F385717

General Info

Members Datasets Scaffolds Average Seq Length
283 201 566 193

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0500917|Ga0395905_0500917_10_678
Length 222
Sequence MSKRNLVPERYGTAFRFSKHGREGSGVVSDSVEGAGRVAPSKRKDARRNKEALLDAAAAVFVRSGVDAPVRDIASEAGVGLGTIYRHFPTRADLIIAVYRHQVDACAEAGPALLASATPYAALREWINLFVDFLVTKHGLAAVLRSDNAGFDTLHAYFLDRLVPVCTELLQAAAAAGETGSDITAYELMRGVGNLCIGADNDPRYDAGRLVELLVEGLRRPH

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
61 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
62 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
173 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
174 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
177 2643221548 Streptomyces sp. Root55 Isolate Unclassified
178 2643221647 Streptomyces sp. Root369 Isolate Unclassified
179 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
180 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
181 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
182 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
183 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
184 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
185 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
186 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
187 2867369537 Streptomyces sp. Z26 Isolate Unclassified
188 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
189 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
190 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
191 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
192 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
193 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
194 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
195 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
196 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
197 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
198 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
199 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
200 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
201 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.75
Metatranscriptomes 1.41
Isolates 8.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0.35
Rhizoplane 4.59
Rhizosphere 66.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0500917 3300037471 Bacteria 1115
2 Ga0006562J51391_1074314 3300003578 Bacteria 3840
3 Ga0006562J51391_1074317 3300003578 Bacteria 4960
4 Ga0006562J51391_1090052 3300003578 Bacteria 3530
5 Ga0070667_100000042 3300005367 Bacteria 168902
6 Ga0070714_100080489 3300005435 Bacteria 2835
7 Ga0070662_100335045 3300005457 Bacteria 1237
8 Ga0070665_100205707 3300005548 Bacteria 1969
9 Ga0070702_100276971 3300005615 Bacteria 1150
10 Ga0068859_100010916 3300005617 Bacteria 9144
11 Ga0068864_100376507 3300005618 Bacteria 1344
12 Ga0068863_100000461 3300005841 Bacteria 41485
13 Ga0068858_100328385 3300005842 Bacteria 1463
14 Ga0068860_100000020 3300005843 Bacteria 283324
15 Ga0068862_100000013 3300005844 Bacteria 263115
16 Ga0068862_100169995 3300005844 Bacteria 1951
17 Ga0075368_10014408 3300006042 Bacteria 2920
18 Ga0075367_10002600 3300006178 Bacteria 8289
19 Ga0097620_100010916 3300006931 Bacteria 9144
20 Ga0099826_10086158 3300006948 Bacteria 1937
21 Ga0105247_10000009 3300009101 Bacteria 385991
22 Ga0105248_10000197 3300009177 Bacteria 70131
23 Ga0105237_10000924 3300009545 Bacteria 39538
24 Ga0105238_10163048 3300009551 Bacteria 2205
25 Ga0105239_10012260 3300010375 Bacteria 9550
26 Ga0182008_10005316 3300014497 Bacteria 7353
27 Ga0157379_10832530 3300014968 Bacteria 872
