F385677

General Info

Members Datasets Scaffolds Average Seq Length
283 181 566 101

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10500356|Ga0307414_105003563
Length 112
Sequence MITPLAAAKAYASAQKGIGVGGAGDAMELPSLSGPSGATQPGGFGDILKSAMTDAMAASKNAEKQMAAQVAGKTELIDVVTAISAAEASLETVIAVRDQVISAYQEIMRMPI

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
165 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
166 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
177 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
178 2849560528 Caulobacter zeae 410 Isolate Unclassified
179 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
180 2851153111 Caulobacter radicis 736 Isolate Unclassified
181 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 0
Rhizoplane 4.95
Rhizosphere 80.21
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10500356 3300032004 Bacteria 1075
2 rootH1_10037526 3300003316 Bacteria 1661
3 rootH2_10062489 3300003320 Bacteria 4420
4 rootH1_10052601 3300003323 Bacteria 3330
5 Ga0055524_1079834 3300003775 Bacteria 599
6 Ga0065165_1009107 3300005262 Bacteria 4508
7 Ga0070670_100000009 3300005331 Bacteria 291074
8 Ga0070666_10528203 3300005335 Bacteria 857
9 Ga0070680_100049422 3300005336 Bacteria 3428
10 Ga0070691_10090024 3300005341 Bacteria 1512
11 Ga0070661_100241994 3300005344 Bacteria 1390
12 Ga0070661_100425051 3300005344 Bacteria 1054
13 Ga0070661_101193688 3300005344 Bacteria 636
14 Ga0070668_100001291 3300005347 Bacteria 17909
15 Ga0070668_100007781 3300005347 Bacteria 7955
16 Ga0070668_100061689 3300005347 Bacteria 2904
17 Ga0070669_100100893 3300005353 Bacteria 2177
18 Ga0070669_100673148 3300005353 Bacteria 872
19 Ga0070671_100146143 3300005355 Bacteria 1996
20 Ga0070671_101088967 3300005355 Bacteria 701
21 Ga0070673_100061672 3300005364 Bacteria 2976
22 Ga0070667_100000730 3300005367 Bacteria 31571
23 Ga0070667_100004635 3300005367 Bacteria 11541
24 Ga0070667_100162831 3300005367 Bacteria 1966
25 Ga0070708_101964742 3300005445 Bacteria 542
26 Ga0070678_100242141 3300005456 Bacteria 1509
27 Ga0070662_100121249 3300005457 Bacteria 2004
28 Ga0070681_10017491 3300005458 Bacteria 7165
29 Ga0070706_101283186 3300005467 Bacteria 672
30 Ga0070679_100045655 3300005530 Bacteria 4365
31 Ga0068853_100519044 3300005539 Bacteria 1126
32 Ga0068853_100769351 3300005539 Bacteria 921
33 Ga0070665_100000338 3300005548 Bacteria 71282
34 Ga0070665_100001314 3300005548 Bacteria 29649
35 Ga0070665_100081313 3300005548 Bacteria 3246
36 Ga0068855_100050185 3300005563 Bacteria 4918
37 Ga0070664_100160763 3300005564 Bacteria 1987
38 Ga0068854_100429605 3300005578 Bacteria 1099
39 Ga0068856_100028297 3300005614 Bacteria 5472
40 Ga0068856_100748773 3300005614 Bacteria 997
41 Ga0068859_100005468 3300005617 Bacteria 12925
42 Ga0068859_100241718 3300005617 Bacteria 1895
43 Ga0068864_100000151 3300005618 Bacteria 65372
44 Ga0068864_100016243 3300005618 Bacteria 6196
45 Ga0068864_100759673 3300005618 Bacteria 950
