F385672

General Info

Members Datasets Scaffolds Average Seq Length
283 202 566 212

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10052243|Ga0307406_100522435
Length 242
Sequence MSSTLHEFQFAYYLTYFAPTGTVVRNINGKGGMGPLDHRPATPADALAELLAGNRRFVTGTRIHPHQDTEHRTAVAEEQRPFAVLFGCSDSRLAAEIIFDRGLGDLYVVRTAGHVVGPEVLASIEYGVTVLGAPLVVVLGHDSCGAIRAARAAMTGEQPAAPHLRAIVDRVVPSIQQAYAQHVTDSDAISHVHVRRTVELIGGRGGMVADAAASGRCAVVGMGYRLADGRVTVLTQDAPTAP

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2508501039 Frankia saprophytica CN3 Isolate Nodule
167 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
168 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
169 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
170 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
171 2671180195 Frankia sp. CcI49 Isolate Nodule
172 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
173 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
174 2687453737 Frankia sp. BMG5.36 Isolate Nodule
175 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
176 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
177 2773857922 Frankia sp. CcI49 Isolate Nodule
178 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
179 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
180 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
181 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
182 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
183 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
184 2862574272 Streptomyces sp. AcE210 Isolate Nodule
185 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
186 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
187 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
188 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
189 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
190 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
191 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
192 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
193 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
194 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
195 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
196 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
197 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
198 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
199 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
200 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
201 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
202 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.22
Metatranscriptomes 0.35
Isolates 13.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 2.83
Rhizoplane 1.41
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10052243 3300031901 Bacteria 2599
2 JGI24737J22298_10026746 3300001990 Bacteria 1821
3 rootH1_10000130 3300003316 Bacteria 8498
4 rootL2_10226746 3300003322 Bacteria 2042
5 Ga0068868_100514508 3300005338 Bacteria 1050
6 Ga0070710_10069722 3300005437 Bacteria 2023
7 Ga0070679_100614659 3300005530 Bacteria 1030
8 Ga0070684_100321693 3300005535 Bacteria 1421
9 Ga0068853_100060187 3300005539 Bacteria 3281
10 Ga0070665_100015279 3300005548 Bacteria 7708
11 Ga0070665_100023653 3300005548 Bacteria 6185
12 Ga0070665_100396331 3300005548 Bacteria 1388
13 Ga0070665_100616423 3300005548 Bacteria 1098
