F385665

General Info

Members Datasets Scaffolds Average Seq Length
283 66 283 159

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10107867|Ga0316579_101078672
Length 182
Sequence MTTEIATFEPVIIGFTCNWCSYRAADLAGTARVKYPPNIRLIRLMCSGRLDPTFVLKAFAEGADAVMISGCHPGECHYIEQNIKALRRFELLRRTIQQMGIEPERLQLVWASAAEGTRLANEIARVTEEVRALGPLNWPAGRNGNLDSAGLEAAWEATGGEPGGPPETPGGENPEHAAEAKR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
6 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
7 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
10 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
11 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
12 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
13 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
14 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
15 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
16 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
17 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
18 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
19 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
20 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
21 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
28 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
29 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
30 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
31 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
32 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
33 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
34 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
35 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
36 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
37 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
38 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
39 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
40 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
41 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
45 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
46 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
47 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
51 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
52 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
53 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
54 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
57 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
58 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
61 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
63 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
64 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
65 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
66 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.57
Metatranscriptomes 19.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_398890 2162886006 Eukaryota 1544
2 SwRhRL2b_contig_1448716 2162886007 Bacteria 7311
3 Ga0065704_10000385 3300005289 Bacteria 41151
4 Ga0065707_10000437 3300005295 Bacteria 81012
5 Ga0075434_100980743 3300006871 Unclassified 859
6 Ga0075429_100066060 3300006880 Bacteria 3148
7 Ga0114129_10008767 3300009147 Bacteria 14423
8 Ga0105246_10027892 3300011119 Bacteria 3706
9 Ga0265318_10099461 3300028577 Bacteria 1070
10 Ga0316575_10005938 3300031665 Bacteria 4371
11 Ga0316575_10009775 3300031665 Bacteria 3516
12 Ga0316575_10023736 3300031665 Bacteria 2372
13 Ga0316575_10064267 3300031665 Unclassified 1469
14 Ga0316579_10000322 3300031691 Bacteria 14904
15 Ga0316579_10001798 3300031691 Bacteria 7903
16 Ga0316579_10008385 3300031691 Bacteria 4305
17 Ga0316579_10021646 3300031691 Bacteria 2867
18 Ga0316579_10034437 3300031691 Unclassified 2330
19 Ga0316579_10044243 3300031691 Bacteria 2073
20 Ga0316579_10078617 3300031691 Unclassified 1569
21 Ga0316579_10081996 3300031691 Unclassified 1536
22 Ga0316579_10098902 3300031691 Bacteria 1396
23 Ga0316579_10107867 3300031691 Bacteria 1336
24 Ga0316579_10118435 3300031691 Unclassified 1272
25 Ga0316579_10492025 3300031691 Unclassified 593
26 Ga0316576_10000179 3300031727 Bacteria 26247
27 Ga0316576_10000303 3300031727 Bacteria 21791
28 Ga0316576_10002981 3300031727 Bacteria 9816
29 Ga0316576_10004168 3300031727 Bacteria 8627
30 Ga0316576_10008062 3300031727 Bacteria 6683
31 Ga0316576_10013941 3300031727 Bacteria 5360
32 Ga0316576_10049342 3300031727 Bacteria 3057