46 Ga0068861_100036680 3300005719 Bacteria 3641
47 Ga0068863_100000399 3300005841 Bacteria 44173
48 Ga0068863_100017137 3300005841 Bacteria 6947
49 Ga0068863_100024686 3300005841 Bacteria 5733
50 Ga0068863_100102303 3300005841 Bacteria 2724
51 Ga0068858_100005365 3300005842 Bacteria 12570
52 Ga0068858_100077564 3300005842 Bacteria 3087
53 Ga0068860_100000184 3300005843 Bacteria 100730
54 Ga0068860_100004249 3300005843 Bacteria 14669
55 Ga0068860_101491270 3300005843 Bacteria 698
56 Ga0068862_100157592 3300005844 Bacteria 2025
57 Ga0068862_100195699 3300005844 Bacteria 1821
58 Ga0068862_102686389 3300005844 Bacteria 509
59 Ga0075363_101031055 3300006048 Bacteria 508
60 Ga0075362_10101427 3300006177 Bacteria 1346
61 Ga0075369_10406509 3300006186 Bacteria 642
62 Ga0097621_100815593 3300006237 Bacteria 865
63 Ga0068871_102126680 3300006358 Bacteria 535
64 Ga0097620_100005468 3300006931 Bacteria 12925
65 Ga0097620_100241749 3300006931 Bacteria 1895
66 Ga0105250_10048299 3300009092 Bacteria 1707
67 Ga0105240_10110703 3300009093 Bacteria 3324
68 Ga0111539_11823844 3300009094 Bacteria 705
69 Ga0105247_10017345 3300009101 Bacteria 4323
70 Ga0105247_10178389 3300009101 Bacteria 1416
71 Ga0105248_10008919 3300009177 Bacteria 11025
72 Ga0105248_10322480 3300009177 Bacteria 1740
73 Ga0105248_10458260 3300009177 Bacteria 1437
74 Ga0105248_10728147 3300009177 Bacteria 1119
75 Ga0105238_10021347 3300009551 Bacteria 6598
76 Ga0105238_10044431 3300009551 Bacteria 4491
77 Ga0105249_10002575 3300009553 Bacteria 15692
78 Ga0105249_10084999 3300009553 Bacteria 2947
79 Ga0105249_10090631 3300009553 Bacteria 2859
80 Ga0105239_10791984 3300010375 Bacteria 1086
81 Ga0157370_10357850 3300013104 Bacteria 1345
82 Ga0163162_10090781 3300013306 Bacteria 3137
83 Ga0163162_11081102 3300013306 Bacteria 908
84 Ga0157372_12994304 3300013307 Bacteria 540
85 Ga0157375_10049535 3300013308 Bacteria 4117
86 Ga0163163_10281378 3300014325 Bacteria 1715
87 Ga0163163_10580299 3300014325 Bacteria 1184
88 Ga0163163_10636053 3300014325 Bacteria 1130
89 Ga0163163_10660675 3300014325 Bacteria 1109
90 Ga0163163_11820064 3300014325 Bacteria 669
91 Ga0157380_12091516 3300014326 Bacteria 629
92 Ga0157380_12601008 3300014326 Bacteria 572
93 Ga0157377_11594080 3300014745 Bacteria 523
94 Ga0157379_10063582 3300014968 Bacteria 3299
95 Ga0157379_10402118 3300014968 Bacteria 1259
96 Ga0157379_11557343 3300014968 Bacteria 644
97 Ga0157376_12747111 3300014969 Bacteria 532
98 Ga0183365_10001 3300015684 Bacteria 2090444
99 Ga0163161_10145300 3300017792 Bacteria 1798
100 Ga0213875_10078846 3300021388 Bacteria 1536
101 Ga0213871_10151037 3300021441 Bacteria 707
102 Ga0209026_1001618 3300025250 Bacteria 9624
103 Ga0209256_1048365 3300025299 Bacteria 1042
104 Ga0207697_10082739 3300025315 Bacteria 1354
105 Ga0207680_10127547 3300025903 Bacteria 1672
106 Ga0207680_10134485 3300025903 Bacteria 1633
107 Ga0207680_10232035 3300025903 Bacteria 1269