28 Ga0182007_10000559 3300015262 Bacteria 22019
29 Ga0182005_1027126 3300015265 Bacteria 1562
30 Ga0163161_10018318 3300017792 Bacteria 4907
31 Ga0207426_1000547 3300025302 Bacteria 52775
32 Ga0207426_1037805 3300025302 Bacteria 1524
33 Ga0207710_10000014 3300025900 Bacteria 408072
34 Ga0207671_10018545 3300025914 Bacteria 5334
35 Ga0207681_10003471 3300025923 Bacteria 9821
36 Ga0207694_10335890 3300025924 Bacteria 1249
37 Ga0207706_10129197 3300025933 Bacteria 2222
38 Ga0207711_10000146 3300025941 Bacteria 74464
39 Ga0207667_10270342 3300025949 Bacteria 1738
40 Ga0207658_10000540 3300025986 Bacteria 34297
41 Ga0207641_10006204 3300026088 Bacteria 10113
42 Ga0207676_10382859 3300026095 Bacteria 1310
43 Ga0207675_100667480 3300026118 Bacteria 1046
44 Ga0209371_1013792 3300027312 Bacteria 2245
45 Ga0209813_10017613 3300027866 Bacteria 1963
46 Ga0268266_10034511 3300028379 Bacteria 4303
47 Ga0268265_10000004 3300028380 Bacteria 648376
48 Ga0268265_10210663 3300028380 Bacteria 1693
49 Ga0268264_10000024 3300028381 Bacteria 470081
50 Ga0307515_10005354 3300028794 Bacteria 26057
51 Ga0307515_10020027 3300028794 Bacteria 11979
52 Ga0307515_10090227 3300028794 Bacteria 3847
53 Ga0268256_1035755 3300030500 Bacteria 1152
54 Ga0307511_10000186 3300030521 Bacteria 61499
55 Ga0307511_10044021 3300030521 Bacteria 3717
56 Ga0307512_10022815 3300030522 Bacteria 5609
57 Ga0307512_10284414 3300030522 Bacteria 787
58 Ga0265340_10000968 3300031247 Bacteria 16390
59 Ga0307513_10183033 3300031456 Bacteria 1956
60 Ga0307513_10446518 3300031456 Bacteria 1018
61 Ga0307509_10015244 3300031507 Bacteria 8981
62 Ga0307509_10016460 3300031507 Bacteria 8557
63 Ga0307509_10026700 3300031507 Bacteria 6435
64 Ga0307508_10009716 3300031616 Bacteria 8826
65 Ga0307508_10157812 3300031616 Bacteria 1872
66 Ga0307514_10019004 3300031649 Bacteria 5626
67 Ga0307516_10007755 3300031730 Bacteria 12267
68 Ga0307516_10677470 3300031730 Bacteria 687
69 Ga0307518_10010158 3300031838 Bacteria 6714
70 Ga0307518_10022917 3300031838 Bacteria 4497
71 Ga0307518_10142183 3300031838 Bacteria 1672
72 Ga0307518_10260073 3300031838 Bacteria 1094
73 Ga0307409_100071061 3300031995 Bacteria 2766
74 Ga0307416_100750439 3300032002 Bacteria 1068
75 Ga0307507_10024671 3300033179 Bacteria 6544
76 Ga0307507_10056951 3300033179 Bacteria 3686
77 Ga0307510_10017944 3300033180 Bacteria 8338
78 Ga0307510_10084669 3300033180 Bacteria 3052
79 Ga0307510_10272326 3300033180 Bacteria 1168
80 Ga0316212_1005031 3300033547 Bacteria 1919
81 Ga0316216_1005489 3300033548 Bacteria 930
82 Ga0372808_026598 3300036459 Bacteria 831
83 Ga0395900_0320291 3300037418 Bacteria 1531
84 Ga0395901_0685787 3300038443 Bacteria 1024
85 Ga0436361_0481294 3300039447 Bacteria 1555
86 Ga0436362_0399730 3300039453 Bacteria 993
87 Ga0451791_0559550 3300041451 Bacteria 1508
88 Ga0451791_1559821 3300041451 Bacteria 1517
89 Ga0451849_0267856 3300041505 Bacteria 961
90 Ga0451853_0353732 3300041512 Bacteria 964
91 Ga0495617_038903 3300046452 Bacteria 1590
92 Ga0495592_0005130 3300046454 Bacteria 9648
93 Ga0495592_0021690 3300046454 Bacteria 4885
94 Ga0495603_0055213 3300046455 Bacteria 2353
95 Ga0495629_0004555 3300046459 Bacteria 10367
96 Ga0495629_0015096 3300046459 Bacteria 5552
97 Ga0495629_0047485 3300046459 Bacteria 3011
98 Ga0495629_0057127 3300046459 Bacteria 2729
99 Ga0495638_0139969 3300046460 Bacteria 1413
100 Ga0495651_0032091 3300046462 Bacteria 4097
101 Ga0495651_0087699 3300046462 Bacteria 2339
102 Ga0495653_0005858 3300046463 Bacteria 10061
103 Ga0495580_0080820 3300046472 Bacteria 2265
104 Ga0495580_0466569 3300046472 Bacteria 846
105 Ga0495605_0019001 3300046474 Bacteria 3678