33 Ga0316576_10077165 3300031727 Unclassified 2467
34 Ga0316576_10095400 3300031727 Unclassified 2219
35 Ga0316576_10131088 3300031727 Bacteria 1886
36 Ga0316576_10209566 3300031727 Bacteria 1467
37 Ga0316576_10214581 3300031727 Unclassified 1448
38 Ga0316576_10347571 3300031727 Bacteria 1104
39 Ga0316576_10394649 3300031727 Bacteria 1026
40 Ga0316576_10637565 3300031727 Unclassified 776
41 Ga0316578_10000664 3300031728 Bacteria 12230
42 Ga0316578_10002941 3300031728 Bacteria 7651
43 Ga0316578_10003239 3300031728 Bacteria 7390
44 Ga0316578_10006255 3300031728 Bacteria 5860
45 Ga0316578_10006916 3300031728 Bacteria 5642
46 Ga0316578_10016906 3300031728 Bacteria 3958
47 Ga0316578_10024708 3300031728 Bacteria 3372
48 Ga0316578_10046707 3300031728 Unclassified 2524
49 Ga0316578_10130540 3300031728 Bacteria 1512
50 Ga0316578_10140852 3300031728 Bacteria 1453
51 Ga0316578_10141027 3300031728 Unclassified 1452
52 Ga0316578_10350674 3300031728 Bacteria 878
53 Ga0316578_10356479 3300031728 Unclassified 870
54 Ga0316578_10378269 3300031728 Bacteria 841
55 Ga0316578_10499781 3300031728 Bacteria 717
56 Ga0316578_10556921 3300031728 Unclassified 673
57 Ga0316577_10000497 3300031733 Bacteria 15594
58 Ga0316577_10000590 3300031733 Bacteria 14916
59 Ga0316577_10001555 3300031733 Bacteria 10914
60 Ga0316577_10007273 3300031733 Bacteria 5904
61 Ga0316577_10017261 3300031733 Unclassified 3983
62 Ga0316577_10022711 3300031733 Bacteria 3483
63 Ga0316577_10087502 3300031733 Bacteria 1743
64 Ga0316577_10102056 3300031733 Unclassified 1608
65 Ga0316577_10116857 3300031733 Bacteria 1498
66 Ga0316577_10130454 3300031733 Bacteria 1414
67 Ga0316577_10132761 3300031733 Unclassified 1401
68 Ga0316577_10208955 3300031733 Bacteria 1103
69 Ga0316577_10231533 3300031733 Unclassified 1045
70 Ga0316577_10601435 3300031733 Unclassified 625
71 Ga0307413_11155531 3300031824 Unclassified 671
72 Ga0307407_11458927 3300031903 Unclassified 540
73 Ga0307416_101291326 3300032002 Unclassified 836
74 Ga0316583_10000134 3300032133 Bacteria 17327
75 Ga0316583_10034109 3300032133 Bacteria 1805
76 Ga0316583_10153576 3300032133 Unclassified 801
77 Ga0316585_10000007 3300032137 Bacteria 31913
78 Ga0316585_10004097 3300032137 Bacteria 4044
79 Ga0316585_10090596 3300032137 Unclassified 999
80 Ga0316585_10106656 3300032137 Bacteria 920
81 Ga0316580_10000256 3300032139 Bacteria 11378
82 Ga0316580_10005632 3300032139 Bacteria 3666
83 Ga0316580_10020454 3300032139 Unclassified 2039
84 Ga0316593_10000492 3300032168 Bacteria 7329
85 Ga0316593_10000708 3300032168 Bacteria 6522
86 Ga0316593_10001059 3300032168 Bacteria 5748
87 Ga0316593_10001563 3300032168 Bacteria 5097
88 Ga0316593_10002686 3300032168 Bacteria 4278
89 Ga0316593_10025602 3300032168 Bacteria 1880
90 Ga0316593_10058139 3300032168 Bacteria 1318
91 Ga0316593_10097887 3300032168 Bacteria 1038
92 Ga0316593_10141370 3300032168 Unclassified 872
93 Ga0316592_1000104 3300033524 Bacteria 8625
94 Ga0316592_1000141 3300033524 Bacteria 7961
95 Ga0316592_1001039 3300033524 Bacteria 4320
96 Ga0316592_1006648 3300033524 Bacteria 2234
97 Ga0316592_1058669 3300033524 Unclassified 863
98 Ga0316592_1072821 3300033524 Unclassified 778
99 Ga0316586_1000042 3300033527 Bacteria 8762
100 Ga0316586_1000074 3300033527 Bacteria 7262
101 Ga0316586_1000315 3300033527 Bacteria 4441
102 Ga0316586_1000324 3300033527 Bacteria 4408
103 Ga0316586_1000374 3300033527 Unclassified 4222
104 Ga0316586_1000428 3300033527 Bacteria 4053
105 Ga0316586_1000654 3300033527 Bacteria 3472
106 Ga0316586_1000682 3300033527 Bacteria 3427
107 Ga0316586_1001222 3300033527 Bacteria 2859
108 Ga0316586_1011820 3300033527 Bacteria 1344
109 Ga0316586_1027697 3300033527 Bacteria 960
110 Ga0316586_1072897 3300033527 Bacteria 634
111 Ga0316586_1103527 3300033527 Unclassified 546
112 Ga0316588_1000081 3300033528 Bacteria 8504
113 Ga0316588_1000109 3300033528 Bacteria 8001
114 Ga0316588_1000184 3300033528 Bacteria 7089
115 Ga0316588_1000918 3300033528 Bacteria 4523
116 Ga0316588_1001001 3300033528 Bacteria 4401
117 Ga0316588_1001321 3300033528 Bacteria 4005
118 Ga0316588_1004575 3300033528 Unclassified 2633
119 Ga0316588_1011431 3300033528 Unclassified 1894
120 Ga0316588_1016308 3300033528 Bacteria 1645
121 Ga0316588_1027183 3300033528 Unclassified 1328
122 Ga0316588_1052211 3300033528 Bacteria 992
123 Ga0316588_1062477 3300033528 Unclassified 909
124 Ga0316588_1143339 3300033528 Unclassified 611