14 Ga0068855_100008014 3300005563 Bacteria 12761
15 Ga0068857_100221810 3300005577 Bacteria 1727
16 Ga0068857_100595475 3300005577 Bacteria 1045
17 Ga0068854_100157452 3300005578 Bacteria 1756
18 Ga0068856_100163544 3300005614 Bacteria 2237
19 Ga0068852_100025024 3300005616 Bacteria 4832
20 Ga0068859_100000141 3300005617 Bacteria 67772
21 Ga0068863_100009585 3300005841 Bacteria 9447
22 Ga0068858_100054625 3300005842 Bacteria 3693
23 Ga0068862_100000039 3300005844 Bacteria 171385
24 Ga0081455_10039468 3300005937 Bacteria 4171
25 Ga0081540_1064488 3300005983 Bacteria 1728
26 Ga0070715_10347340 3300006163 Bacteria 809
27 Ga0070712_100136339 3300006175 Bacteria 1867
28 Ga0075428_100078540 3300006844 Bacteria 3603
29 Ga0075428_100303440 3300006844 Bacteria 1716
30 Ga0075428_100409926 3300006844 Bacteria 1452
31 Ga0075428_100592671 3300006844 Bacteria 1184
32 Ga0075431_100609324 3300006847 Bacteria 1075
33 Ga0075433_10916033 3300006852 Bacteria 764
34 Ga0075429_100373743 3300006880 Bacteria 1248
35 Ga0097620_100000141 3300006931 Bacteria 67772
36 Ga0105240_10387009 3300009093 Bacteria 1578
37 Ga0114129_10010030 3300009147 Bacteria 13504
38 Ga0114129_10048939 3300009147 Bacteria 5941
39 Ga0105241_10002553 3300009174 Bacteria 13672
40 Ga0105248_11465690 3300009177 Bacteria 772
41 Ga0105249_10011362 3300009553 Bacteria 7819
42 Ga0157369_10646345 3300013105 Bacteria 1091
43 Ga0157369_10746117 3300013105 Bacteria 1007
44 Ga0157374_10070763 3300013296 Bacteria 3288
45 Ga0157375_11009580 3300013308 Bacteria 971
46 Ga0163163_10011656 3300014325 Bacteria 7986
47 Ga0163163_10102104 3300014325 Bacteria 2891
48 Ga0163163_10412712 3300014325 Bacteria 1409
49 Ga0224712_10004148 3300022467 Bacteria 3875
50 Ga0209758_1005785 3300025297 Bacteria 9277
51 Ga0207692_10040718 3300025898 Bacteria 2295
52 Ga0207647_10019780 3300025904 Bacteria 4522
53 Ga0207647_10051108 3300025904 Bacteria 2556
54 Ga0207654_10632122 3300025911 Bacteria 766
55 Ga0207695_10043107 3300025913 Bacteria 4812
56 Ga0207695_10324284 3300025913 Bacteria 1429
57 Ga0207693_10020371 3300025915 Bacteria 5276
58 Ga0207694_10003816 3300025924 Bacteria 11922
59 Ga0207700_10220261 3300025928 Bacteria 1608
60 Ga0207712_10331407 3300025961 Bacteria 1259
61 Ga0207640_10058910 3300025981 Bacteria 2532
62 Ga0207677_10638121 3300026023 Bacteria 939
63 Ga0207703_10058314 3300026035 Bacteria 3151
64 Ga0207641_10052605 3300026088 Bacteria 3449
65 Ga0207674_10196498 3300026116 Bacteria 1967
66 Ga0268266_10234255 3300028379 Bacteria 1692
67 Ga0268265_10000020 3300028380 Bacteria 275575
68 Ga0307508_10036923 3300031616 Bacteria 4398
69 Ga0307518_10001022 3300031838 Bacteria 20913
70 Ga0307518_10135474 3300031838 Bacteria 1725
71 Ga0395900_0129040 3300037418 Bacteria 2592
72 Ga0395898_0028899 3300037466 Bacteria 5556
73 Ga0395898_0034882 3300037466 Bacteria 5007
74 Ga0395905_0596973 3300037471 Bacteria 1006
75 Ga0395901_0119346 3300038443 Bacteria 2771
76 Ga0451853_0399669 3300041512 Bacteria 2692
77 Ga0439448_0145073 3300042005 Bacteria 822
78 Ga0466969_0008976 3300044656 Bacteria 5299
79 Ga0466969_0168939 3300044656 Bacteria 1003
80 Ga0466965_0028588 3300044683 Bacteria 2709
81 Ga0466965_0096576 3300044683 Bacteria 1508
82 Ga0466965_0395441 3300044683 Bacteria 763
83 Ga0466966_0003208 3300044684 Bacteria 10775
84 Ga0466966_0011657 3300044684 Bacteria 5827
85 Ga0466961_0006785 3300044693 Bacteria 7286
