0075363_100009164 3300006048 Bacteria 4647
48 Ga0070716_100105010 3300006173 Bacteria 1740
49 Ga0070712_100096135 3300006175 Bacteria 2180
50 Ga0070712_100232790 3300006175 Bacteria 1464
51 Ga0075362_10059905 3300006177 Bacteria 1720
52 Ga0075367_10032629 3300006178 Bacteria 2998
53 Ga0075369_10091784 3300006186 Bacteria 1356
54 Ga0075366_10039884 3300006195 Bacteria 2776
55 Ga0075428_100054329 3300006844 Bacteria 4389
56 Ga0075428_100155336 3300006844 Bacteria 2486
57 Ga0075433_10163995 3300006852 Bacteria 1978
58 Ga0075434_100004320 3300006871 Bacteria 12779
59 Ga0075434_100260794 3300006871 Bacteria 1752
60 Ga0075429_100398126 3300006880 Bacteria 1206
61 Ga0075436_100079970 3300006914 Bacteria 2264
62 Ga0075435_100014130 3300007076 Bacteria 5958
63 Ga0075435_100154210 3300007076 Bacteria 1932
64 Ga0099794_10163121 3300007265 Bacteria 1134
65 Ga0099795_10110623 3300007788 Bacteria 1088
66 Ga0105240_10003036 3300009093 Bacteria 26403
67 Ga0105240_10025347 3300009093 Bacteria 7795
68 Ga0105240_10258434 3300009093 Bacteria 2010
69 Ga0105240_10336213 3300009093 Bacteria 1717
70 Ga0111539_10023877 3300009094 Bacteria 7511
71 Ga0111539_10149299 3300009094 Bacteria 2736
72 Ga0114129_10027883 3300009147 Bacteria 7997
73 Ga0114129_10845407 3300009147 Bacteria 1164
74 Ga0105242_10135783 3300009176 Bacteria 2128
75 Ga0105238_10011178 3300009551 Bacteria 9031
76 Ga0105238_10391735 3300009551 Bacteria 1382
77 Ga0099796_10055231 3300010159 Bacteria 1390
78 Ga0105239_10849277 3300010375 Bacteria 1047
79 Ga0105246_10500555 3300011119 Bacteria 1032
80 Ga0157373_10406519 3300013100 Bacteria 976
81 Ga0157374_10522403 3300013296 Bacteria 1193
82 Ga0163162_10551795 3300013306 Bacteria 1280
83 Ga0163162_10567544 3300013306 Bacteria 1262
84 Ga0163162_10783820 3300013306 Bacteria 1071
85 Ga0157372_10039606 3300013307 Bacteria 5201
86 Ga0157372_10759291 3300013307 Bacteria 1127
87 Ga0157375_10299507 3300013308 Bacteria 1772
88 Ga0157375_10901378 3300013308 Bacteria 1028
89 Ga0163163_10076811 3300014325 Bacteria 3335
90 Ga0163163_10350762 3300014325 Bacteria 1532
91 Ga0163163_11024820 3300014325 Bacteria 889
92 Ga0157380_10727009 3300014326 Bacteria 1001
93 Ga0157377_10213100 3300014745 Bacteria 1233
94 Ga0157376_10028940 3300014969 Bacteria 4410
95 Ga0157376_10166182 3300014969 Bacteria 2005
96 Ga0163161_10194905 3300017792 Bacteria 1559
97 Ga0213872_10060345 3300021361 Bacteria 1715
98 Ga0213874_10089466 3300021377 Bacteria 1009
99 Ga0213875_10000198 3300021388 Bacteria 61683
100 Ga0213875_10000530 3300021388 Bacteria 31543
101 Ga0207692_10329993 3300025898 Bacteria 936
102 Ga0207688_10306232 3300025901 Bacteria 972
103 Ga0207699_10061748 3300025906 Bacteria 2256
104 Ga0207707_10026437 3300025912 Bacteria 5073
105 Ga0207707_10037172 3300025912 Bacteria 4254
106 Ga0207707_10315018 3300025912 Bacteria 1351
107 Ga0207707_10413120 3300025912 Bacteria 1158
108 Ga0207695_10000939 3300025913 Bacteria 51994
109 Ga0207695_10009429 3300025913 Bacteria 12074
110 Ga0207695_10189120 3300025913 Bacteria 1977
111 Ga0207693_10003109 3300025915 Bacteria 14279
112 Ga0207693_10053360 3300025915 Bacteria 3172
113 Ga0207693_10074517 3300025915 Bacteria 2658
114 Ga0207693_10179658 3300025915 Bacteria 1665
115 Ga0207663_10481098 3300025916 Bacteria 962
116 Ga0207657_10047483 3300025919 Bacteria 3754
117 Ga0207652_10082002 3300025921 Bacteria 2821
118 Ga0207646_10018288 3300025922 Bacteria 6540
119 Ga0207694_10033633 3300025924 Bacteria 3927
120 Ga0207700_10065878 3300025928 Bacteria 2766
121 Ga0207700_10155689 3300025928 Bacteria 1893
122 Ga0207664_10262677 3300025929 Bacteria 1510
123 Ga0207644_10380386 3300025931 Bacteria 1151
124 Ga0207690_10001563 3300025932 Bacteria 14344
125 Ga0207670_10446587 3300025936 Bacteria 1042