125 Ga0316587_1000149 3300033529 Bacteria 5664
126 Ga0316587_1004484 3300033529 Bacteria 2034
127 Ga0316587_1008275 3300033529 Bacteria 1631
128 Ga0316587_1011205 3300033529 Unclassified 1444
129 Ga0316587_1044358 3300033529 Unclassified 807
130 Ga0316587_1073530 3300033529 Bacteria 642
131 Ga0316596_1000088 3300033541 Bacteria 11233
132 Ga0316596_1000930 3300033541 Bacteria 5564
133 Ga0316596_1001695 3300033541 Bacteria 4553
134 Ga0316596_1002735 3300033541 Bacteria 3794
135 Ga0316596_1002755 3300033541 Bacteria 3787
136 Ga0316596_1028404 3300033541 Bacteria 1446
137 Ga0316596_1039305 3300033541 Bacteria 1241
138 Ga0316596_1055066 3300033541 Bacteria 1056
139 Ga0316574_0000797 3300035398 Bacteria 13671
140 Ga0316574_0004280 3300035398 Bacteria 7456
141 Ga0316574_0014976 3300035398 Bacteria 4492
142 Ga0316574_0017328 3300035398 Unclassified 4216
143 Ga0316574_0030976 3300035398 Bacteria 3243
144 Ga0316574_0053675 3300035398 Bacteria 2516
145 Ga0316574_0116509 3300035398 Bacteria 1714
146 Ga0316574_0184392 3300035398 Unclassified 1342
147 Ga0316574_0188351 3300035398 Bacteria 1327
148 Ga0316574_0229352 3300035398 Bacteria 1189
149 Ga0316574_0255569 3300035398 Unclassified 1119
150 Ga0316574_0429229 3300035398 Bacteria 830
151 Ga0316574_0739365 3300035398 Unclassified 601
152 Ga0316582_0014399 3300036647 Unclassified 4487
153 Ga0316582_0017177 3300036647 Bacteria 4179
154 Ga0316582_0023160 3300036647 Unclassified 3698
155 Ga0316582_0028817 3300036647 Bacteria 3367
156 Ga0316582_0030591 3300036647 Unclassified 3281
157 Ga0316582_0036149 3300036647 Unclassified 3055
158 Ga0316582_0039553 3300036647 Bacteria 2937
159 Ga0316582_0044112 3300036647 Bacteria 2801
160 Ga0316582_0054965 3300036647 Bacteria 2537
161 Ga0316582_0060378 3300036647 Bacteria 2430
162 Ga0316582_0093426 3300036647 Bacteria 1983
163 Ga0316582_0105793 3300036647 Bacteria 1868
164 Ga0316582_0128991 3300036647 Unclassified 1697
165 Ga0316582_0168631 3300036647 Unclassified 1485
166 Ga0316582_0474895 3300036647 Bacteria 862
167 Ga0316582_0509039 3300036647 Unclassified 830
168 Ga0316582_1033948 3300036647 Unclassified 560
169 Ga0316584_0001088 3300036712 Bacteria 15887
170 Ga0316584_0004941 3300036712 Bacteria 8873
171 Ga0316584_0009958 3300036712 Bacteria 6621
172 Ga0316584_0051982 3300036712 Bacteria 3065
173 Ga0316584_0053538 3300036712 Bacteria 3020
174 Ga0316584_0060136 3300036712 Bacteria 2845
175 Ga0316584_0077630 3300036712 Unclassified 2488
176 Ga0316584_0111860 3300036712 Bacteria 2043
177 Ga0316584_0130242 3300036712 Unclassified 1879
178 Ga0316584_0223621 3300036712 Bacteria 1382
179 Ga0316584_0296692 3300036712 Bacteria 1171
180 Ga0316584_0482159 3300036712 Bacteria 873
181 Ga0316584_0536831 3300036712 Unclassified 818
182 Ga0316581_0007325 3300037588 Unclassified 2956
183 Ga0316581_0023461 3300037588 Unclassified 1825
184 Ga0316581_0033003 3300037588 Bacteria 1563
185 Ga0316581_0045923 3300037588 Unclassified 1335
186 Ga0400484_06661 3300038725 Bacteria 16539
187 Ga0400484_33134 3300038725 Bacteria 1254
188 Ga0400490_19113 3300038726 Bacteria 10534
189 Ga0400483_144676 3300039062 Bacteria 1100
190 Ga0400489_25125 3300039093 Bacteria 1910
191 Ga0451577_0067910 3300042876 Bacteria 3180
192 Ga0451577_0105605 3300042876 Bacteria 2517
193 Ga0451577_0594088 3300042876 Unclassified 1005
194 Ga0451577_0719253 3300042876 Bacteria 904
195 Ga0451577_1299425 3300042876 Bacteria 647
196 Ga0453683_0006138 3300044673 Bacteria 8274
197 Ga0453683_0010055 3300044673 Bacteria 6290
198 Ga0453683_0219446 3300044673 Bacteria 1209
199 Ga0453683_0811859 3300044673 Bacteria 616
200 Ga0453684_0000003 3300044712 Bacteria 1481694
201 Ga0453684_0000640 3300044712 Bacteria 126342
202 Ga0453684_0002633 3300044712 Bacteria 42891
203 Ga0453684_0003052 3300044712 Bacteria 38873
204 Ga0453684_0003091 3300044712 Bacteria 38407
205 Ga0453684_0007761 3300044712 Bacteria 19573
206 Ga0453684_0013594 3300044712 Bacteria 13197
207 Ga0453684_0019366 3300044712 Bacteria 10364
208 Ga0453684_0032194 3300044712 Bacteria 7347
209 Ga0453684_0042211 3300044712 Bacteria 6152
210 Ga0453684_0044399 3300044712 Bacteria 5948
211 Ga0453684_0044637 3300044712 Bacteria 5925
212 Ga0453684_0112964 3300044712 Unclassified 3296
213 Ga0453684_0129411 3300044712 Unclassified 3031
214 Ga0453684_0254691 3300044712 Unclassified 2014
215 Ga0453684_0360364 3300044712 Bacteria 1637
216 Ga0453684_0360527 3300044712 Bacteria 1637