86 Ga0466961_0039558 3300044693 Bacteria 3023
87 Ga0466971_0003307 3300044719 Bacteria 6884
88 Ga0466971_0031907 3300044719 Bacteria 2360
89 Ga0466970_0022707 3300044765 Bacteria 3273
90 Ga0466970_0088220 3300044765 Bacteria 1682
91 Ga0466970_0215473 3300044765 Bacteria 1071
92 Ga0466960_0006756 3300044901 Bacteria 4620
93 Ga0466960_0111155 3300044901 Bacteria 1424
94 Ga0466959_0027944 3300045049 Bacteria 4183
95 Ga0466958_0046867 3300045836 Bacteria 2609
96 Ga0466967_0024322 3300045976 Bacteria 4978
97 Ga0466967_0237628 3300045976 Bacteria 1737
98 Ga0495592_0073854 3300046454 Bacteria 2478
99 Ga0495603_0023177 3300046455 Bacteria 3758
100 Ga0495603_0069971 3300046455 Bacteria 2063
101 Ga0495603_0074956 3300046455 Bacteria 1986
102 Ga0495603_0223041 3300046455 Bacteria 1087
103 Ga0495590_0095419 3300046457 Bacteria 1054
104 Ga0495651_0612890 3300046462 Bacteria 685
105 Ga0495605_0015282 3300046474 Bacteria 4180
106 Ga0495605_0074071 3300046474 Bacteria 1603
107 Ga0495662_0268843 3300046476 Bacteria 839
108 Ga0495585_0134739 3300046492 Bacteria 1297
109 Ga0495585_0252256 3300046492 Bacteria 880
110 Ga0495594_0007740 3300046499 Bacteria 5525
111 Ga0495594_0020429 3300046499 Bacteria 3527
112 Ga0495596_0035716 3300046500 Bacteria 1970
113 Ga0495607_0089021 3300046501 Bacteria 1676
114 Ga0495583_0017469 3300046506 Bacteria 3806
115 Ga0495606_0004995 3300046507 Bacteria 12934
116 Ga0495606_0070149 3300046507 Bacteria 2211
117 Ga0495608_0112112 3300046511 Bacteria 1753
118 Ga0495616_0022140 3300046513 Bacteria 3434
119 Ga0495620_0003848 3300046515 Bacteria 8555
120 Ga0495620_0004219 3300046515 Bacteria 8134
121 Ga0495620_0031459 3300046515 Bacteria 2431
122 Ga0495628_0143537 3300046516 Bacteria 1821
123 Ga0495631_0004966 3300046518 Bacteria 7009
124 Ga0495643_0005920 3300046522 Bacteria 8162
125 Ga0495643_0008072 3300046522 Bacteria 6709
126 Ga0495643_0019087 3300046522 Bacteria 3969
127 Ga0495648_0029034 3300046524 Bacteria 3676
128 Ga0495648_0046755 3300046524 Bacteria 2680
129 Ga0495666_0029755 3300046526 Bacteria 2686
130 Ga0495666_0326138 3300046526 Bacteria 693
131 Ga0495642_0182473 3300046528 Bacteria 913
132 Ga0495652_0129797 3300046529 Bacteria 1997
133 Ga0495640_0014240 3300046533 Bacteria 6028
134 Ga0495597_0033606 3300046542 Bacteria 2321
135 Ga0495597_0034509 3300046542 Bacteria 2286
136 Ga0495597_0066072 3300046542 Bacteria 1568
137 Ga0495622_0244808 3300046557 Bacteria 790
138 Ga0495667_0223448 3300046559 Bacteria 1202
139 Ga0495668_0009942 3300046616 Bacteria 5798
140 Ga0495668_0048593 3300046616 Bacteria 2353
141 Ga0495668_0069354 3300046616 Bacteria 1939
142 Ga0495634_0079564 3300046642 Bacteria 2146
143 Ga0495611_0045967 3300046648 Bacteria 1956
144 Ga0495611_0251870 3300046648 Bacteria 818
145 Ga0495625_0048486 3300046660 Bacteria 3058
146 Ga0495625_0067021 3300046660 Bacteria 2527
147 Ga0495635_0373684 3300046663 Bacteria 949
148 Ga0495657_0007626 3300046675 Bacteria 8335
149 Ga0495657_0009358 3300046675 Bacteria 7432
150 Ga0495623_0003125 3300046679 Bacteria 10914
151 Ga0495613_0006203 3300046689 Bacteria 8942
152 Ga0495613_0272081 3300046689 Bacteria 1178
153 Ga0495624_0111859 3300046690 Bacteria 1678
154 Ga0495649_0029916 3300046694 Bacteria 3009
155 Ga0495649_0163283 3300046694 Bacteria 1167
156 Ga0495649_0167573 3300046694 Bacteria 1150
157 Ga0495589_0005926 3300046794 Bacteria 6452