126 Ga0207665_10113140 3300025939 Bacteria 1909
127 Ga0207665_10220979 3300025939 Bacteria 1388
128 Ga0207679_10688293 3300025945 Bacteria 927
129 Ga0207667_10035837 3300025949 Bacteria 5322
130 Ga0207668_10124877 3300025972 Bacteria 1955
131 Ga0207677_10425509 3300026023 Bacteria 1132
132 Ga0207639_10119559 3300026041 Bacteria 2162
133 Ga0207702_10038821 3300026078 Bacteria 3988
134 Ga0207702_10203901 3300026078 Bacteria 1835
135 Ga0207641_11072633 3300026088 Bacteria 804
136 Ga0207675_100063620 3300026118 Bacteria 3447
137 Ga0207675_100397215 3300026118 Bacteria 1358
138 Ga0207698_10120749 3300026142 Bacteria 2217
139 Ga0207428_10034164 3300027907 Bacteria 4170
140 Ga0265338_10020869 3300028800 Bacteria 6864
141 Ga0265338_10185108 3300028800 Bacteria 1584
142 Ga0265339_10005853 3300031249 Bacteria 8152
143 Ga0265331_10011169 3300031250 Bacteria 4926
144 Ga0265327_10000275 3300031251 Bacteria 101668
145 Ga0265316_10079226 3300031344 Bacteria 2521
146 Ga0265313_10000079 3300031595 Bacteria 95515
147 Ga0265342_10051506 3300031712 Bacteria 2456
148 Ga0373958_0049288 3300034819 Bacteria 885
149 Ga0373934_0006346 3300035086 Bacteria 4385
150 Ga0373923_0150195 3300035111 Bacteria 1058
151 Ga0373932_0110285 3300035112 Bacteria 906
152 Ga0373936_0046603 3300035113 Bacteria 1748
153 Ga0373945_0049149 3300035116 Bacteria 1547
154 Ga0373953_0012310 3300035117 Bacteria 3026
155 Ga0373953_0113331 3300035117 Bacteria 1148
156 Ga0373954_0005687 3300035118 Bacteria 5407
157 Ga0373954_0153427 3300035118 Bacteria 1126
158 Ga0373956_0064168 3300035119 Bacteria 1667
159 Ga0373957_0015184 3300035120 Bacteria 2647
160 Ga0373957_0047412 3300035120 Bacteria 1634
161 Ga0373943_0145355 3300035170 Bacteria 1281
162 Ga0373946_0077706 3300035171 Bacteria 1447
163 Ga0373955_0064234 3300035172 Bacteria 2034
164 Ga0373955_0247149 3300035172 Bacteria 1069
165 Ga0373961_0061780 3300035241 Bacteria 1139
166 Ga0373924_0041109 3300035410 Bacteria 1894
167 Ga0373931_0000929 3300035691 Bacteria 12312
168 Ga0373931_0193621 3300035691 Bacteria 1211
169 Ga0373935_0039458 3300035692 Bacteria 2961
170 Ga0373935_0049845 3300035692 Bacteria 2656
171 Ga0373935_0208252 3300035692 Bacteria 1354
172 Ga0373935_0271825 3300035692 Bacteria 1191
173 Ga0373927_0099679 3300035695 Bacteria 1889
174 Ga0373933_0006031 3300035724 Bacteria 6591
175 Ga0373933_0062635 3300035724 Bacteria 2247
176 Ga0373947_0016990 3300035725 Bacteria 4181
177 Ga0373937_0022330 3300036401 Bacteria 5689
178 Ga0373937_0025566 3300036401 Bacteria 5331
179 Ga0373937_0071551 3300036401 Bacteria 3198
180 Ga0373937_0210271 3300036401 Bacteria 1830
181 Ga0265778_024193 3300036457 Bacteria 763
182 Ga0373925_0076178 3300037068 Bacteria 2543
183 Ga0373925_0211371 3300037068 Bacteria 1545
184 Ga0373925_0274166 3300037068 Bacteria 1357
185 Ga0373925_0414261 3300037068 Bacteria 1100
186 Ga0373925_0434231 3300037068 Bacteria 1074
187 Ga0436364_0022735 3300037853 Bacteria 162985
188 Ga0436364_0072060 3300037853 Bacteria 2319
189 Ga0436364_1070807 3300037853 Bacteria 80692
190 Ga0436365_0071266 3300039437 Bacteria 1249
191 Ga0436365_0755142 3300039437 Bacteria 1242
192 Ga0436365_1109782 3300039437 Bacteria 1664
193 Ga0436365_1396677 3300039437 Bacteria 1979
194 Ga0436360_0564101 3300039438 Bacteria 1472
195 Ga0436360_0657821 3300039438 Bacteria 2982
196 Ga0436361_0310288 3300039447 Bacteria 6871
197 Ga0436361_0699975 3300039447 Bacteria 3493
198 Ga0436363_1079299 3300039450 Bacteria 865
199 Ga0436363_1259167 3300039450 Bacteria 1368
200 Ga0436363_1341696 3300039450 Bacteria 1316
201 Ga0436363_1502795 3300039450 Bacteria 2354
202 Ga0436363_1505184 3300039450 Bacteria 1833
203 Ga0436362_1076623 3300039453 Bacteria 2304
204 Ga0436362_1292843 3300039453 Bacteria 1768
205 Ga0466963_0090473 3300044694 Bacteria 2084