217 Ga0453684_0368649 3300044712 Unclassified 1615
218 Ga0453684_0408145 3300044712 Unclassified 1520
219 Ga0453684_0423828 3300044712 Bacteria 1486
220 Ga0453684_0599185 3300044712 Bacteria 1208
221 Ga0453684_0646401 3300044712 Bacteria 1155
222 Ga0453684_0761311 3300044712 Bacteria 1047
223 Ga0453684_0822877 3300044712 Bacteria 1000
224 Ga0453684_0899555 3300044712 Bacteria 948
225 Ga0453684_1033937 3300044712 Bacteria 872
226 Ga0453684_1049254 3300044712 Unclassified 864
227 Ga0453684_1060123 3300044712 Bacteria 859
228 Ga0453684_1117868 3300044712 Unclassified 831
229 Ga0453684_1994684 3300044712 Unclassified 585
230 Ga0453684_2078281 3300044712 Bacteria 570
231 Ga0451576_0018536 3300045051 Bacteria 7626
232 Ga0451576_0020476 3300045051 Bacteria 7202
233 Ga0451576_0040702 3300045051 Bacteria 4916
234 Ga0451576_0097442 3300045051 Bacteria 3058
235 Ga0451576_0568776 3300045051 Bacteria 1191
236 Ga0501292_067231 3300049515 Bacteria 660
237 Ga0501031_0008874 3300049568 Bacteria 6535
238 Ga0501036_0036074 3300049572 Bacteria 4183
239 Ga0501037_0208936 3300049573 Unclassified 1377
240 Ga0501038_0006809 3300049574 Bacteria 10558
241 Ga0501039_0022549 3300049575 Bacteria 4833
242 Ga0501040_0215799 3300049576 Bacteria 1364
243 Ga0501040_0491917 3300049576 Bacteria 884
244 Ga0501040_0891101 3300049576 Unclassified 644
245 Ga0501041_0000862 3300049577 Bacteria 16353
246 Ga0501041_0302006 3300049577 Unclassified 1009
247 Ga0501041_0632135 3300049577 Bacteria 684
248 Ga0501042_0390898 3300049578 Bacteria 1007
249 Ga0501046_0009166 3300049580 Bacteria 8573
250 Ga0501046_0288071 3300049580 Unclassified 1202
251 Ga0501048_0006016 3300049582 Bacteria 9239
252 Ga0501070_0010987 3300049586 Bacteria 7644
253 Ga0501071_0727884 3300049587 Unclassified 764
254 Ga0501072_0004279 3300049588 Bacteria 10832
255 Ga0501074_0197715 3300049590 Unclassified 1433
256 Ga0501075_0040036 3300049591 Bacteria 3508
257 Ga0501075_0068152 3300049591 Bacteria 2688
258 Ga0501075_0471331 3300049591 Unclassified 958
259 Ga0501075_1039717 3300049591 Bacteria 622
260 Ga0501076_0005038 3300049592 Bacteria 9456
261 Ga0501076_0286445 3300049592 Unclassified 1350
262 Ga0501076_1064516 3300049592 Bacteria 666
263 Ga0501077_0094613 3300049593 Bacteria 1894
264 Ga0501077_0507583 3300049593 Unclassified 773
265 Ga0501236_013520 3300049670 Bacteria 1118
266 Ga0501079_0008295 3300049741 Bacteria 7873
267 Ga0501079_0436071 3300049741 Bacteria 1029
268 Ga0501079_1095894 3300049741 Unclassified 627
269 Ga0501080_0022801 3300049742 Bacteria 5801
270 Ga0501080_0425778 3300049742 Bacteria 1192
271 Ga0501080_1092543 3300049742 Bacteria 689
272 Ga0501081_0014533 3300049743 Bacteria 5193
273 Ga0501081_0698747 3300049743 Unclassified 761
274 Ga0501035_0141431 3300049822 Bacteria 2092
275 Ga0501045_0009318 3300049824 Bacteria 6866
276 nmdc:mga05p37_9614_c1 3300050507 Bacteria 11452
277 Ga0501084_0038484 3300054114 Bacteria 3998
278 Ga0501084_0221987 3300054114 Bacteria 1595
279 Ga0501084_0270418 3300054114 Unclassified 1435
280 Ga0501084_0497361 3300054114 Bacteria 1030
281 Ga0501082_0196313 3300060353 Unclassified 1756
282 Ga0530510_0016284 3300061734 Bacteria 5258
283 Ga0530510_0949821 3300061734 Bacteria 657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0482159 Ga0316584_0482159_18_467 140
2 3300033527 Ga0316586_1000374 Ga0316586_10003744 142
3 3300033529 Ga0316587_1011205 Ga0316587_10112052 142
4 3300035398 Ga0316574_0030976 Ga0316574_0030976_2050_2517 142
5 3300036647 Ga0316582_0023160 Ga0316582_0023160_804_1271 142
6 3300044712 Ga0453684_0000003 Ga0453684_0000003_1396759_1397223 142
7 3300049568 Ga0501031_0008874 Ga0501031_0008874_741_1250 143
8 3300049573 Ga0501037_0208936 Ga0501037_0208936_656_1165 143
9 3300049574 Ga0501038_0006809 Ga0501038_0006809_5566_6093 143
10 3300049576 Ga0501040_0215799 Ga0501040_0215799_97_624 143
11 3300049577 Ga0501041_0000862 Ga0501041_0000862_8977_9504 143
12 3300049580 Ga0501046_0009166 Ga0501046_0009166_4533_5042 143
13 3300049588 Ga0501072_0004279 Ga0501072_0004279_7265_7792 143
14 3300049591 Ga0501075_0040036 Ga0501075_0040036_1802_2311 143
15 3300049592 Ga0501076_0005038 Ga0501076_0005038_2651_3160 143
16 3300049743 Ga0501081_0014533 Ga0501081_0014533_3342_3869 143
17 3300049822 Ga0501035_0141431 Ga0501035_0141431_67_576 143
18 3300049824 Ga0501045_0009318 Ga0501045_0009318_6048_6557 143
19 3300061734 Ga0530510_0016284 Ga0530510_0016284_1813_2304 143