158 Ga0495589_0016188 3300046794 Bacteria 3832
159 Ga0495589_0045769 3300046794 Bacteria 2173
160 Ga0495660_0002891 3300046810 Bacteria 10783
161 Ga0495660_0056227 3300046810 Bacteria 2127
162 Ga0495660_0144389 3300046810 Bacteria 1180
163 Ga0495604_0004422 3300047317 Bacteria 11127
164 Ga0495604_0027238 3300047317 Bacteria 4547
165 Ga0495604_0352212 3300047317 Bacteria 978
166 Ga0495604_0492085 3300047317 Bacteria 796
167 Ga0495672_0192959 3300047320 Bacteria 1023
168 Ga0495676_0003247 3300047321 Bacteria 14705
169 Ga0495676_0004211 3300047321 Bacteria 13133
170 Ga0495676_0097009 3300047321 Bacteria 2190
171 Ga0495676_0188361 3300047321 Bacteria 1441
172 Ga0495676_0257869 3300047321 Bacteria 1187
173 Ga0495680_0045194 3300047322 Bacteria 3478
174 Ga0495680_0335665 3300047322 Bacteria 1055
175 Ga0495683_0070712 3300047323 Bacteria 1713
176 Ga0495687_010360 3300047443 Bacteria 5117
177 Ga0495687_011053 3300047443 Bacteria 4884
178 Ga0495687_030976 3300047443 Bacteria 2459
179 Ga0495675_0017724 3300047444 Bacteria 4515
180 Ga0495685_025614 3300047447 Bacteria 2029
181 Ga0495685_026646 3300047447 Bacteria 1988
182 Ga0495681_0114774 3300047470 Bacteria 1162
183 Ga0495686_0078249 3300047472 Bacteria 2024
184 Ga0495593_0008916 3300047673 Bacteria 5821
185 Ga0495614_0016584 3300048089 Bacteria 3205
186 Ga0495626_0042895 3300048091 Bacteria 2124
187 Ga0496102_0292185 3300048905 Bacteria 1536
188 Ga0496104_0370350 3300048907 Bacteria 1345
189 Ga0496112_0130349 3300048915 Bacteria 2485
190 Ga0496113_0497593 3300048916 Bacteria 979
191 Ga0496117_0234712 3300048920 Bacteria 1011
192 Ga0496118_0024015 3300048921 Bacteria 5277
193 Ga0495678_037085 3300049459 Bacteria 1984
194 Ga0501031_0036276 3300049568 Bacteria 3216
195 Ga0501033_0036801 3300049570 Bacteria 3665
196 Ga0501033_0148607 3300049570 Bacteria 1691
197 Ga0501034_0007870 3300049571 Bacteria 11328
198 Ga0501034_0113823 3300049571 Bacteria 2695
199 Ga0501034_0142181 3300049571 Bacteria 2378
200 Ga0501034_0778756 3300049571 Bacteria 850
201 Ga0501036_0000204 3300049572 Bacteria 39411
202 Ga0501036_0001830 3300049572 Bacteria 16507
203 Ga0501036_0038338 3300049572 Bacteria 4055
204 Ga0501037_0001575 3300049573 Bacteria 16622
205 Ga0501038_0041302 3300049574 Bacteria 4023
206 Ga0501038_0513929 3300049574 Bacteria 914
207 Ga0501039_0184682 3300049575 Bacteria 1640
208 Ga0501040_0021163 3300049576 Bacteria 4338
209 Ga0501040_0146806 3300049576 Bacteria 1663
210 Ga0501041_0003316 3300049577 Bacteria 9260
211 Ga0501042_0016366 3300049578 Bacteria 5087
212 Ga0501043_0001522 3300049579 Bacteria 20237
213 Ga0501043_0013585 3300049579 Bacteria 6370
214 Ga0501047_0003044 3300049581 Bacteria 15905
215 Ga0501047_0007794 3300049581 Bacteria 10084
216 Ga0501047_0058440 3300049581 Bacteria 3726
217 Ga0501048_0024315 3300049582 Bacteria 4422
218 Ga0501067_0008933 3300049583 Bacteria 5552
219 Ga0501068_0008386 3300049584 Bacteria 5748
220 Ga0501069_0065824 3300049585 Bacteria 2026
221 Ga0501070_0013064 3300049586 Bacteria 6999
222 Ga0501070_0428466 3300049586 Bacteria 1068
223 Ga0501071_0170985 3300049587 Bacteria 1626
224 Ga0501072_0006003 3300049588 Bacteria 9260
225 Ga0501074_0042773 3300049590 Bacteria 3277
226 Ga0501074_0069442 3300049590 Bacteria 2533
227 Ga0501076_0037798 3300049592 Bacteria 3788
228 Ga0501077_0076710 3300049593 Bacteria 2117