106 Ga0495662_0000876 3300046476 Bacteria 14697
107 Ga0495662_0006999 3300046476 Bacteria 5602
108 Ga0495662_0076560 3300046476 Bacteria 1624
109 Ga0495664_0003519 3300046477 Bacteria 8537
110 Ga0495664_0066766 3300046477 Bacteria 2145
111 Ga0495584_0052925 3300046491 Bacteria 2043
112 Ga0495585_0026195 3300046492 Bacteria 3331
113 Ga0495594_0027450 3300046499 Bacteria 3068
114 Ga0495594_0063281 3300046499 Bacteria 2049
115 Ga0495607_0170238 3300046501 Bacteria 1100
116 Ga0495583_0038333 3300046506 Bacteria 2264
117 Ga0495583_0162661 3300046506 Bacteria 920
118 Ga0495606_0004970 3300046507 Bacteria 12973
119 Ga0495608_0001788 3300046511 Bacteria 15362
120 Ga0495608_0190193 3300046511 Bacteria 1296
121 Ga0495610_0010730 3300046512 Bacteria 5667
122 Ga0495616_0021858 3300046513 Bacteria 3458
123 Ga0495628_0012348 3300046516 Bacteria 7200
124 Ga0495628_0153777 3300046516 Bacteria 1751
125 Ga0495630_0123946 3300046517 Bacteria 1960
126 Ga0495630_0304307 3300046517 Bacteria 1218
127 Ga0495637_0041777 3300046520 Bacteria 1965
128 Ga0495643_0259756 3300046522 Bacteria 807
129 Ga0495648_0074783 3300046524 Bacteria 1950
130 Ga0495666_0002763 3300046526 Bacteria 8764
131 Ga0495666_0019016 3300046526 Bacteria 3412
132 Ga0495652_0071825 3300046529 Bacteria 2887
133 Ga0495652_0401315 3300046529 Bacteria 970
134 Ga0495665_0008798 3300046531 Bacteria 5479
135 Ga0495640_0044411 3300046533 Bacteria 3089
136 Ga0495586_0013955 3300046535 Bacteria 4262
137 Ga0495587_0001757 3300046536 Bacteria 14484
138 Ga0495597_0006792 3300046542 Bacteria 5885
139 Ga0495622_0021333 3300046557 Bacteria 3015
140 Ga0495667_0085381 3300046559 Bacteria 2048
141 Ga0495667_0591759 3300046559 Bacteria 691
142 Ga0495668_0007772 3300046616 Bacteria 6799
143 Ga0495634_0015975 3300046642 Bacteria 5378
144 Ga0495634_0036083 3300046642 Bacteria 3382
145 Ga0495611_0008668 3300046648 Bacteria 4302
146 Ga0495625_0009653 3300046660 Bacteria 8044
147 Ga0495625_0152384 3300046660 Bacteria 1553
148 Ga0495625_0436331 3300046660 Bacteria 812
149 Ga0495635_0005354 3300046663 Bacteria 8928
150 Ga0495661_0037974 3300046665 Bacteria 3004
151 Ga0495588_0256845 3300046674 Bacteria 921
152 Ga0495657_0001000 3300046675 Bacteria 24877
153 Ga0495657_0189589 3300046675 Bacteria 1257
154 Ga0495623_0233317 3300046679 Bacteria 1042
155 Ga0495646_0003061 3300046680 Bacteria 10365
156 Ga0495646_0047737 3300046680 Bacteria 2604
157 Ga0495658_0017816 3300046683 Bacteria 3679
158 Ga0495613_0001758 3300046689 Bacteria 16497
159 Ga0495613_0008287 3300046689 Bacteria 7716
160 Ga0495613_0260537 3300046689 Bacteria 1208
161 Ga0495613_0405529 3300046689 Bacteria 929
162 Ga0495624_0065357 3300046690 Bacteria 2272
163 Ga0495671_0025955 3300046692 Bacteria 3041
164 Ga0495589_0006504 3300046794 Bacteria 6163
165 Ga0495600_0029183 3300046809 Bacteria 3570
166 Ga0495600_0124635 3300046809 Bacteria 1675
167 Ga0495600_0519263 3300046809 Bacteria 730
168 Ga0495581_0010691 3300047315 Bacteria 5307
169 Ga0495581_0066863 3300047315 Bacteria 2078
170 Ga0495604_0009586 3300047317 Bacteria 7658
171 Ga0495604_0056503 3300047317 Bacteria 3021
172 Ga0495636_0001096 3300047318 Bacteria 10171
173 Ga0495674_0160298 3300047319 Bacteria 1882
174 Ga0495676_0002468 3300047321 Bacteria 16443
175 Ga0495676_0205404 3300047321 Bacteria 1366
176 Ga0495683_0142143 3300047323 Bacteria 1123
177 Ga0495687_002242 3300047443 Bacteria 15941
178 Ga0495687_012894 3300047443 Bacteria 4392
179 Ga0495687_100100 3300047443 Bacteria 1089
180 Ga0495675_0039517 3300047444 Bacteria 3004
181 Ga0495685_003633 3300047447 Bacteria 4933
182 Ga0495681_0004340 3300047470 Bacteria 9697