20 3300044712 Ga0453684_0000640 Ga0453684_0000640_33425_33880 145
21 3300044712 Ga0453684_1994684 Ga0453684_1994684_72_527 145
22 3300049572 Ga0501036_0036074 Ga0501036_0036074_1604_2095 145
23 3300049575 Ga0501039_0022549 Ga0501039_0022549_2955_3446 145
24 3300049582 Ga0501048_0006016 Ga0501048_0006016_3986_4477 145
25 3300049586 Ga0501070_0010987 Ga0501070_0010987_3292_3783 145
26 3300049593 Ga0501077_0094613 Ga0501077_0094613_395_886 145
27 3300049593 Ga0501077_0507583 Ga0501077_0507583_20_502 145
28 3300054114 Ga0501084_0038484 Ga0501084_0038484_2503_2994 145
29 3300031691 Ga0316579_10034437 Ga0316579_100344372 146
30 3300031727 Ga0316576_10214581 Ga0316576_102145812 146
31 3300031733 Ga0316577_10017261 Ga0316577_100172612 146
32 3300033524 Ga0316592_1058669 Ga0316592_10586692 146
33 3300036647 Ga0316582_0030591 Ga0316582_0030591_1954_2421 146
34 3300036712 Ga0316584_0296692 Ga0316584_0296692_617_1084 146
35 3300037588 Ga0316581_0023461 Ga0316581_0023461_1015_1482 146
36 3300044712 Ga0453684_0599185 Ga0453684_0599185_593_1054 146
37 3300049587 Ga0501071_0727884 Ga0501071_0727884_29_496 146
38 3300049591 Ga0501075_0471331 Ga0501075_0471331_89_559 146
39 3300049592 Ga0501076_0286445 Ga0501076_0286445_552_1022 146
40 3300054114 Ga0501084_0270418 Ga0501084_0270418_903_1370 146
41 3300032168 Ga0316593_10001563 Ga0316593_100015632 147
42 3300031691 Ga0316579_10044243 Ga0316579_100442432 148
43 3300031727 Ga0316576_10000179 Ga0316576_1000017918 148
44 3300031727 Ga0316576_10209566 Ga0316576_102095662 148
45 3300031728 Ga0316578_10002941 Ga0316578_100029414 148
46 3300031728 Ga0316578_10006255 Ga0316578_100062555 148
47 3300031733 Ga0316577_10116857 Ga0316577_101168572 148
48 3300033529 Ga0316587_1073530 Ga0316587_10735302 148
49 3300036647 Ga0316582_0014399 Ga0316582_0014399_3787_4251 148
50 3300036712 Ga0316584_0077630 Ga0316584_0077630_974_1435 148
51 3300036712 Ga0316584_0111860 Ga0316584_0111860_230_694 148
52 3300044712 Ga0453684_0003091 Ga0453684_0003091_20487_20984 148
53 3300031665 Ga0316575_10009775 Ga0316575_100097752 149
54 3300031665 Ga0316575_10023736 Ga0316575_100237362 149
55 3300031665 Ga0316575_10064267 Ga0316575_100642671 149
56 3300031691 Ga0316579_10001798 Ga0316579_100017986 149
57 3300031691 Ga0316579_10008385 Ga0316579_100083853 149
58 3300031691 Ga0316579_10078617 Ga0316579_100786171 149
59 3300031691 Ga0316579_10081996 Ga0316579_100819962 149
60 3300031691 Ga0316579_10492025 Ga0316579_104920252 149
61 3300031727 Ga0316576_10000303 Ga0316576_1000030310 149
62 3300031727 Ga0316576_10002981 Ga0316576_100029815 149
63 3300031727 Ga0316576_10008062 Ga0316576_100080625 149
64 3300031727 Ga0316576_10394649 Ga0316576_103946492 149
65 3300031728 Ga0316578_10000664 Ga0316578_1000066411 149
66 3300031728 Ga0316578_10003239 Ga0316578_100032396 149
67 3300031728 Ga0316578_10024708 Ga0316578_100247082 149
68 3300031728 Ga0316578_10046707 Ga0316578_100467072 149
69 3300031728 Ga0316578_10130540 Ga0316578_101305402 149
70 3300031728 Ga0316578_10356479 Ga0316578_103564792 149
71 3300031728 Ga0316578_10378269 Ga0316578_103782692 149
72 3300031733 Ga0316577_10000497 Ga0316577_100004976 149
73 3300031733 Ga0316577_10022711 Ga0316577_100227112 149
74 3300031733 Ga0316577_10601435 Ga0316577_106014351 149
75 3300032133 Ga0316583_10000134 Ga0316583_1000013413 149
76 3300032133 Ga0316583_10034109 Ga0316583_100341092 149
77 3300032133 Ga0316583_10153576 Ga0316583_101535762 149
78 3300032137 Ga0316585_10000007 Ga0316585_1000000721 149
79 3300032137 Ga0316585_10004097 Ga0316585_100040973 149
80 3300032137 Ga0316585_10090596 Ga0316585_100905962 149
81 3300032139 Ga0316580_10000256 Ga0316580_100002563 149
82 3300032139 Ga0316580_10005632 Ga0316580_100056322 149
83 3300032139 Ga0316580_10020454 Ga0316580_100204542 149
84 3300032168 Ga0316593_10000492 Ga0316593_100004924 149
85 3300032168 Ga0316593_10000708 Ga0316593_100007084 149
86 3300032168 Ga0316593_10001059 Ga0316593_100010594 149
87 3300032168 Ga0316593_10097887 Ga0316593_100978872 149
88 3300032168 Ga0316593_10141370 Ga0316593_101413702 149
89 3300033524 Ga0316592_1000104 Ga0316592_10001044 149
90 3300033524 Ga0316592_1000141 Ga0316592_10001416 149
91 3300033524 Ga0316592_1006648 Ga0316592_10066483 149
92 3300033527 Ga0316586_1000324 Ga0316586_10003241 149
93 3300033527 Ga0316586_1000682 Ga0316586_10006822 149
94 3300033528 Ga0316588_1000081 Ga0316588_10000814 149