229 Ga0501079_0041524 3300049741 Bacteria 3551
230 Ga0501080_0141449 3300049742 Bacteria 2224
231 Ga0501083_0005628 3300049744 Bacteria 8870
232 Ga0501035_0014351 3300049822 Bacteria 7313
233 Ga0501044_0034639 3300049823 Bacteria 5293
234 Ga0501044_0060839 3300049823 Bacteria 3865
235 Ga0501044_0328529 3300049823 Bacteria 1452
236 Ga0501045_0120327 3300049824 Bacteria 1949
237 nmdc:mga05p37_192167_c1 3300050507 Bacteria 2477
238 nmdc:mga05p37_300704_c1 3300050507 Bacteria 1907
239 nmdc:mga09592_854724_c1 3300050508 Bacteria 767
240 nmdc:mga06r32_200669_c1 3300050510 Bacteria 1982
241 Ga0500646_0000370 3300053090 Bacteria 13582
242 Ga0500588_0000383 3300053146 Bacteria 6867
243 Ga0466962_0013479 3300061719 Bacteria 3935
244 Ga0530510_0225590 3300061734 Bacteria 1393
245 Ga0530510_0289745 3300061734 Bacteria 1224
246 2508678391 2508501039 Bacteria 9978592
247 2547405754 2547132111 Bacteria 8013147
248 2585318854 2582581314 Bacteria 11452267
249 2586059862 2585427649 Bacteria 9053857
250 2616701245 2616644814 Bacteria 11555299
251 2671833666 2671180195 Bacteria 9757215
252 2676201921 2675902999 Bacteria 9438463
253 2686537002 2684623035 Bacteria 8032739
254 2689957491 2687453737 Bacteria 11203906
255 2689991925 2687453743 Bacteria 8361025
256 2774846497 2773857921 Bacteria 9435764
257 2774851822 2773857922 Bacteria 9757215
258 2776375633 2775506925 Bacteria 7237746
259 2809588915 2808606522 Bacteria 9488490
260 2811842254 2808606982 Bacteria 7791042
261 2819700150 2818991463 Bacteria 7948711
262 2819747038 2818991472 Bacteria 10089953
263 2862184440 2862178590 Bacteria 8583590
264 2862582313 2862574272 Bacteria 10567477
265 2863075373 2863067949 Bacteria 8541735
266 2866556264 2866552031 Bacteria 5824618
267 2866612911 2866612099 Bacteria 7543886
268 2870787318 2870782633 Bacteria 9624083
269 2873152114 2873151551 Bacteria 8625867
270 2887482008 2887478801 Bacteria 8972725
271 2895883447 2895880812 Bacteria 11255272
272 2899360842 2899359706 Bacteria 10940472
273 2912727500 2912723979 Bacteria 8557534
274 2917742670 2917736166 Bacteria 9690793
275 2946078637 2946072368 Bacteria 8999607
276 3006492478 3006486233 Bacteria 8157040
277 3006494928 3006493962 Bacteria 8825450
278 3006497635 3006493962 Bacteria 8825450
279 8008575193 8008574985 Bacteria 7815457
280 8023629698 8023623736 Bacteria 8593882
281 8053953410 8053945823 Bacteria 8962862
282 8054164780 8054160619 Bacteria 7783213
283 8056214679 8056207758 Bacteria 8639239
284 Ga0307406_10052243
285 JGI24737J22298_10026746
286 rootH1_10000130
287 rootL2_10226746
288 Ga0068868_100514508
289 Ga0070710_10069722
290 Ga0070679_100614659
291 Ga0070684_100321693
292 Ga0068853_100060187
293 Ga0070665_100015279
294 Ga0070665_100023653
295 Ga0070665_100396331
296 Ga0070665_100616423
297 Ga0068855_100008014
298 Ga0068857_100221810
299 Ga0068857_100595475
300 Ga0068854_100157452
301 Ga0068856_100163544
302 Ga0068852_100025024
303 Ga0068859_100000141
304 Ga0068863_100009585
305 Ga0068858_100054625
306 Ga0068862_100000039
307 Ga0081455_10039468
308 Ga0081540_1064488
309 Ga0070715_10347340
310 Ga0070712_100136339
311 Ga0075428_100078540
312 Ga0075428_100303440
313 Ga0075428_100409926
314 Ga0075428_100592671
315 Ga0075431_100609324
316 Ga0075433_10916033
317 Ga0075429_100373743
318 Ga0097620_100000141
319 Ga0105240_10387009
320 Ga0114129_10010030
321 Ga0114129_10048939
322 Ga0105241_10002553