183 Ga0495684_0545296 3300047471 Bacteria 790
184 Ga0495593_0000062 3300047673 Bacteria 45281
185 Ga0495602_0026180 3300048088 Bacteria 5630
186 Ga0495602_0086097 3300048088 Bacteria 2624
187 Ga0495614_0000858 3300048089 Bacteria 12847
188 Ga0495614_0004100 3300048089 Bacteria 6557
189 Ga0495614_0029072 3300048089 Bacteria 2379
190 Ga0495626_0127852 3300048091 Bacteria 1087
191 Ga0496100_0002922 3300048903 Bacteria 8779
192 Ga0496100_0108466 3300048903 Bacteria 1925
193 Ga0496101_0000112 3300048904 Bacteria 81887
194 Ga0496101_0032346 3300048904 Bacteria 3682
195 Ga0496102_0000007 3300048905 Bacteria 417224
196 Ga0496102_0000691 3300048905 Bacteria 33503
197 Ga0496103_0000071 3300048906 Bacteria 119931
198 Ga0496103_0000795 3300048906 Bacteria 23202
199 Ga0496105_0316816 3300048908 Bacteria 1251
200 Ga0496107_0018344 3300048910 Bacteria 4927
201 Ga0496116_0000033 3300048919 Bacteria 418191
202 Ga0496116_0004780 3300048919 Bacteria 12786
203 Ga0496117_0000025 3300048920 Bacteria 418106
204 Ga0496117_0000909 3300048920 Bacteria 45378
205 Ga0496118_0000023 3300048921 Bacteria 418106
206 Ga0496118_0000324 3300048921 Bacteria 82637
207 Ga0496119_0001106 3300048922 Bacteria 33980
208 Ga0496119_0007952 3300048922 Bacteria 9434
209 Ga0496120_0000281 3300048923 Bacteria 85648
210 Ga0496121_0000427 3300048924 Bacteria 82773
211 Ga0496121_0002438 3300048924 Bacteria 28440
212 Ga0496125_0106785 3300048928 Bacteria 2042
213 Ga0496126_0000189 3300048929 Bacteria 138921
214 Ga0496126_0000539 3300048929 Bacteria 73256
215 Ga0496126_0069688 3300048929 Bacteria 3135
216 Ga0496126_0487216 3300048929 Bacteria 987
217 Ga0495678_125690 3300049459 Bacteria 855
218 Ga0501031_0014822 3300049568 Bacteria 5067
219 Ga0501031_0695283 3300049568 Bacteria 653
220 Ga0501032_0005774 3300049569 Bacteria 9156
221 Ga0501033_0001678 3300049570 Bacteria 19371
222 Ga0501033_0001870 3300049570 Bacteria 18313
223 Ga0501033_0253944 3300049570 Bacteria 1245
224 Ga0501034_0027132 3300049571 Bacteria 5826
225 Ga0501034_0102173 3300049571 Bacteria 2860
226 Ga0501036_0016031 3300049572 Bacteria 6261
227 Ga0501036_0497084 3300049572 Bacteria 1015
228 Ga0501037_0054381 3300049573 Bacteria 2927
229 Ga0501037_0188967 3300049573 Bacteria 1459
230 Ga0501038_0051051 3300049574 Bacteria 3571
231 Ga0501039_0815272 3300049575 Bacteria 728
232 Ga0501040_0597792 3300049576 Bacteria 797
233 Ga0501043_0010334 3300049579 Bacteria 7317
234 Ga0501043_0054495 3300049579 Bacteria 3140
235 Ga0501046_0000071 3300049580 Bacteria 107260
236 Ga0501046_0060710 3300049580 Bacteria 2957
237 Ga0501046_0122273 3300049580 Bacteria 1980
238 Ga0501047_0035783 3300049581 Bacteria 4797
239 Ga0501048_0005465 3300049582 Bacteria 9667
240 Ga0501070_0433324 3300049586 Bacteria 1061
241 Ga0501035_0009476 3300049822 Bacteria 9053
242 Ga0501035_0078951 3300049822 Bacteria 2907
243 Ga0501035_0199641 3300049822 Bacteria 1716
244 Ga0501044_0066502 3300049823 Bacteria 3675
245 Ga0501044_0087151 3300049823 Bacteria 3153
246 Ga0501044_1045648 3300049823 Bacteria 687
247 nmdc:mga06z11_8699_c1 3300050494 Bacteria 4249
248 nmdc:mga04h51_7072_c1 3300050495 Bacteria 2943
249 Ga0495619_0033880 3300053085 Bacteria 3318
250 Ga0500643_006773 3300053087 Bacteria 4727
251 Ga0500583_0274756 3300053092 Bacteria 828
252 Ga0500650_0094625 3300053098 Bacteria 1399
253 Ga0500660_060555 3300053100 Bacteria 1825
254 Ga0500560_000231 3300053107 Bacteria 6859
255 Ga0500560_053089 3300053107 Bacteria 1305
256 Ga0500614_052021 3300053123 Bacteria 1079
257 Ga0500573_0094711 3300053140 Bacteria 1684
258 Ga0500600_0200904 3300053149 Bacteria 939
259 2643763026 2643221548 Bacteria 8053412