206 Ga0466967_0750081 3300045976 Bacteria 968
207 Ga0495592_0045481 3300046454 Bacteria 3276
208 Ga0495592_0199694 3300046454 Bacteria 1350
209 Ga0495629_0212238 3300046459 Bacteria 1337
210 Ga0495629_0227338 3300046459 Bacteria 1286
211 Ga0495638_0005990 3300046460 Bacteria 8912
212 Ga0495651_0127627 3300046462 Bacteria 1861
213 Ga0495580_0064209 3300046472 Bacteria 2574
214 Ga0495639_0061726 3300046475 Bacteria 1719
215 Ga0495639_0258563 3300046475 Bacteria 862
216 Ga0495662_0055118 3300046476 Bacteria 1921
217 Ga0495664_0000595 3300046477 Bacteria 18303
218 Ga0495594_0179837 3300046499 Bacteria 1204
219 Ga0495618_0115566 3300046514 Bacteria 1718
220 Ga0495630_0118304 3300046517 Bacteria 2010
221 Ga0495630_0433062 3300046517 Bacteria 1008
222 Ga0495652_0287581 3300046529 Bacteria 1201
223 Ga0495640_0051028 3300046533 Bacteria 2846
224 Ga0495640_0133305 3300046533 Bacteria 1606
225 Ga0495586_0017143 3300046535 Bacteria 3851
226 Ga0495587_0004538 3300046536 Bacteria 9121
227 Ga0495667_0243746 3300046559 Bacteria 1144
228 Ga0495667_0273276 3300046559 Bacteria 1073
229 Ga0495634_0270801 3300046642 Bacteria 1034
230 Ga0495635_0038535 3300046663 Bacteria 3309
231 Ga0495599_0028271 3300046678 Bacteria 3514
232 Ga0495623_0156071 3300046679 Bacteria 1345
233 Ga0495646_0005725 3300046680 Bacteria 7871
234 Ga0495600_0040777 3300046809 Bacteria 3025
235 Ga0495600_0076961 3300046809 Bacteria 2179
236 Ga0495604_0018987 3300047317 Bacteria 5505
237 Ga0495674_0128247 3300047319 Bacteria 2138
238 Ga0495672_0217613 3300047320 Bacteria 945
239 Ga0495680_0041766 3300047322 Bacteria 3644
240 Ga0495675_0132671 3300047444 Bacteria 1547
241 Ga0495684_0065202 3300047471 Bacteria 2769
242 Ga0495684_0121613 3300047471 Bacteria 1966
243 Ga0495684_0266887 3300047471 Bacteria 1240
244 Ga0495602_0000574 3300048088 Bacteria 34217
245 Ga0496110_0016881 3300048913 Bacteria 6101
246 Ga0496110_0106080 3300048913 Bacteria 2521
247 Ga0496111_0236198 3300048914 Bacteria 1358
248 Ga0496112_0195241 3300048915 Bacteria 1985
249 Ga0496112_0283498 3300048915 Bacteria 1603
250 Ga0496113_0026789 3300048916 Bacteria 4126
251 Ga0496121_0101548 3300048924 Bacteria 2218
252 Ga0496126_0091836 3300048929 Bacteria 2669
253 Ga0501047_0666152 3300049581 Bacteria 859
254 Ga0501048_0502497 3300049582 Bacteria 869
255 Ga0501070_0301279 3300049586 Bacteria 1306
256 nmdc:mga03683_91029_c1 3300050489 Bacteria 1330
257 nmdc:mga03n38_3767_c1 3300050490 Bacteria 4917
258 nmdc:mga0yw44_274_c1 3300050492 Bacteria 17652
259 nmdc:mga0yw44_57680_c2 3300050492 Bacteria 1564
260 nmdc:mga0k408_43501_c1 3300050493 Bacteria 2588
261 nmdc:mga06z11_154623_c1 3300050494 Bacteria 1307
262 nmdc:mga07m45_47896_c1 3300050496 Bacteria 2403
263 nmdc:mga05p37_1176751_c1 3300050507 Bacteria 795
264 nmdc:mga08y16_335342_c1 3300050511 Bacteria 1555
265 nmdc:mga08y16_527811_c1 3300050511 Bacteria 1197
266 nmdc:mga08y16_99026_c1 3300050511 Bacteria 3036
267 nmdc:mga0rr50_62192_c1 3300050513 Bacteria 2815
268 nmdc:mga0rr50_9450_c1 3300050513 Bacteria 6131
269 nmdc:mga0a205_264522_c1 3300050515 Bacteria 1597
270 nmdc:mga0sz30_70160_c1 3300050516 Bacteria 1507
271 Ga0495601_0010161 3300053077 Bacteria 5594
272 Ga0495601_0021627 3300053077 Bacteria 3940
273 Ga0495601_0184681 3300053077 Bacteria 1363
274 Ga0495612_0004207 3300053078 Bacteria 5967
275 Ga0495595_0021092 3300053084 Bacteria 2843
276 Ga0495619_0017025 3300053085 Bacteria 4607
277 Ga0495619_0033424 3300053085 Bacteria 3340
278 Ga0495619_0067073 3300053085 Bacteria 2395
279 Ga0500643_000050 3300053087 Bacteria 147005
280 Ga0500595_018677 3300053119 Bacteria 2531
281 Ga0500559_0044281 3300053136 Bacteria 1946
282 Ga0500568_0040215 3300053139 Bacteria 1884
283 Ga0587128_008573 3300059630 Bacteria 1325