108 Ga0207705_10235691 3300025909 Bacteria 1393
109 Ga0207705_10295292 3300025909 Bacteria 1242
110 Ga0207705_10836991 3300025909 Bacteria 714
111 Ga0207707_10246119 3300025912 Bacteria 1553
112 Ga0207695_10000695 3300025913 Bacteria 65865
113 Ga0207660_10310603 3300025917 Bacteria 1257
114 Ga0207657_10819852 3300025919 Bacteria 719
115 Ga0207649_10471482 3300025920 Bacteria 951
116 Ga0207652_10118005 3300025921 Bacteria 2358
117 Ga0207681_10319545 3300025923 Bacteria 1234
118 Ga0207681_10610041 3300025923 Bacteria 902
119 Ga0207694_10312719 3300025924 Bacteria 1295
120 Ga0207650_10000014 3300025925 Bacteria 398063
121 Ga0207650_10030289 3300025925 Bacteria 3897
122 Ga0207644_10303127 3300025931 Bacteria 1288
123 Ga0207644_10375123 3300025931 Bacteria 1159
124 Ga0207644_11318894 3300025931 Bacteria 606
125 Ga0207690_11395602 3300025932 Bacteria 586
126 Ga0207706_10011689 3300025933 Bacteria 8004
127 Ga0207704_11397764 3300025938 Bacteria 600
128 Ga0207711_10085330 3300025941 Bacteria 2766
129 Ga0207711_10161871 3300025941 Bacteria 2026
130 Ga0207711_10219113 3300025941 Bacteria 1740
131 Ga0207711_10320228 3300025941 Bacteria 1433
132 Ga0207679_10080578 3300025945 Bacteria 2486
133 Ga0207667_10131571 3300025949 Bacteria 2577
134 Ga0207651_10100761 3300025960 Bacteria 2142
135 Ga0207712_10000782 3300025961 Bacteria 23725
136 Ga0207712_10025483 3300025961 Bacteria 3929
137 Ga0207712_11550765 3300025961 Bacteria 594
138 Ga0207668_10000025 3300025972 Bacteria 131733
139 Ga0207668_10000118 3300025972 Bacteria 55570
140 Ga0207668_10014929 3300025972 Bacteria 4817
141 Ga0207658_10001444 3300025986 Bacteria 18526
142 Ga0207658_10006386 3300025986 Bacteria 8050
143 Ga0207658_10205052 3300025986 Bacteria 1649
144 Ga0207658_10212131 3300025986 Bacteria 1623
145 Ga0207677_11600463 3300026023 Bacteria 603
146 Ga0207703_10002454 3300026035 Bacteria 16079
147 Ga0207703_10206201 3300026035 Bacteria 1750
148 Ga0207639_10377237 3300026041 Bacteria 1273
149 Ga0207702_10204728 3300026078 Bacteria 1831
150 Ga0207702_10329656 3300026078 Bacteria 1456
151 Ga0207641_10007773 3300026088 Bacteria 8909
152 Ga0207641_10654032 3300026088 Bacteria 1032
153 Ga0207641_11221398 3300026088 Bacteria 751
154 Ga0207641_12115876 3300026088 Bacteria 563
155 Ga0207676_10000069 3300026095 Bacteria 104526
156 Ga0207676_10034148 3300026095 Bacteria 3849
157 Ga0207676_10038209 3300026095 Bacteria 3662
158 Ga0207676_10082409 3300026095 Bacteria 2616
159 Ga0207675_100033862 3300026118 Bacteria 4761
160 Ga0207675_100479011 3300026118 Bacteria 1237
161 Ga0207683_10116110 3300026121 Bacteria 2399
162 Ga0268266_10000533 3300028379 Bacteria 53233
163 Ga0268266_10018483 3300028379 Bacteria 5940
164 Ga0268265_10002343 3300028380 Bacteria 14376
165 Ga0268265_10049483 3300028380 Bacteria 3161
166 Ga0268265_10152763 3300028380 Bacteria 1949
167 Ga0268264_10000124 3300028381 Bacteria 187493
168 Ga0268264_10029492 3300028381 Bacteria 4494
169 Ga0268264_10901235 3300028381 Bacteria 887