260 2644267882 2643221647 Bacteria 10741251
261 2644436928 2643221678 Bacteria 9540101
262 2644464116 2643221682 Bacteria 6743283
263 2785366024 2784746768 Bacteria 10036182
264 2793976777 2791355406 Bacteria 11364898
265 2808841822 2808606359 Bacteria 9866990
266 2808917546 2808606375 Bacteria 9466072
267 2812479433 2811994917 Bacteria 7761064
268 2862285699 2862281513 Bacteria 9621493
269 2867374491 2867369537 Bacteria 6501581
270 2877684472 2877676314 Bacteria 9512378
271 2884698495 2884693830 Bacteria 11273186
272 2895451094 2895442618 Bacteria 11027144
273 2912764637 2912757875 Bacteria 7940295
274 2929221665 2929219909 Bacteria 6984360
275 2954389960 2954380949 Bacteria 10050426
276 2954700694 2954691527 Bacteria 10720516
277 2954701536 2954701450 Bacteria 10834262
278 3006497519 3006493962 Bacteria 8825450
279 8047903649 8047893842 Bacteria 11723082
280 8048132011 8048127548 Bacteria 11053136
281 8048356911 8048356638 Bacteria 11044339
282 8048378914 8048369669 Bacteria 11666822
283 8048388017 8048379754 Bacteria 11877923
284 Ga0395905_0500917
285 Ga0006562J51391_1074314
286 Ga0006562J51391_1074317
287 Ga0006562J51391_1090052
288 Ga0070667_100000042
289 Ga0070714_100080489
290 Ga0070662_100335045
291 Ga0070665_100205707
292 Ga0070702_100276971
293 Ga0068859_100010916
294 Ga0068864_100376507
295 Ga0068863_100000461
296 Ga0068858_100328385
297 Ga0068860_100000020
298 Ga0068862_100000013
299 Ga0068862_100169995
300 Ga0075368_10014408
301 Ga0075367_10002600
302 Ga0097620_100010916
303 Ga0099826_10086158
304 Ga0105247_10000009
305 Ga0105248_10000197
306 Ga0105237_10000924
307 Ga0105238_10163048
308 Ga0105239_10012260
309 Ga0182008_10005316
310 Ga0157379_10832530
311 Ga0182007_10000559
312 Ga0182005_1027126
313 Ga0163161_10018318
314 Ga0207426_1000547
315 Ga0207426_1037805
316 Ga0207710_10000014
317 Ga0207671_10018545
318 Ga0207681_10003471
319 Ga0207694_10335890
320 Ga0207706_10129197
321 Ga0207711_10000146
322 Ga0207667_10270342
323 Ga0207658_10000540
324 Ga0207641_10006204
325 Ga0207676_10382859
326 Ga0207675_100667480
327 Ga0209371_1013792
328 Ga0209813_10017613
329 Ga0268266_10034511
330 Ga0268265_10000004
331 Ga0268265_10210663
332 Ga0268264_10000024
333 Ga0307515_10005354
334 Ga0307515_10020027
335 Ga0307515_10090227
336 Ga0268256_1035755
337 Ga0307511_10000186
338 Ga0307511_10044021
339 Ga0307512_10022815
340 Ga0307512_10284414
341 Ga0265340_10000968
342 Ga0307513_10183033
343 Ga0307513_10446518
344 Ga0307509_10015244
345 Ga0307509_10016460
346 Ga0307509_10026700
347 Ga0307508_10009716
348 Ga0307508_10157812
349 Ga0307514_10019004
350 Ga0307516_10007755
351 Ga0307516_10677470
352 Ga0307518_10010158
353 Ga0307518_10022917
354 Ga0307518_10142183
355 Ga0307518_10260073
356 Ga0307409_100071061
357 Ga0307416_100750439
358 Ga0307507_10024671
359 Ga0307507_10056951
360 Ga0307510_10017944
361 Ga0307510_10084669
362 Ga0307510_10272326
363 Ga0316212_1005031
364 Ga0316216_1005489
365 Ga0372808_026598
366 Ga0395900_0320291
367 Ga0395901_0685787
368 Ga0436361_0481294
369 Ga0436362_0399730
370 Ga0451791_0559550
371 Ga0451791_1559821
372 Ga0451849_0267856
373 Ga0451853_0353732
374 Ga0495617_038903
375 Ga0495592_0005130
376 Ga0495592_0021690
377 Ga0495603_0055213
378 Ga0495629_0004555
379 Ga0495629_0015096
380 Ga0495629_0047485
381 Ga0495629_0057127
382 Ga0495638_0139969
383 Ga0495651_0032091
384 Ga0495651_0087699
385 Ga0495653_0005858
386 Ga0495580_0080820
387 Ga0495580_0466569
388 Ga0495605_0019001
389 Ga0495662_0000876
390 Ga0495662_0006999
391 Ga0495662_0076560
392 Ga0495664_0003519
393 Ga0495664_0066766
394 Ga0495584_0052925
395 Ga0495585_0026195