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0666152 Ga0501047_0666152_45_788 229
2 3300049582 Ga0501048_0502497 Ga0501048_0502497_94_837 229
3 3300013308 Ga0157375_10299507 Ga0157375_102995072 234
4 3300047471 Ga0495684_0065202 Ga0495684_0065202_645_1523 238
5 3300005330 Ga0070690_100620202 Ga0070690_1006202021 239
6 3300005347 Ga0070668_100126536 Ga0070668_1001265363 239
7 3300005536 Ga0070697_100049027 Ga0070697_1000490272 239
8 3300005545 Ga0070695_100000711 Ga0070695_10000071114 239
9 3300005549 Ga0070704_100726667 Ga0070704_1007266671 239
10 3300005719 Ga0068861_100271951 Ga0068861_1002719512 239
11 3300005719 Ga0068861_100285576 Ga0068861_1002855762 239
12 3300005937 Ga0081455_10000302 Ga0081455_1000030218 239
13 3300005983 Ga0081540_1000338 Ga0081540_100033818 239
14 3300005985 Ga0081539_10030530 Ga0081539_100305301 239
15 3300006844 Ga0075428_100054329 Ga0075428_1000543296 239
16 3300006844 Ga0075428_100155336 Ga0075428_1001553362 239
17 3300006852 Ga0075433_10163995 Ga0075433_101639952 239
18 3300006871 Ga0075434_100004320 Ga0075434_1000043203 239
19 3300006880 Ga0075429_100398126 Ga0075429_1003981263 239
20 3300007076 Ga0075435_100014130 Ga0075435_1000141304 239
21 3300009094 Ga0111539_10023877 Ga0111539_100238771 239
22 3300009094 Ga0111539_10149299 Ga0111539_101492993 239
23 3300009147 Ga0114129_10027883 Ga0114129_100278837 239
24 3300013306 Ga0163162_10783820 Ga0163162_107838202 239
25 3300013308 Ga0157375_10901378 Ga0157375_109013782 239
26 3300014326 Ga0157380_10727009 Ga0157380_107270091 239
27 3300017792 Ga0163161_10194905 Ga0163161_101949052 239
28 3300025936 Ga0207670_10446587 Ga0207670_104465871 239
29 3300025972 Ga0207668_10124877 Ga0207668_101248771 239
30 3300026118 Ga0207675_100063620 Ga0207675_1000636203 239
31 3300026118 Ga0207675_100397215 Ga0207675_1003972152 239
32 3300034819 Ga0373958_0049288 Ga0373958_0049288_52_771 239
33 3300035241 Ga0373961_0061780 Ga0373961_0061780_291_1010 239
34 3300035691 Ga0373931_0000929 Ga0373931_0000929_2576_3295 239
35 3300035691 Ga0373931_0193621 Ga0373931_0193621_280_999 239
36 3300037068 Ga0373925_0434231 Ga0373925_0434231_116_835 239
37 3300046459 Ga0495629_0227338 Ga0495629_0227338_375_1094 239
38 3300046475 Ga0495639_0258563 Ga0495639_0258563_46_765 239
39 3300048913 Ga0496110_0016881 Ga0496110_0016881_1008_1727 239
40 3300048915 Ga0496112_0195241 Ga0496112_0195241_781_1500 239
41 3300050507 nmdc:mga05p37_1176751_c1 nmdc:mga05p37_1176751_c1_28_747 239
42 3300050511 nmdc:mga08y16_335342_c1 nmdc:mga08y16_335342_c1_537_1256 239
43 3300050511 nmdc:mga08y16_527811_c1 nmdc:mga08y16_527811_c1_64_783 239
44 3300050513 nmdc:mga0rr50_9450_c1 nmdc:mga0rr50_9450_c1_3453_4172 239
45 3300050515 nmdc:mga0a205_264522_c1 nmdc:mga0a205_264522_c1_134_853 239
46 3300004803 Ga0058862_12216272 Ga0058862_122162721 240
47 3300005290 Ga0065712_10263036 Ga0065712_102630361 240
48 3300005293 Ga0065715_10209667 Ga0065715_102096672 240
49 3300005295 Ga0065707_10292074 Ga0065707_102920742 240
50 3300005327 Ga0070658_10058094 Ga0070658_100580942 240
51 3300005339 Ga0070660_100552513 Ga0070660_1005525131 240
52 3300005366 Ga0070659_100284596 Ga0070659_1002845961 240
53 3300005435 Ga0070714_100458563 Ga0070714_1004585632 240
54 3300005436 Ga0070713_100006755 Ga0070713_1000067557 240
55 3300005436 Ga0070713_100140810 Ga0070713_1001408103 240
56 3300005437 Ga0070710_10038810 Ga0070710_100388102 240
57 3300005437 Ga0070710_10082579 Ga0070710_100825792 240
58 3300005437 Ga0070710_10373336 Ga0070710_103733361 240
59 3300005439 Ga0070711_100009303 Ga0070711_1000093031 240
60 3300005439 Ga0070711_100165230 Ga0070711_1001652302 240
61 3300005445 Ga0070708_100476843 Ga0070708_1004768432 240
62 3300005458 Ga0070681_10024498 Ga0070681_100244983 240