170 Ga0265326_10085109 3300028558 Bacteria 894
171 Ga0265334_10022132 3300028573 Bacteria 2593
172 Ga0307517_10008484 3300028786 Bacteria 14745
173 Ga0307517_10073760 3300028786 Bacteria 3020
174 Ga0307517_10102024 3300028786 Bacteria 2253
175 Ga0265338_10012968 3300028800 Bacteria 9462
176 Ga0307511_10024092 3300030521 Bacteria 5651
177 Ga0265339_10250275 3300031249 Bacteria 858
178 Ga0307513_10001510 3300031456 Bacteria 33405
179 Ga0307513_10011527 3300031456 Bacteria 10979
180 Ga0307513_10359163 3300031456 Bacteria 1202
181 Ga0307513_10835181 3300031456 Bacteria 628
182 Ga0265314_10065990 3300031711 Bacteria 2442
183 Ga0373937_0162449 3300036401 Bacteria 2094
184 Ga0395905_0052369 3300037471 Bacteria 3821
185 Ga0395905_0238704 3300037471 Bacteria 1699
186 Ga0395905_1002585 3300037471 Bacteria 738
187 Ga0436364_0621828 3300037853 Bacteria 27902
188 Ga0436364_0665130 3300037853 Unclassified 586
189 Ga0436365_1006012 3300039437 Bacteria 683
190 Ga0436365_1528596 3300039437 Bacteria 686
191 Ga0436360_0066982 3300039438 Bacteria 5496
192 Ga0439453_0146697 3300041408 Bacteria 558
193 Ga0451793_0728988 3300041452 Bacteria 644
194 Ga0451798_1009942 3300041458 Bacteria 597
195 Ga0439462_0141604 3300042015 Bacteria 674
196 Ga0466969_0003458 3300044656 Bacteria 8394
197 Ga0466966_0001423 3300044684 Bacteria 15420
198 Ga0466961_0004454 3300044693 Bacteria 8773
199 Ga0466963_0133207 3300044694 Bacteria 1718
200 Ga0466971_0000881 3300044719 Bacteria 12254
201 Ga0466970_0011984 3300044765 Bacteria 4426
202 Ga0466957_0031788 3300044842 Bacteria 3156
203 Ga0466959_0048771 3300045049 Bacteria 3111
204 Ga0466958_0000425 3300045836 Bacteria 17411
205 Ga0495662_0674985 3300046476 Bacteria 504
206 Ga0495642_0080612 3300046528 Bacteria 1370
207 Ga0495642_0105930 3300046528 Bacteria 1200
208 Ga0495668_0031937 3300046616 Bacteria 2965
209 Ga0495668_0059281 3300046616 Bacteria 2112
210 Ga0495611_0003482 3300046648 Bacteria 6933
211 Ga0495659_0040074 3300046664 Bacteria 1668
212 Ga0495669_0000022 3300046684 Bacteria 117864
213 Ga0495669_0071737 3300046684 Bacteria 1579
214 Ga0495669_0105471 3300046684 Bacteria 1312
215 Ga0495581_0112372 3300047315 Bacteria 1584
216 Ga0495636_0440779 3300047318 Bacteria 625
217 Ga0495672_0127378 3300047320 Bacteria 1344
218 Ga0495677_0006482 3300047445 Bacteria 4423
219 Ga0495677_0036358 3300047445 Bacteria 1799
220 Ga0495677_0320967 3300047445 Bacteria 610
221 Ga0495686_0005344 3300047472 Bacteria 10170
222 Ga0495602_0935812 3300048088 Bacteria 575
223 Ga0496101_0955280 3300048904 Bacteria 674
224 Ga0496102_0227035 3300048905 Bacteria 1760
225 Ga0496103_0280712 3300048906 Bacteria 1071
226 Ga0496106_0462523 3300048909 Bacteria 1019
227 Ga0496108_0077224 3300048911 Bacteria 2816
228 Ga0496109_0224128 3300048912 Bacteria 1768
229 Ga0496110_0619425 3300048913 Bacteria 981
230 Ga0496111_0289069 3300048914 Bacteria 1216
231 Ga0496112_0041870 3300048915 Bacteria 4482
232 Ga0496113_0236927 3300048916 Bacteria 1456