396 Ga0495594_0027450
397 Ga0495594_0063281
398 Ga0495607_0170238
399 Ga0495583_0038333
400 Ga0495583_0162661
401 Ga0495606_0004970
402 Ga0495608_0001788
403 Ga0495608_0190193
404 Ga0495610_0010730
405 Ga0495616_0021858
406 Ga0495628_0012348
407 Ga0495628_0153777
408 Ga0495630_0123946
409 Ga0495630_0304307
410 Ga0495637_0041777
411 Ga0495643_0259756
412 Ga0495648_0074783
413 Ga0495666_0002763
414 Ga0495666_0019016
415 Ga0495652_0071825
416 Ga0495652_0401315
417 Ga0495665_0008798
418 Ga0495640_0044411
419 Ga0495586_0013955
420 Ga0495587_0001757
421 Ga0495597_0006792
422 Ga0495622_0021333
423 Ga0495667_0085381
424 Ga0495667_0591759
425 Ga0495668_0007772
426 Ga0495634_0015975
427 Ga0495634_0036083
428 Ga0495611_0008668
429 Ga0495625_0009653
430 Ga0495625_0152384
431 Ga0495625_0436331
432 Ga0495635_0005354
433 Ga0495661_0037974
434 Ga0495588_0256845
435 Ga0495657_0001000
436 Ga0495657_0189589
437 Ga0495623_0233317
438 Ga0495646_0003061
439 Ga0495646_0047737
440 Ga0495658_0017816
441 Ga0495613_0001758
442 Ga0495613_0008287
443 Ga0495613_0260537
444 Ga0495613_0405529
445 Ga0495624_0065357
446 Ga0495671_0025955
447 Ga0495589_0006504
448 Ga0495600_0029183
449 Ga0495600_0124635
450 Ga0495600_0519263
451 Ga0495581_0010691
452 Ga0495581_0066863
453 Ga0495604_0009586
454 Ga0495604_0056503
455 Ga0495636_0001096
456 Ga0495674_0160298
457 Ga0495676_0002468
458 Ga0495676_0205404
459 Ga0495683_0142143
460 Ga0495687_002242
461 Ga0495687_012894
462 Ga0495687_100100
463 Ga0495675_0039517
464 Ga0495685_003633
465 Ga0495681_0004340
466 Ga0495684_0545296
467 Ga0495593_0000062
468 Ga0495602_0026180
469 Ga0495602_0086097
470 Ga0495614_0000858
471 Ga0495614_0004100
472 Ga0495614_0029072
473 Ga0495626_0127852
474 Ga0496100_0002922
475 Ga0496100_0108466
476 Ga0496101_0000112
477 Ga0496101_0032346
478 Ga0496102_0000007
479 Ga0496102_0000691
480 Ga0496103_0000071
481 Ga0496103_0000795
482 Ga0496105_0316816
483 Ga0496107_0018344
484 Ga0496116_0000033
485 Ga0496116_0004780
486 Ga0496117_0000025
487 Ga0496117_0000909
488 Ga0496118_0000023
489 Ga0496118_0000324
490 Ga0496119_0001106
491 Ga0496119_0007952
492 Ga0496120_0000281
493 Ga0496121_0000427
494 Ga0496121_0002438
495 Ga0496125_0106785
496 Ga0496126_0000189
497 Ga0496126_0000539
498 Ga0496126_0069688
499 Ga0496126_0487216
500 Ga0495678_125690
501 Ga0501031_0014822
502 Ga0501031_0695283
503 Ga0501032_0005774
504 Ga0501033_0001678
505 Ga0501033_0001870
506 Ga0501033_0253944
507 Ga0501034_0027132
508 Ga0501034_0102173
509 Ga0501036_0016031
510 Ga0501036_0497084
511 Ga0501037_0054381
512 Ga0501037_0188967
513 Ga0501038_0051051
514 Ga0501039_0815272
515 Ga0501040_0597792
516 Ga0501043_0010334
517 Ga0501043_0054495
518 Ga0501046_0000071
519 Ga0501046_0060710
520 Ga0501046_0122273
521 Ga0501047_0035783
522 Ga0501048_0005465
523 Ga0501070_0433324
524 Ga0501035_0009476
525 Ga0501035_0078951
526 Ga0501035_0199641
527 Ga0501044_0066502
528 Ga0501044_0087151
529 Ga0501044_1045648
530 nmdc:mga06z11_8699_c1
531 nmdc:mga04h51_7072_c1
532 Ga0495619_0033880
533 Ga0500643_006773
534 Ga0500583_0274756
535 Ga0500650_0094625
536 Ga0500660_060555
537 Ga0500560_000231
538 Ga0500560_053089
539 Ga0500614_052021
540 Ga0500573_0094711
541 Ga0500600_0200904
542 2643763026
543 2644267882
544 2644436928
545 2644464116
546 2785366024
547 2793976777
548 2808841822
549 2808917546
550 2812479433
551 2862285699
552 2867374491
553 2877684472
554 2884698495
555 2895451094
556 2912764637
557 2929221665
558 2954389960
559 2954700694
560 2954701536
561 3006497519
562 8047903649
563 8048132011
564 8048356911
565 8048378914
566 8048388017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