63 3300005458 Ga0070681_10036226 Ga0070681_100362262 240
64 3300005467 Ga0070706_100111258 Ga0070706_1001112581 240
65 3300005468 Ga0070707_100028915 Ga0070707_1000289155 240
66 3300005471 Ga0070698_100124719 Ga0070698_1001247193 240
67 3300005471 Ga0070698_100251283 Ga0070698_1002512831 240
68 3300005518 Ga0070699_100157937 Ga0070699_1001579372 240
69 3300005518 Ga0070699_100281063 Ga0070699_1002810631 240
70 3300005530 Ga0070679_100016699 Ga0070679_1000166999 240
71 3300005549 Ga0070704_100281018 Ga0070704_1002810181 240
72 3300005563 Ga0068855_100186595 Ga0068855_1001865952 240
73 3300005614 Ga0068856_100335603 Ga0068856_1003356032 240
74 3300005616 Ga0068852_100119076 Ga0068852_1001190762 240
75 3300005842 Ga0068858_100604710 Ga0068858_1006047102 240
76 3300005844 Ga0068862_100435460 Ga0068862_1004354602 240
77 3300005937 Ga0081455_10149166 Ga0081455_101491661 240
78 3300005983 Ga0081540_1028334 Ga0081540_10283343 240
79 3300006028 Ga0070717_10089701 Ga0070717_100897012 240
80 3300006028 Ga0070717_10360305 Ga0070717_103603051 240
81 3300006028 Ga0070717_10595472 Ga0070717_105954721 240
82 3300006048 Ga0075363_100009164 Ga0075363_1000091641 240
83 3300006173 Ga0070716_100105010 Ga0070716_1001050102 240
84 3300006175 Ga0070712_100096135 Ga0070712_1000961352 240
85 3300006175 Ga0070712_100232790 Ga0070712_1002327901 240
86 3300006177 Ga0075362_10059905 Ga0075362_100599052 240
87 3300006178 Ga0075367_10032629 Ga0075367_100326292 240
88 3300006186 Ga0075369_10091784 Ga0075369_100917842 240
89 3300006195 Ga0075366_10039884 Ga0075366_100398842 240
90 3300006871 Ga0075434_100260794 Ga0075434_1002607942 240
91 3300006914 Ga0075436_100079970 Ga0075436_1000799702 240
92 3300007076 Ga0075435_100154210 Ga0075435_1001542102 240
93 3300007265 Ga0099794_10163121 Ga0099794_101631211 240
94 3300007788 Ga0099795_10110623 Ga0099795_101106231 240
95 3300009093 Ga0105240_10003036 Ga0105240_100030366 240
96 3300009093 Ga0105240_10025347 Ga0105240_100253478 240
97 3300009093 Ga0105240_10258434 Ga0105240_102584342 240
98 3300009093 Ga0105240_10336213 Ga0105240_103362132 240
99 3300009147 Ga0114129_10845407 Ga0114129_108454071 240
100 3300009176 Ga0105242_10135783 Ga0105242_101357832 240
101 3300009551 Ga0105238_10011178 Ga0105238_100111788 240
102 3300009551 Ga0105238_10391735 Ga0105238_103917351 240
103 3300010159 Ga0099796_10055231 Ga0099796_100552312 240
104 3300010375 Ga0105239_10849277 Ga0105239_108492772 240
105 3300011119 Ga0105246_10500555 Ga0105246_105005552 240
106 3300013100 Ga0157373_10406519 Ga0157373_104065191 240
107 3300013296 Ga0157374_10522403 Ga0157374_105224031 240
108 3300013306 Ga0163162_10551795 Ga0163162_105517952 240
109 3300013306 Ga0163162_10567544 Ga0163162_105675442 240
110 3300013307 Ga0157372_10039606 Ga0157372_100396063 240
111 3300013307 Ga0157372_10759291 Ga0157372_107592912 240
112 3300014325 Ga0163163_10076811 Ga0163163_100768113 240
113 3300014325 Ga0163163_10350762 Ga0163163_103507622 240
114 3300014325 Ga0163163_11024820 Ga0163163_110248201 240
115 3300014745 Ga0157377_10213100 Ga0157377_102131002 240
116 3300014969 Ga0157376_10028940 Ga0157376_100289405 240
117 3300014969 Ga0157376_10166182 Ga0157376_101661822 240
118 3300021361 Ga0213872_10060345 Ga0213872_100603451 240
119 3300021377 Ga0213874_10089466 Ga0213874_100894661 240
120 3300021388 Ga0213875_10000198 Ga0213875_1000019814 240
121 3300021388 Ga0213875_10000530 Ga0213875_1000053024 240
122 3300025898 Ga0207692_10329993 Ga0207692_103299931 240
123 3300025901 Ga0207688_10306232 Ga0207688_103062321 240
124 3300025906 Ga0207699_10061748 Ga0207699_100617483 240
125 3300025912 Ga0207707_10026437 Ga0207707_100264376 240
126 3300025912 Ga0207707_10037172 Ga0207707_100371722 240
127 3300025912 Ga0207707_10315018 Ga0207707_103150182 240