233 Ga0496113_0323020 3300048916 Bacteria 1237
234 Ga0496115_1012168 3300048918 Bacteria 634
235 Ga0501032_0439786 3300049569 Bacteria 836
236 Ga0501033_0012027 3300049570 Bacteria 6609
237 Ga0501033_0730236 3300049570 Bacteria 672
238 Ga0501034_0309307 3300049571 Bacteria 1515
239 Ga0501034_0502615 3300049571 Bacteria 1126
240 Ga0501038_0219358 3300049574 Bacteria 1518
241 Ga0501043_0551752 3300049579 Bacteria 856
242 Ga0501046_0442744 3300049580 Bacteria 935
243 Ga0501047_0004232 3300049581 Bacteria 13510
244 Ga0501047_0060734 3300049581 Bacteria 3647
245 Ga0501047_0218226 3300049581 Bacteria 1764
246 Ga0501047_0326581 3300049581 Bacteria 1373
247 Ga0501047_0935943 3300049581 Bacteria 680
248 Ga0501067_0237006 3300049583 Bacteria 1015
249 Ga0501067_0847334 3300049583 Bacteria 515
250 Ga0501072_0044325 3300049588 Bacteria 3498
251 Ga0501073_0072593 3300049589 Bacteria 2397
252 Ga0501080_0273442 3300049742 Bacteria 1537
253 Ga0501083_0152570 3300049744 Bacteria 1512
254 Ga0501035_0001881 3300049822 Bacteria 21130
255 Ga0501035_0165542 3300049822 Bacteria 1912
256 Ga0501044_0003113 3300049823 Bacteria 18797
257 Ga0501044_0229312 3300049823 Bacteria 1805
258 Ga0501044_0373556 3300049823 Bacteria 1342
259 Ga0501044_0576596 3300049823 Bacteria 1020
260 Ga0501044_0744540 3300049823 Bacteria 863
261 nmdc:mga03683_163871_c1 3300050489 Bacteria 1008
262 nmdc:mga0yw44_151166_c1 3300050492 Bacteria 1514
263 Ga0500643_007219 3300053087 Bacteria 4527
264 Ga0500643_023908 3300053087 Bacteria 1947
265 Ga0500643_179424 3300053087 Bacteria 568
266 Ga0500647_0011386 3300053091 Bacteria 3969
267 Ga0500650_0464676 3300053098 Bacteria 541
268 Ga0500556_0152641 3300053104 Bacteria 910
269 Ga0500562_005509 3300053108 Bacteria 3177
270 Ga0500595_018799 3300053119 Bacteria 2520
271 Ga0500618_168876 3300053125 Bacteria 501
272 Ga0500559_0000152 3300053136 Bacteria 54664
273 Ga0500645_005951 3300053730 Bacteria 4415
274 Ga0500645_017599 3300053730 Bacteria 2238
275 Ga0501084_0031520 3300054114 Bacteria 4432
276 Ga0501082_0008836 3300060353 Bacteria 8688
277 Ga0466962_0000117 3300061719 Bacteria 32210
278 2792463043 2791355048 Bacteria 5832535
279 2843746904 2843744320 Bacteria 5659202
280 2849563190 2849560528 Bacteria 5393480
281 2849576593 2849573788 Bacteria 5421256
282 2851154182 2851153111 Bacteria 5542585
283 2898333196 2898329390 Bacteria 5168154
284 Ga0307414_10500356
285 rootH1_10037526
286 rootH2_10062489
287 rootH1_10052601
288 Ga0055524_1079834
289 Ga0065165_1009107
290 Ga0070670_100000009
291 Ga0070666_10528203
292 Ga0070680_100049422
293 Ga0070691_10090024
294 Ga0070661_100241994
295 Ga0070661_100425051
296 Ga0070661_101193688
297 Ga0070668_100001291
298 Ga0070668_100007781
299 Ga0070668_100061689
300 Ga0070669_100100893
301 Ga0070669_100673148
302 Ga0070671_100146143
303 Ga0070671_101088967
304 Ga0070673_100061672
305 Ga0070667_100000730
306 Ga0070667_100004635
307 Ga0070667_100162831