323 Ga0105248_11465690
324 Ga0105249_10011362
325 Ga0157369_10646345
326 Ga0157369_10746117
327 Ga0157374_10070763
328 Ga0157375_11009580
329 Ga0163163_10011656
330 Ga0163163_10102104
331 Ga0163163_10412712
332 Ga0224712_10004148
333 Ga0209758_1005785
334 Ga0207692_10040718
335 Ga0207647_10019780
336 Ga0207647_10051108
337 Ga0207654_10632122
338 Ga0207695_10043107
339 Ga0207695_10324284
340 Ga0207693_10020371
341 Ga0207694_10003816
342 Ga0207700_10220261
343 Ga0207712_10331407
344 Ga0207640_10058910
345 Ga0207677_10638121
346 Ga0207703_10058314
347 Ga0207641_10052605
348 Ga0207674_10196498
349 Ga0268266_10234255
350 Ga0268265_10000020
351 Ga0307508_10036923
352 Ga0307518_10001022
353 Ga0307518_10135474
354 Ga0395900_0129040
355 Ga0395898_0028899
356 Ga0395898_0034882
357 Ga0395905_0596973
358 Ga0395901_0119346
359 Ga0451853_0399669
360 Ga0439448_0145073
361 Ga0466969_0008976
362 Ga0466969_0168939
363 Ga0466965_0028588
364 Ga0466965_0096576
365 Ga0466965_0395441
366 Ga0466966_0003208
367 Ga0466966_0011657
368 Ga0466961_0006785
369 Ga0466961_0039558
370 Ga0466971_0003307
371 Ga0466971_0031907
372 Ga0466970_0022707
373 Ga0466970_0088220
374 Ga0466970_0215473
375 Ga0466960_0006756
376 Ga0466960_0111155
377 Ga0466959_0027944
378 Ga0466958_0046867
379 Ga0466967_0024322
380 Ga0466967_0237628
381 Ga0495592_0073854
382 Ga0495603_0023177
383 Ga0495603_0069971
384 Ga0495603_0074956
385 Ga0495603_0223041
386 Ga0495590_0095419
387 Ga0495651_0612890
388 Ga0495605_0015282
389 Ga0495605_0074071
390 Ga0495662_0268843
391 Ga0495585_0134739
392 Ga0495585_0252256
393 Ga0495594_0007740
394 Ga0495594_0020429
395 Ga0495596_0035716
396 Ga0495607_0089021
397 Ga0495583_0017469
398 Ga0495606_0004995
399 Ga0495606_0070149
400 Ga0495608_0112112
401 Ga0495616_0022140
402 Ga0495620_0003848
403 Ga0495620_0004219
404 Ga0495620_0031459
405 Ga0495628_0143537
406 Ga0495631_0004966
407 Ga0495643_0005920
408 Ga0495643_0008072
409 Ga0495643_0019087
410 Ga0495648_0029034
411 Ga0495648_0046755
412 Ga0495666_0029755
413 Ga0495666_0326138
414 Ga0495642_0182473
415 Ga0495652_0129797
416 Ga0495640_0014240
417 Ga0495597_0033606
418 Ga0495597_0034509
419 Ga0495597_0066072
420 Ga0495622_0244808
421 Ga0495667_0223448
422 Ga0495668_0009942
423 Ga0495668_0048593
424 Ga0495668_0069354
425 Ga0495634_0079564
426 Ga0495611_0045967
427 Ga0495611_0251870
428 Ga0495625_0048486
429 Ga0495625_0067021
430 Ga0495635_0373684
431 Ga0495657_0007626
432 Ga0495657_0009358
433 Ga0495623_0003125
434 Ga0495613_0006203
435 Ga0495613_0272081
436 Ga0495624_0111859
437 Ga0495649_0029916
438 Ga0495649_0163283
439 Ga0495649_0167573
440 Ga0495589_0005926
441 Ga0495589_0016188
442 Ga0495589_0045769
443 Ga0495660_0002891
444 Ga0495660_0056227
445 Ga0495660_0144389
446 Ga0495604_0004422
447 Ga0495604_0027238
448 Ga0495604_0352212
449 Ga0495604_0492085
450 Ga0495672_0192959
451 Ga0495676_0003247
452 Ga0495676_0004211
453 Ga0495676_0097009
454 Ga0495676_0188361
455 Ga0495676_0257869
456 Ga0495680_0045194
457 Ga0495680_0335665
458 Ga0495683_0070712
459 Ga0495687_010360
460 Ga0495687_011053
461 Ga0495687_030976
462 Ga0495675_0017724
463 Ga0495685_025614
464 Ga0495685_026646
465 Ga0495681_0114774
466 Ga0495686_0078249
467 Ga0495593_0008916
468 Ga0495614_0016584
469 Ga0495626_0042895
470 Ga0496102_0292185
471 Ga0496104_0370350
472 Ga0496112_0130349
473 Ga0496113_0497593
474 Ga0496117_0234712