128 3300025912 Ga0207707_10413120 Ga0207707_104131202 240
129 3300025913 Ga0207695_10000939 Ga0207695_1000093938 240
130 3300025913 Ga0207695_10009429 Ga0207695_100094298 240
131 3300025913 Ga0207695_10189120 Ga0207695_101891202 240
132 3300025915 Ga0207693_10003109 Ga0207693_100031097 240
133 3300025915 Ga0207693_10053360 Ga0207693_100533602 240
134 3300025915 Ga0207693_10074517 Ga0207693_100745172 240
135 3300025915 Ga0207693_10179658 Ga0207693_101796582 240
136 3300025916 Ga0207663_10481098 Ga0207663_104810981 240
137 3300025919 Ga0207657_10047483 Ga0207657_100474833 240
138 3300025921 Ga0207652_10082002 Ga0207652_100820024 240
139 3300025922 Ga0207646_10018288 Ga0207646_100182884 240
140 3300025924 Ga0207694_10033633 Ga0207694_100336332 240
141 3300025928 Ga0207700_10065878 Ga0207700_100658782 240
142 3300025928 Ga0207700_10155689 Ga0207700_101556891 240
143 3300025929 Ga0207664_10262677 Ga0207664_102626772 240
144 3300025931 Ga0207644_10380386 Ga0207644_103803862 240
145 3300025932 Ga0207690_10001563 Ga0207690_100015633 240
146 3300025939 Ga0207665_10113140 Ga0207665_101131401 240
147 3300025939 Ga0207665_10220979 Ga0207665_102209792 240
148 3300025945 Ga0207679_10688293 Ga0207679_106882931 240
149 3300025949 Ga0207667_10035837 Ga0207667_100358376 240
150 3300026023 Ga0207677_10425509 Ga0207677_104255092 240
151 3300026041 Ga0207639_10119559 Ga0207639_101195592 240
152 3300026078 Ga0207702_10038821 Ga0207702_100388214 240
153 3300026078 Ga0207702_10203901 Ga0207702_102039012 240
154 3300026088 Ga0207641_11072633 Ga0207641_110726331 240
155 3300026142 Ga0207698_10120749 Ga0207698_101207492 240
156 3300027907 Ga0207428_10034164 Ga0207428_100341645 240
157 3300028800 Ga0265338_10020869 Ga0265338_100208698 240
158 3300028800 Ga0265338_10185108 Ga0265338_101851083 240
159 3300031249 Ga0265339_10005853 Ga0265339_100058533 240
160 3300031250 Ga0265331_10011169 Ga0265331_100111692 240
161 3300031251 Ga0265327_10000275 Ga0265327_1000027558 240
162 3300031344 Ga0265316_10079226 Ga0265316_100792263 240
163 3300031595 Ga0265313_10000079 Ga0265313_1000007966 240
164 3300031712 Ga0265342_10051506 Ga0265342_100515062 240
165 3300035086 Ga0373934_0006346 Ga0373934_0006346_2192_2914 240
166 3300035111 Ga0373923_0150195 Ga0373923_0150195_308_1030 240
167 3300035112 Ga0373932_0110285 Ga0373932_0110285_111_833 240
168 3300035113 Ga0373936_0046603 Ga0373936_0046603_607_1329 240
169 3300035116 Ga0373945_0049149 Ga0373945_0049149_70_792 240
170 3300035117 Ga0373953_0012310 Ga0373953_0012310_1224_1946 240
171 3300035117 Ga0373953_0113331 Ga0373953_0113331_173_895 240
172 3300035118 Ga0373954_0005687 Ga0373954_0005687_4072_4794 240
173 3300035118 Ga0373954_0153427 Ga0373954_0153427_379_1101 240
174 3300035119 Ga0373956_0064168 Ga0373956_0064168_68_790 240
175 3300035120 Ga0373957_0015184 Ga0373957_0015184_518_1240 240
176 3300035120 Ga0373957_0047412 Ga0373957_0047412_171_893 240
177 3300035170 Ga0373943_0145355 Ga0373943_0145355_543_1265 240
178 3300035171 Ga0373946_0077706 Ga0373946_0077706_557_1279 240
179 3300035172 Ga0373955_0064234 Ga0373955_0064234_20_742 240
180 3300035172 Ga0373955_0247149 Ga0373955_0247149_85_807 240
181 3300035410 Ga0373924_0041109 Ga0373924_0041109_545_1267 240
182 3300035692 Ga0373935_0039458 Ga0373935_0039458_2064_2786 240
183 3300035692 Ga0373935_0049845 Ga0373935_0049845_219_941 240
184 3300035692 Ga0373935_0208252 Ga0373935_0208252_348_1070 240
185 3300035692 Ga0373935_0271825 Ga0373935_0271825_100_822 240
186 3300035695 Ga0373927_0099679 Ga0373927_0099679_575_1297 240
187 3300035724 Ga0373933_0006031 Ga0373933_0006031_5437_6159 240
188 3300035724 Ga0373933_0062635 Ga0373933_0062635_953_1675 240
189 3300035725 Ga0373947_0016990 Ga0373947_0016990_421_1143 240
190 3300036401 Ga0373937_0022330 Ga0373937_0022330_330_1052 240