308 Ga0070708_101964742
309 Ga0070678_100242141
310 Ga0070662_100121249
311 Ga0070681_10017491
312 Ga0070706_101283186
313 Ga0070679_100045655
314 Ga0068853_100519044
315 Ga0068853_100769351
316 Ga0070665_100000338
317 Ga0070665_100001314
318 Ga0070665_100081313
319 Ga0068855_100050185
320 Ga0070664_100160763
321 Ga0068854_100429605
322 Ga0068856_100028297
323 Ga0068856_100748773
324 Ga0068859_100005468
325 Ga0068859_100241718
326 Ga0068864_100000151
327 Ga0068864_100016243
328 Ga0068864_100759673
329 Ga0068861_100036680
330 Ga0068863_100000399
331 Ga0068863_100017137
332 Ga0068863_100024686
333 Ga0068863_100102303
334 Ga0068858_100005365
335 Ga0068858_100077564
336 Ga0068860_100000184
337 Ga0068860_100004249
338 Ga0068860_101491270
339 Ga0068862_100157592
340 Ga0068862_100195699
341 Ga0068862_102686389
342 Ga0075363_101031055
343 Ga0075362_10101427
344 Ga0075369_10406509
345 Ga0097621_100815593
346 Ga0068871_102126680
347 Ga0097620_100005468
348 Ga0097620_100241749
349 Ga0105250_10048299
350 Ga0105240_10110703
351 Ga0111539_11823844
352 Ga0105247_10017345
353 Ga0105247_10178389
354 Ga0105248_10008919
355 Ga0105248_10322480
356 Ga0105248_10458260
357 Ga0105248_10728147
358 Ga0105238_10021347
359 Ga0105238_10044431
360 Ga0105249_10002575
361 Ga0105249_10084999
362 Ga0105249_10090631
363 Ga0105239_10791984
364 Ga0157370_10357850
365 Ga0163162_10090781
366 Ga0163162_11081102
367 Ga0157372_12994304
368 Ga0157375_10049535
369 Ga0163163_10281378
370 Ga0163163_10580299
371 Ga0163163_10636053
372 Ga0163163_10660675
373 Ga0163163_11820064
374 Ga0157380_12091516
375 Ga0157380_12601008
376 Ga0157377_11594080
377 Ga0157379_10063582
378 Ga0157379_10402118
379 Ga0157379_11557343
380 Ga0157376_12747111
381 Ga0183365_10001
382 Ga0163161_10145300
383 Ga0213875_10078846
384 Ga0213871_10151037
385 Ga0209026_1001618
386 Ga0209256_1048365
387 Ga0207697_10082739
388 Ga0207680_10127547
389 Ga0207680_10134485
390 Ga0207680_10232035
391 Ga0207705_10235691
392 Ga0207705_10295292
393 Ga0207705_10836991
394 Ga0207707_10246119
395 Ga0207695_10000695
396 Ga0207660_10310603
397 Ga0207657_10819852
398 Ga0207649_10471482
399 Ga0207652_10118005
400 Ga0207681_10319545
401 Ga0207681_10610041
402 Ga0207694_10312719
403 Ga0207650_10000014
404 Ga0207650_10030289
405 Ga0207644_10303127
406 Ga0207644_10375123
407 Ga0207644_11318894
408 Ga0207690_11395602
409 Ga0207706_10011689
410 Ga0207704_11397764
411 Ga0207711_10085330
412 Ga0207711_10161871
413 Ga0207711_10219113
414 Ga0207711_10320228
415 Ga0207679_10080578
416 Ga0207667_10131571
417 Ga0207651_10100761
418 Ga0207712_10000782
419 Ga0207712_10025483
420 Ga0207712_11550765
421 Ga0207668_10000025
422 Ga0207668_10000118
423 Ga0207668_10014929
424 Ga0207658_10001444
425 Ga0207658_10006386
426 Ga0207658_10205052
427 Ga0207658_10212131
428 Ga0207677_11600463
429 Ga0207703_10002454
430 Ga0207703_10206201
431 Ga0207639_10377237
432 Ga0207702_10204728
433 Ga0207702_10329656
434 Ga0207641_10007773
435 Ga0207641_10654032