53

98

0.96

PF21597

TetR_C_43

Transcriptional regulator SbtR-like, C-terminal domain

118

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q24-assembly1.cif.gz_B crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor 0.8046 23 196
2q24-assembly1.cif.gz_B crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor 0.7971 23 196
2rek-assembly1.cif.gz_A crystal structure of tetr-family transcriptional regulator 0.7754 18 192
2rek-assembly1.cif.gz_B-2 crystal structure of tetr-family transcriptional regulator 0.7669 16 195
2rek-assembly1.cif.gz_B-2 crystal structure of tetr-family transcriptional regulator 0.7631 16 195
ID Description Score Start End Superfamily
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9505 19 70 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9397 25 70 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9378 22 70 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9375 22 70 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9369 22 70 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A429DUF3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9953 13 194 GO:0000976
GO:0003700
AF-A0A178XA55-F1-model_v4 DNA-binding transcriptional repressor AcrR 0.9897 12 196 GO:0000976
GO:0003700
AF-A0A1Q9SK55-F1-model_v4 deleted 0.9875 7 194
AF-A0A0N0T7N9-F1-model_v4 TetR family transcriptional regulator 0.9869 27 194 GO:0000976
GO:0003700
AF-A0A370VQD6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9865 12 196 GO:0000976
GO:0003700

Map