95 3300033528 Ga0316588_1000109 Ga0316588_10001095 149
96 3300033528 Ga0316588_1000918 Ga0316588_10009182 149
97 3300033528 Ga0316588_1001001 Ga0316588_10010016 149
98 3300033528 Ga0316588_1062477 Ga0316588_10624771 149
99 3300033541 Ga0316596_1000088 Ga0316596_10000889 149
100 3300033541 Ga0316596_1000930 Ga0316596_10009304 149
101 3300033541 Ga0316596_1002735 Ga0316596_10027354 149
102 3300033541 Ga0316596_1039305 Ga0316596_10393051 149
103 3300035398 Ga0316574_0014976 Ga0316574_0014976_492_959 149
104 3300035398 Ga0316574_0053675 Ga0316574_0053675_712_1221 149
105 3300035398 Ga0316574_0116509 Ga0316574_0116509_887_1426 149
106 3300035398 Ga0316574_0184392 Ga0316574_0184392_285_752 149
107 3300035398 Ga0316574_0429229 Ga0316574_0429229_91_567 149
108 3300036647 Ga0316582_0060378 Ga0316582_0060378_1521_1991 149
109 3300036647 Ga0316582_0105793 Ga0316582_0105793_225_698 149
110 3300036647 Ga0316582_0128991 Ga0316582_0128991_1057_1566 149
111 3300036647 Ga0316582_0168631 Ga0316582_0168631_120_587 149
112 3300036647 Ga0316582_1033948 Ga0316582_1033948_77_547 149
113 3300036712 Ga0316584_0001088 Ga0316584_0001088_4291_4758 149
114 3300036712 Ga0316584_0053538 Ga0316584_0053538_682_1149 149
115 3300036712 Ga0316584_0060136 Ga0316584_0060136_756_1226 149
116 3300042876 Ga0451577_0594088 Ga0451577_0594088_16_486 149
117 3300044673 Ga0453683_0010055 Ga0453683_0010055_1906_2376 149
118 3300044712 Ga0453684_0822877 Ga0453684_0822877_230_700 149
119 3300044712 Ga0453684_1060123 Ga0453684_1060123_259_729 149
120 3300045051 Ga0451576_0018536 Ga0451576_0018536_4285_4755 149
121 3300033527 Ga0316586_1011820 Ga0316586_10118202 150
122 3300033527 Ga0316586_1072897 Ga0316586_10728972 150
123 3300033527 Ga0316586_1103527 Ga0316586_11035271 150
124 3300033528 Ga0316588_1027183 Ga0316588_10271832 150
125 3300033528 Ga0316588_1143339 Ga0316588_11433392 150
126 3300033541 Ga0316596_1055066 Ga0316596_10550661 150
127 3300049577 Ga0501041_0632135 Ga0501041_0632135_187_672 150
128 3300049742 Ga0501080_0022801 Ga0501080_0022801_972_1448 150
129 3300049742 Ga0501080_0425778 Ga0501080_0425778_501_986 150
130 3300054114 Ga0501084_0497361 Ga0501084_0497361_368_853 150
131 3300031727 Ga0316576_10077165 Ga0316576_100771652 151
132 3300031727 Ga0316576_10347571 Ga0316576_103475712 151
133 3300031727 Ga0316576_10637565 Ga0316576_106375652 151
134 3300031728 Ga0316578_10350674 Ga0316578_103506741 151
135 3300031733 Ga0316577_10102056 Ga0316577_101020562 151
136 3300033527 Ga0316586_1000654 Ga0316586_10006542 151
137 3300033527 Ga0316586_1001222 Ga0316586_10012223 151
138 3300033528 Ga0316588_1004575 Ga0316588_10045752 151
139 3300033528 Ga0316588_1016308 Ga0316588_10163082 151
140 3300033528 Ga0316588_1052211 Ga0316588_10522112 151
141 3300035398 Ga0316574_0017328 Ga0316574_0017328_2838_3314 151
142 3300038725 Ga0400484_06661 Ga0400484_06661_8287_8766 151
143 3300038726 Ga0400490_19113 Ga0400490_19113_4855_5334 151
144 3300039062 Ga0400483_144676 Ga0400483_144676_269_739 151
145 3300044712 Ga0453684_0003052 Ga0453684_0003052_31504_32037 151
146 3300044712 Ga0453684_0044637 Ga0453684_0044637_5310_5801 151
147 3300044712 Ga0453684_0129411 Ga0453684_0129411_1144_1638 151
148 3300044712 Ga0453684_0254691 Ga0453684_0254691_131_622 151
149 3300044712 Ga0453684_0899555 Ga0453684_0899555_375_857 151
150 3300031665 Ga0316575_10005938 Ga0316575_100059384 152
151 3300031691 Ga0316579_10118435 Ga0316579_101184352 152
152 3300031727 Ga0316576_10095400 Ga0316576_100954002 152
153 3300031727 Ga0316576_10131088 Ga0316576_101310881 152
154 3300031728 Ga0316578_10141027 Ga0316578_101410272 152
155 3300031733 Ga0316577_10132761 Ga0316577_101327612 152
156 3300031733 Ga0316577_10208955 Ga0316577_102089552 152
157 3300032168 Ga0316593_10002686 Ga0316593_100026865 152
158 3300033527 Ga0316586_1000074 Ga0316586_10000744 152
159 3300033527 Ga0316586_1000428 Ga0316586_10004285 152
160 3300033527 Ga0316586_1027697 Ga0316586_10276972 152
161 3300033528 Ga0316588_1011431 Ga0316588_10114312 152
162 3300033529 Ga0316587_1000149 Ga0316587_10001493 152
163 3300033529 Ga0316587_1004484 Ga0316587_10044842 152
164 3300035398 Ga0316574_0000797 Ga0316574_0000797_7584_8060 152
165 3300035398 Ga0316574_0004280 Ga0316574_0004280_4216_4701 152
166 3300035398 Ga0316574_0188351 Ga0316574_0188351_828_1313 152
167 3300035398 Ga0316574_0229352 Ga0316574_0229352_646_1131 152
168 3300036647 Ga0316582_0054965 Ga0316582_0054965_386_871 152