436 Ga0207641_11221398
437 Ga0207641_12115876
438 Ga0207676_10000069
439 Ga0207676_10034148
440 Ga0207676_10038209
441 Ga0207676_10082409
442 Ga0207675_100033862
443 Ga0207675_100479011
444 Ga0207683_10116110
445 Ga0268266_10000533
446 Ga0268266_10018483
447 Ga0268265_10002343
448 Ga0268265_10049483
449 Ga0268265_10152763
450 Ga0268264_10000124
451 Ga0268264_10029492
452 Ga0268264_10901235
453 Ga0265326_10085109
454 Ga0265334_10022132
455 Ga0307517_10008484
456 Ga0307517_10073760
457 Ga0307517_10102024
458 Ga0265338_10012968
459 Ga0307511_10024092
460 Ga0265339_10250275
461 Ga0307513_10001510
462 Ga0307513_10011527
463 Ga0307513_10359163
464 Ga0307513_10835181
465 Ga0265314_10065990
466 Ga0373937_0162449
467 Ga0395905_0052369
468 Ga0395905_0238704
469 Ga0395905_1002585
470 Ga0436364_0621828
471 Ga0436364_0665130
472 Ga0436365_1006012
473 Ga0436365_1528596
474 Ga0436360_0066982
475 Ga0439453_0146697
476 Ga0451793_0728988
477 Ga0451798_1009942
478 Ga0439462_0141604
479 Ga0466969_0003458
480 Ga0466966_0001423
481 Ga0466961_0004454
482 Ga0466963_0133207
483 Ga0466971_0000881
484 Ga0466970_0011984
485 Ga0466957_0031788
486 Ga0466959_0048771
487 Ga0466958_0000425
488 Ga0495662_0674985
489 Ga0495642_0080612
490 Ga0495642_0105930
491 Ga0495668_0031937
492 Ga0495668_0059281
493 Ga0495611_0003482
494 Ga0495659_0040074
495 Ga0495669_0000022
496 Ga0495669_0071737
497 Ga0495669_0105471
498 Ga0495581_0112372
499 Ga0495636_0440779
500 Ga0495672_0127378
501 Ga0495677_0006482
502 Ga0495677_0036358
503 Ga0495677_0320967
504 Ga0495686_0005344
505 Ga0495602_0935812
506 Ga0496101_0955280
507 Ga0496102_0227035
508 Ga0496103_0280712
509 Ga0496106_0462523
510 Ga0496108_0077224
511 Ga0496109_0224128
512 Ga0496110_0619425
513 Ga0496111_0289069
514 Ga0496112_0041870
515 Ga0496113_0236927
516 Ga0496113_0323020
517 Ga0496115_1012168
518 Ga0501032_0439786
519 Ga0501033_0012027
520 Ga0501033_0730236
521 Ga0501034_0309307
522 Ga0501034_0502615
523 Ga0501038_0219358
524 Ga0501043_0551752
525 Ga0501046_0442744
526 Ga0501047_0004232
527 Ga0501047_0060734
528 Ga0501047_0218226
529 Ga0501047_0326581
530 Ga0501047_0935943
531 Ga0501067_0237006
532 Ga0501067_0847334
533 Ga0501072_0044325
534 Ga0501073_0072593
535 Ga0501080_0273442
536 Ga0501083_0152570
537 Ga0501035_0001881
538 Ga0501035_0165542
539 Ga0501044_0003113
540 Ga0501044_0229312
541 Ga0501044_0373556
542 Ga0501044_0576596
543 Ga0501044_0744540
544 nmdc:mga03683_163871_c1
545 nmdc:mga0yw44_151166_c1
546 Ga0500643_007219
547 Ga0500643_023908
548 Ga0500643_179424
549 Ga0500647_0011386
550 Ga0500650_0464676
551 Ga0500556_0152641
552 Ga0500562_005509
553 Ga0500595_018799
554 Ga0500618_168876
555 Ga0500559_0000152
556 Ga0500645_005951
557 Ga0500645_017599
558 Ga0501084_0031520
559 Ga0501082_0008836
560 Ga0466962_0000117
561 2792463043
562 2843746904
563 2849563190
564 2849576593
565 2851154182
566 2898333196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

27

112

0.94

Map