191 3300036401 Ga0373937_0025566 Ga0373937_0025566_4550_5272 240
192 3300036401 Ga0373937_0071551 Ga0373937_0071551_2225_2947 240
193 3300036401 Ga0373937_0210271 Ga0373937_0210271_655_1377 240
194 3300036457 Ga0265778_024193 Ga0265778_024193_11_733 240
195 3300037068 Ga0373925_0076178 Ga0373925_0076178_1302_2024 240
196 3300037068 Ga0373925_0211371 Ga0373925_0211371_526_1248 240
197 3300037068 Ga0373925_0274166 Ga0373925_0274166_144_866 240
198 3300037068 Ga0373925_0414261 Ga0373925_0414261_37_762 240
199 3300037853 Ga0436364_0022735 Ga0436364_0022735_27122_27844 240
200 3300037853 Ga0436364_0072060 Ga0436364_0072060_1292_2014 240
201 3300037853 Ga0436364_1070807 Ga0436364_1070807_27086_27808 240
202 3300039437 Ga0436365_0071266 Ga0436365_0071266_290_1012 240
203 3300039437 Ga0436365_0755142 Ga0436365_0755142_459_1181 240
204 3300039437 Ga0436365_1109782 Ga0436365_1109782_128_850 240
205 3300039437 Ga0436365_1396677 Ga0436365_1396677_1176_1898 240
206 3300039438 Ga0436360_0564101 Ga0436360_0564101_366_1088 240
207 3300039438 Ga0436360_0657821 Ga0436360_0657821_997_1719 240
208 3300039447 Ga0436361_0310288 Ga0436361_0310288_282_1007 240
209 3300039447 Ga0436361_0699975 Ga0436361_0699975_2660_3385 240
210 3300039450 Ga0436363_1079299 Ga0436363_1079299_76_801 240
211 3300039450 Ga0436363_1259167 Ga0436363_1259167_241_981 240
212 3300039450 Ga0436363_1341696 Ga0436363_1341696_173_895 240
213 3300039450 Ga0436363_1502795 Ga0436363_1502795_623_1345 240
214 3300039450 Ga0436363_1505184 Ga0436363_1505184_497_1219 240
215 3300039453 Ga0436362_1076623 Ga0436362_1076623_1117_1839 240
216 3300039453 Ga0436362_1292843 Ga0436362_1292843_595_1350 240
217 3300044694 Ga0466963_0090473 Ga0466963_0090473_996_1718 240
218 3300045976 Ga0466967_0750081 Ga0466967_0750081_183_926 240
219 3300046454 Ga0495592_0045481 Ga0495592_0045481_1779_2501 240
220 3300046454 Ga0495592_0199694 Ga0495592_0199694_244_966 240
221 3300046459 Ga0495629_0212238 Ga0495629_0212238_401_1126 240
222 3300046460 Ga0495638_0005990 Ga0495638_0005990_7752_8474 240
223 3300046462 Ga0495651_0127627 Ga0495651_0127627_674_1396 240
224 3300046472 Ga0495580_0064209 Ga0495580_0064209_820_1542 240
225 3300046475 Ga0495639_0061726 Ga0495639_0061726_716_1438 240
226 3300046476 Ga0495662_0055118 Ga0495662_0055118_219_941 240
227 3300046477 Ga0495664_0000595 Ga0495664_0000595_4761_5483 240
228 3300046499 Ga0495594_0179837 Ga0495594_0179837_423_1145 240
229 3300046514 Ga0495618_0115566 Ga0495618_0115566_535_1257 240
230 3300046517 Ga0495630_0118304 Ga0495630_0118304_351_1073 240
231 3300046517 Ga0495630_0433062 Ga0495630_0433062_84_806 240
232 3300046529 Ga0495652_0287581 Ga0495652_0287581_421_1143 240
233 3300046533 Ga0495640_0051028 Ga0495640_0051028_1974_2696 240
234 3300046533 Ga0495640_0133305 Ga0495640_0133305_456_1178 240
235 3300046535 Ga0495586_0017143 Ga0495586_0017143_2616_3338 240
236 3300046536 Ga0495587_0004538 Ga0495587_0004538_7467_8189 240
237 3300046559 Ga0495667_0243746 Ga0495667_0243746_46_768 240
238 3300046559 Ga0495667_0273276 Ga0495667_0273276_227_949 240
239 3300046642 Ga0495634_0270801 Ga0495634_0270801_230_1012 240
240 3300046663 Ga0495635_0038535 Ga0495635_0038535_85_807 240
241 3300046678 Ga0495599_0028271 Ga0495599_0028271_258_980 240
242 3300046679 Ga0495623_0156071 Ga0495623_0156071_264_986 240
243 3300046680 Ga0495646_0005725 Ga0495646_0005725_1961_2683 240
244 3300046809 Ga0495600_0040777 Ga0495600_0040777_1755_2477 240
245 3300046809 Ga0495600_0076961 Ga0495600_0076961_1378_2100 240
246 3300047317 Ga0495604_0018987 Ga0495604_0018987_3745_4467 240
247 3300047319 Ga0495674_0128247 Ga0495674_0128247_229_951 240
248 3300047320 Ga0495672_0217613 Ga0495672_0217613_82_807 240
249 3300047322 Ga0495680_0041766 Ga0495680_0041766_2218_2940 240