475 Ga0496118_0024015
476 Ga0495678_037085
477 Ga0501031_0036276
478 Ga0501033_0036801
479 Ga0501033_0148607
480 Ga0501034_0007870
481 Ga0501034_0113823
482 Ga0501034_0142181
483 Ga0501034_0778756
484 Ga0501036_0000204
485 Ga0501036_0001830
486 Ga0501036_0038338
487 Ga0501037_0001575
488 Ga0501038_0041302
489 Ga0501038_0513929
490 Ga0501039_0184682
491 Ga0501040_0021163
492 Ga0501040_0146806
493 Ga0501041_0003316
494 Ga0501042_0016366
495 Ga0501043_0001522
496 Ga0501043_0013585
497 Ga0501047_0003044
498 Ga0501047_0007794
499 Ga0501047_0058440
500 Ga0501048_0024315
501 Ga0501067_0008933
502 Ga0501068_0008386
503 Ga0501069_0065824
504 Ga0501070_0013064
505 Ga0501070_0428466
506 Ga0501071_0170985
507 Ga0501072_0006003
508 Ga0501074_0042773
509 Ga0501074_0069442
510 Ga0501076_0037798
511 Ga0501077_0076710
512 Ga0501079_0041524
513 Ga0501080_0141449
514 Ga0501083_0005628
515 Ga0501035_0014351
516 Ga0501044_0034639
517 Ga0501044_0060839
518 Ga0501044_0328529
519 Ga0501045_0120327
520 nmdc:mga05p37_192167_c1
521 nmdc:mga05p37_300704_c1
522 nmdc:mga09592_854724_c1
523 nmdc:mga06r32_200669_c1
524 Ga0500646_0000370
525 Ga0500588_0000383
526 Ga0466962_0013479
527 Ga0530510_0225590
528 Ga0530510_0289745
529 2508678391
530 2547405754
531 2585318854
532 2586059862
533 2616701245
534 2671833666
535 2676201921
536 2686537002
537 2689957491
538 2689991925
539 2774846497
540 2774851822
541 2776375633
542 2809588915
543 2811842254
544 2819700150
545 2819747038
546 2862184440
547 2862582313
548 2863075373
549 2866556264
550 2866612911
551 2870787318
552 2873152114
553 2887482008
554 2895883447
555 2899360842
556 2912727500
557 2917742670
558 2946078637
559 3006492478
560 3006494928
561 3006497635
562 8008575193
563 8023629698
564 8053953410
565 8054164780
566 8056214679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

83

231

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a5v-assembly1.cif.gz_A crystal structure of m. tuberculosis beta carbonic anhydrase, rv3588c, tetrameric form 0.9555 6 205
1ym3-assembly1.cif.gz_A-2 crystal structure of carbonic anhydrase rv3588c from mycobacterium tuberculosis 0.9409 7 205
1ym3-assembly1.cif.gz_A-2 crystal structure of carbonic anhydrase rv3588c from mycobacterium tuberculosis 0.9175 7 205
2a5v-assembly1.cif.gz_A crystal structure of m. tuberculosis beta carbonic anhydrase, rv3588c, tetrameric form 0.9071 6 205
3e1v-assembly2.cif.gz_A h. influenzae beta-carbonic anhydrase, variant d44n 0.8516 46 195
ID Description Score Start End Superfamily
1ym3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9409 7 205 3.40.1050.10
1ym3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9175 7 205 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8664 45 202 3.40.1050.10
af_A0A0R0GEN7_55_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8363 81 199 3.40.1050.10
2w3qA02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8191 49 199 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A516PW94-F1-model_v4 Carbonic anhydrase 0.99 101 205 GO:0004089
GO:0008270
AF-X7VY04-F1-model_v4 deleted 0.9825 52 205
AF-W5YAN6-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9801 45 205 GO:0004089
GO:0008270
GO:0015976
AF-A0A1H7NTU2-F1-model_v4 Carbonic anhydrase 0.9795 73 210 GO:0004089
GO:0008270
AF-A0A6B3CE08-F1-model_v4 Carbonic anhydrase 0.9786 80 206 GO:0004089
GO:0008270

Map