169 3300036712 Ga0316584_0536831 Ga0316584_0536831_149_625 152
170 3300038725 Ga0400484_33134 Ga0400484_33134_497_970 152
171 3300044712 Ga0453684_1049254 Ga0453684_1049254_19_504 152
172 3300028577 Ga0265318_10099461 Ga0265318_100994611 153
173 3300031691 Ga0316579_10000322 Ga0316579_1000032210 153
174 3300031727 Ga0316576_10004168 Ga0316576_100041683 153
175 3300031727 Ga0316576_10013941 Ga0316576_100139415 153
176 3300031728 Ga0316578_10006916 Ga0316578_100069165 153
177 3300031728 Ga0316578_10016906 Ga0316578_100169062 153
178 3300031733 Ga0316577_10000590 Ga0316577_1000059010 153
179 3300031733 Ga0316577_10001555 Ga0316577_100015558 153
180 3300031733 Ga0316577_10007273 Ga0316577_100072732 153
181 3300031733 Ga0316577_10231533 Ga0316577_102315332 153
182 3300032137 Ga0316585_10106656 Ga0316585_101066561 153
183 3300033524 Ga0316592_1001039 Ga0316592_10010394 153
184 3300033527 Ga0316586_1000042 Ga0316586_10000426 153
185 3300033527 Ga0316586_1000315 Ga0316586_10003152 153
186 3300033528 Ga0316588_1001321 Ga0316588_10013212 153
187 3300033529 Ga0316587_1008275 Ga0316587_10082752 153
188 3300033541 Ga0316596_1001695 Ga0316596_10016955 153
189 3300035398 Ga0316574_0255569 Ga0316574_0255569_464_949 153
190 3300036647 Ga0316582_0039553 Ga0316582_0039553_1580_2065 153
191 3300036647 Ga0316582_0093426 Ga0316582_0093426_1451_1936 153
192 3300036712 Ga0316584_0004941 Ga0316584_0004941_3968_4453 153
193 3300036712 Ga0316584_0009958 Ga0316584_0009958_5454_5939 153
194 3300039093 Ga0400489_25125 Ga0400489_25125_313_795 153
195 3300031691 Ga0316579_10098902 Ga0316579_100989022 154
196 3300036647 Ga0316582_0036149 Ga0316582_0036149_1464_1952 154
197 3300031728 Ga0316578_10499781 Ga0316578_104997812 155
198 3300031824 Ga0307413_11155531 Ga0307413_111555312 155
199 3300031903 Ga0307407_11458927 Ga0307407_114589271 155
200 3300032002 Ga0307416_101291326 Ga0307416_1012913262 155
201 3300033528 Ga0316588_1000184 Ga0316588_10001844 155
202 3300036712 Ga0316584_0051982 Ga0316584_0051982_916_1458 155
203 3300045051 Ga0451576_0040702 Ga0451576_0040702_2454_2927 155
204 3300049576 Ga0501040_0891101 Ga0501040_0891101_81_548 155
205 3300049577 Ga0501041_0302006 Ga0501041_0302006_300_767 155
206 3300049578 Ga0501042_0390898 Ga0501042_0390898_39_530 155
207 3300049580 Ga0501046_0288071 Ga0501046_0288071_330_797 155
208 3300049590 Ga0501074_0197715 Ga0501074_0197715_699_1166 155
209 3300049591 Ga0501075_0068152 Ga0501075_0068152_945_1412 155
210 3300049741 Ga0501079_0008295 Ga0501079_0008295_4322_4813 155
211 3300049743 Ga0501081_0698747 Ga0501081_0698747_124_591 155
212 3300054114 Ga0501084_0221987 Ga0501084_0221987_1061_1528 155
213 3300060353 Ga0501082_0196313 Ga0501082_0196313_699_1166 155
214 3300061734 Ga0530510_0949821 Ga0530510_0949821_169_636 155
215 3300006880 Ga0075429_100066060 Ga0075429_1000660603 156
216 3300009147 Ga0114129_10008767 Ga0114129_100087674 156
217 3300011119 Ga0105246_10027892 Ga0105246_100278923 156
218 3300045051 Ga0451576_0568776 Ga0451576_0568776_196_666 156
219 3300050507 nmdc:mga05p37_9614_c1 nmdc:mga05p37_9614_c1_175_651 156
220 3300033529 Ga0316587_1044358 Ga0316587_10443582 157
221 3300044712 Ga0453684_0112964 Ga0453684_0112964_781_1254 157
222 3300044712 Ga0453684_0646401 Ga0453684_0646401_394_867 157
223 3300049576 Ga0501040_0491917 Ga0501040_0491917_306_785 157
224 3300049591 Ga0501075_1039717 Ga0501075_1039717_104_583 157
225 3300049592 Ga0501076_1064516 Ga0501076_1064516_125_604 157
226 3300049741 Ga0501079_0436071 Ga0501079_0436071_350_829 157
227 3300049742 Ga0501080_1092543 Ga0501080_1092543_117_605 157
228 3300036647 Ga0316582_0017177 Ga0316582_0017177_1845_2342 158
229 3300037588 Ga0316581_0045923 Ga0316581_0045923_480_977 158
230 3300042876 Ga0451577_0719253 Ga0451577_0719253_224_727 158
231 3300044673 Ga0453683_0006138 Ga0453683_0006138_2093_2572 158
232 3300044712 Ga0453684_0019366 Ga0453684_0019366_5571_6077 158
233 3300044712 Ga0453684_0044399 Ga0453684_0044399_1108_1611 158
234 3300044712 Ga0453684_0360364 Ga0453684_0360364_518_1021 158
235 3300044712 Ga0453684_0761311 Ga0453684_0761311_288_767 158
236 3300044712 Ga0453684_1033937 Ga0453684_1033937_73_570 158
237 3300045051 Ga0451576_0097442 Ga0451576_0097442_1735_2214 158
238 3300044712 Ga0453684_0002633 Ga0453684_0002633_4211_4720 160
239 3300031691 Ga0316579_10021646 Ga0316579_100216462 161
240 3300031728 Ga0316578_10556921 Ga0316578_105569211 161