250 3300047444 Ga0495675_0132671 Ga0495675_0132671_625_1347 240
251 3300047471 Ga0495684_0121613 Ga0495684_0121613_726_1448 240
252 3300047471 Ga0495684_0266887 Ga0495684_0266887_405_1127 240
253 3300048088 Ga0495602_0000574 Ga0495602_0000574_2372_3094 240
254 3300048913 Ga0496110_0106080 Ga0496110_0106080_1659_2381 240
255 3300048914 Ga0496111_0236198 Ga0496111_0236198_115_837 240
256 3300048915 Ga0496112_0283498 Ga0496112_0283498_830_1552 240
257 3300048916 Ga0496113_0026789 Ga0496113_0026789_2956_3678 240
258 3300048924 Ga0496121_0101548 Ga0496121_0101548_51_776 240
259 3300048929 Ga0496126_0091836 Ga0496126_0091836_668_1393 240
260 3300049586 Ga0501070_0301279 Ga0501070_0301279_520_1257 240
261 3300050489 nmdc:mga03683_91029_c1 nmdc:mga03683_91029_c1_182_925 240
262 3300050490 nmdc:mga03n38_3767_c1 nmdc:mga03n38_3767_c1_44_787 240
263 3300050492 nmdc:mga0yw44_274_c1 nmdc:mga0yw44_274_c1_4807_5550 240
264 3300050492 nmdc:mga0yw44_57680_c2 nmdc:mga0yw44_57680_c2_752_1495 240
265 3300050493 nmdc:mga0k408_43501_c1 nmdc:mga0k408_43501_c1_649_1392 240
266 3300050494 nmdc:mga06z11_154623_c1 nmdc:mga06z11_154623_c1_71_814 240
267 3300050496 nmdc:mga07m45_47896_c1 nmdc:mga07m45_47896_c1_332_1075 240
268 3300050511 nmdc:mga08y16_99026_c1 nmdc:mga08y16_99026_c1_300_1022 240
269 3300050513 nmdc:mga0rr50_62192_c1 nmdc:mga0rr50_62192_c1_1320_2042 240
270 3300050516 nmdc:mga0sz30_70160_c1 nmdc:mga0sz30_70160_c1_223_966 240
271 3300053077 Ga0495601_0010161 Ga0495601_0010161_2841_3563 240
272 3300053077 Ga0495601_0021627 Ga0495601_0021627_2264_2986 240
273 3300053077 Ga0495601_0184681 Ga0495601_0184681_567_1349 240
274 3300053078 Ga0495612_0004207 Ga0495612_0004207_1464_2186 240
275 3300053084 Ga0495595_0021092 Ga0495595_0021092_481_1203 240
276 3300053085 Ga0495619_0017025 Ga0495619_0017025_244_966 240
277 3300053085 Ga0495619_0033424 Ga0495619_0033424_719_1441 240
278 3300053085 Ga0495619_0067073 Ga0495619_0067073_1567_2289 240
279 3300053087 Ga0500643_000050 Ga0500643_000050_12573_13325 240
280 3300053119 Ga0500595_018677 Ga0500595_018677_1739_2479 240
281 3300053136 Ga0500559_0044281 Ga0500559_0044281_1008_1730 240
282 3300053139 Ga0500568_0040215 Ga0500568_0040215_205_948 240
283 3300059630 Ga0587128_008573 Ga0587128_008573_267_1115 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

117

199

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

3

81

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

9

82

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

4

86

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9732 3 204
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9727 1 205
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9717 1 205
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9624 1 205
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9618 1 207
ID Description Score Start End Superfamily
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9956 3 86 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9945 1 84 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9715 1 84 3.40.30.10
4eciA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9561 1 85 3.40.30.10
4mf6A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9536 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A382KR11-F1-model_v4 GST N-terminal domain-containing protein 0.9973 1 208
AF-A0A382KR11-F1-model_v4 GST N-terminal domain-containing protein 0.9925 1 208
AF-A0A0S8AWI8-F1-model_v4 Glutathione S-transferase 0.9921 1 101 GO:0016740
AF-A0A3C0KY15-F1-model_v4 GST N-terminal domain-containing protein 0.9911 12 164
AF-A0A447N7A1-F1-model_v4 Glutathione-S transferase 0.9908 1 84 GO:0015036
GO:0016740

Feature Viewer

pLDDT pTM Quality
91.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map