241 3300031733 Ga0316577_10087502 Ga0316577_100875022 161
242 3300032168 Ga0316593_10025602 Ga0316593_100256022 161
243 3300033524 Ga0316592_1072821 Ga0316592_10728211 161
244 3300033541 Ga0316596_1002755 Ga0316596_10027552 161
245 3300033541 Ga0316596_1028404 Ga0316596_10284042 161
246 3300036647 Ga0316582_0044112 Ga0316582_0044112_586_1077 161
247 3300036647 Ga0316582_0474895 Ga0316582_0474895_161_658 161
248 3300036712 Ga0316584_0130242 Ga0316584_0130242_621_1112 161
249 3300037588 Ga0316581_0007325 Ga0316581_0007325_554_1045 161
250 3300044712 Ga0453684_1117868 Ga0453684_1117868_162_650 161
251 3300049515 Ga0501292_067231 Ga0501292_067231_12_503 161
252 3300049670 Ga0501236_013520 Ga0501236_013520_131_622 161
253 3300006871 Ga0075434_100980743 Ga0075434_1009807432 162
254 3300031691 Ga0316579_10107867 Ga0316579_101078672 162
255 3300031727 Ga0316576_10049342 Ga0316576_100493422 162
256 3300031733 Ga0316577_10130454 Ga0316577_101304542 162
257 3300032168 Ga0316593_10058139 Ga0316593_100581392 162
258 3300036647 Ga0316582_0028817 Ga0316582_0028817_688_1236 162
259 3300036712 Ga0316584_0223621 Ga0316584_0223621_609_1157 162
260 3300037588 Ga0316581_0033003 Ga0316581_0033003_679_1227 162
261 3300042876 Ga0451577_1299425 Ga0451577_1299425_103_600 162
262 3300044673 Ga0453683_0219446 Ga0453683_0219446_354_842 162
263 3300044712 Ga0453684_0007761 Ga0453684_0007761_7425_7925 162
264 3300044712 Ga0453684_0423828 Ga0453684_0423828_395_883 162
265 3300049741 Ga0501079_1095894 Ga0501079_1095894_12_500 162
266 3300031728 Ga0316578_10140852 Ga0316578_101408522 163
267 3300035398 Ga0316574_0739365 Ga0316574_0739365_29_556 163
268 3300036647 Ga0316582_0509039 Ga0316582_0509039_22_549 163
269 3300042876 Ga0451577_0067910 Ga0451577_0067910_293_799 163
270 3300044712 Ga0453684_0013594 Ga0453684_0013594_6855_7355 163
271 3300044712 Ga0453684_0360527 Ga0453684_0360527_81_587 163
272 3300044712 Ga0453684_0368649 Ga0453684_0368649_985_1488 163
273 2162886006 SwRhRL3b_contig_398890 SwRhRL3b_0252.00001760 164
274 2162886007 SwRhRL2b_contig_1448716 SwRhRL2b_0533.00007590 164
275 3300005289 Ga0065704_10000385 Ga0065704_100003859 164
276 3300005295 Ga0065707_10000437 Ga0065707_1000043741 164
277 3300042876 Ga0451577_0105605 Ga0451577_0105605_610_1104 164
278 3300044673 Ga0453683_0811859 Ga0453683_0811859_77_571 164
279 3300044712 Ga0453684_0032194 Ga0453684_0032194_6475_6969 164
280 3300044712 Ga0453684_0042211 Ga0453684_0042211_3683_4177 164
281 3300044712 Ga0453684_0408145 Ga0453684_0408145_29_523 164
282 3300044712 Ga0453684_2078281 Ga0453684_2078281_11_505 164
283 3300045051 Ga0451576_0020476 Ga0451576_0020476_1576_2070 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02662

FlpD

Methyl-viologen-reducing hydrogenase, delta subunit

12

134

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_D heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.9658 5 140
7bkb-assembly1.cif.gz_F formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.9623 4 132
5odq-assembly1.cif.gz_D heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.9521 5 140
7bkb-assembly1.cif.gz_F formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.9012 4 132
6cb1-assembly1.cif.gz_I yeast nucleolar pre-60s ribosomal subunit (state 3) 0.617 1 69
ID Description Score Start End Superfamily
af_Q58806_1_244_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6044 8 114 3.40.605.10
af_G5EE34_24_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.6039 6 69 3.40.630.20
3pqaB01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.5947 6 114 3.40.605.10
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.5938 7 131 3.40.50.960
af_A0A1T5HUM0_1_367_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5923 5 106 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Q9MZL4-F1-model_v4 Methyl-viologen-reducing hydrogenase delta subunit 0.9868 5 133 GO:0016491
GO:0051536
AF-A0A842MMY6-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9852 4 132 GO:0016491
GO:0051536
AF-A0A522UYX0-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9847 7 133 GO:0016491
GO:0051536
AF-A0A7J2TGW3-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9846 8 133 GO:0016491
GO:0051536
AF-A0A7J2IS27-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9841 6 133 GO:0016491
GO:0051536

Feature Viewer

pLDDT pTM Quality
83.24 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map