F385659

General Info

Members Datasets Scaffolds Average Seq Length
283 197 566 88

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10490450|Ga0265316_104904503
Length 84
Sequence MVKWTLYFTKQAQKDAKKLSASNPQKLLEVISENPFKTPPPFERLIGDLDGALSRRINIHNRIVYQVLQKEHAVKILRMWTHYQ

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
145 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 2.83
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10490450 3300031344 Unclassified 878
2 rootH2_10052587 3300003320 Bacteria 1792
3 Ga0065707_10695028 3300005295 Unclassified 642
4 Ga0070658_10112627 3300005327 Bacteria 2255
5 Ga0070658_10315205 3300005327 Bacteria 1335
6 Ga0070658_10724665 3300005327 Bacteria 863
7 Ga0070683_101228054 3300005329 Unclassified 720
8 Ga0070670_100029636 3300005331 Bacteria 4712
9 Ga0070660_100396283 3300005339 Bacteria 1141
10 Ga0070661_100070239 3300005344 Bacteria 2575
11 Ga0070661_100687777 3300005344 Bacteria 833
12 Ga0070661_101834884 3300005344 Unclassified 515
13 Ga0070669_100523598 3300005353 Bacteria 986
14 Ga0070675_100439875 3300005354 Bacteria 1168
15 Ga0070671_100001731 3300005355 Bacteria 16589
16 Ga0070673_100022482 3300005364 Bacteria 4591
17 Ga0070659_100212104 3300005366 Bacteria 1596
18 Ga0070659_100401471 3300005366 Bacteria 1157
19 Ga0070667_102293793 3300005367 Unclassified 508
20 Ga0070703_10002955 3300005406 Bacteria 4856
21 Ga0070700_100304659 3300005441 Bacteria 1164
22 Ga0070708_100018471 3300005445 Bacteria 5836
23 Ga0070708_100734429 3300005445 Bacteria 929
24 Ga0070663_100001890 3300005455 Bacteria 11687
25 Ga0070678_100004849 3300005456 Bacteria 7684
26 Ga0070662_100146102 3300005457 Bacteria 1837
27 Ga0070681_10129145 3300005458 Bacteria 2459
28 Ga0070706_100000248 3300005467 Bacteria 65930
29 Ga0070706_100059417 3300005467 Bacteria 3528
30 Ga0070706_100118386 3300005467 Unclassified 2467
31 Ga0070707_100151372 3300005468 Unclassified 2259
32 Ga0070698_101252274 3300005471 Unclassified 691
33 Ga0070699_100089040 3300005518 Bacteria 2696
34 Ga0070679_100813017 3300005530 Bacteria 878
35 Ga0070684_100000086 3300005535 Bacteria 60960
36 Ga0070684_101348639 3300005535 Bacteria 671
37 Ga0070697_100260294 3300005536 Bacteria 1485
38 Ga0070697_100997647 3300005536 Unclassified 744
39 Ga0068853_100127784 3300005539 Bacteria 2272
40 Ga0068853_100301687 3300005539 Bacteria 1480
41 Ga0070672_100021604 3300005543 Bacteria 4713
42 Ga0070686_101517979 3300005544 Bacteria 565
43 Ga0070665_100699912 3300005548 Viruses 1026
44 Ga0068855_100461804 3300005563 Bacteria 1384
45 Ga0070664_100091309 3300005564 Bacteria 2636
46 Ga0070664_100510680 3300005564 Bacteria 1108
47 Ga0068857_100047075 3300005577 Bacteria 3828
48 Ga0068857_100074689 3300005577 Bacteria 3021
49 Ga0068854_100024492 3300005578 Bacteria 4133
50 Ga0068854_100261936 3300005578 Bacteria 1385
51 Ga0068854_100407991 3300005578 Bacteria 1126
52 Ga0068856_100107057 3300005614 Bacteria 2791
53 Ga0068856_102232752 3300005614 Bacteria 556
54 Ga0068852_100007569 3300005616 Bacteria 7935
55 Ga0068852_101447840 3300005616 Unclassified 709
56 Ga0068852_101770862 3300005616 Bacteria 640
57 Ga0068859_100839057 3300005617 Bacteria 1005
58 Ga0068859_101661025 3300005617 Bacteria 706
59 Ga0068864_100140394 3300005618 Bacteria 2179
60 Ga0068866_10613197 3300005718 Bacteria 736
61 Ga0068851_10001036 3300005834 Bacteria 12077
62 Ga0068870_10056007 3300005840 Bacteria 2103
63 Ga0068870_10215058 3300005840 Bacteria 1173
64 Ga0068863_100775009 3300005841 Bacteria 956
65 Ga0068858_101217014 3300005842 Bacteria 740
66 Ga0068862_100002033 3300005844 Bacteria 18325
67 Ga0097621_100680598 3300006237 Bacteria 946
68 Ga0068871_100047221 3300006358 Bacteria 3471
69 Ga0075434_100163862 3300006871 Unclassified 2243
70 Ga0097620_100839280 3300006931 Bacteria 1005
71 Ga0097620_101661016 3300006931 Bacteria 706
72 Ga0105244_10108248 3300009036 Bacteria 1354
73 Ga0105240_10035362 3300009093 Bacteria 6439
74 Ga0111539_12854392 3300009094 Bacteria 559
75 Ga0105245_10000066 3300009098 Bacteria 109321
76 Ga0105241_10028588 3300009174 Bacteria 4155
77 Ga0105248_10112949 3300009177 Bacteria 3064
78 Ga0105248_10707630 3300009177 Viruses 1137
79 Ga0105238_11896410 3300009551 Bacteria 629
80 Ga0105249_10203025 3300009553 Bacteria 1941
81 Ga0105249_10610319 3300009553 Bacteria 1146
82 Ga0105249_10731649 3300009553 Bacteria 1051
83 Ga0105239_10851210 3300010375 Bacteria 1046
84 Ga0157371_10593485 3300013102 Bacteria 823
85 Ga0157370_10389161 3300013104 Bacteria 1284
86 Ga0157369_11034219 3300013105 Unclassified 840
87 Ga0157369_11175709 3300013105 Bacteria 783
88 Ga0157374_10001751 3300013296 Bacteria 18235
89 Ga0157374_10085632 3300013296 Bacteria 2997
90 Ga0157378_10081894 3300013297 Bacteria 2918
91 Ga0157372_10108403 3300013307 Bacteria 3178
92 Ga0157372_10260879 3300013307 Bacteria 2012
93 Ga0157375_10069594 3300013308 Bacteria 3526
94 Ga0163163_10000024 3300014325 Bacteria 185100
95 Ga0163163_10444105 3300014325 Bacteria 1357
96 Ga0157380_10356688 3300014326 Bacteria 1370
97 Ga0157379_10307715 3300014968 Bacteria 1445
98 Ga0154015_1002525 3300020610 Unclassified 533
99 Ga0224712_10043587 3300022467 Unclassified 1706
100 Ga0207656_10000704 3300025321 Bacteria 10951
101 Ga0207653_10000022 3300025885 Bacteria 126662
102 Ga0207642_10520231 3300025899 Bacteria 731
103 Ga0207705_10034528 3300025909 Bacteria 3616
104 Ga0207705_10038968 3300025909 Bacteria 3405
105 Ga0207705_10848447 3300025909 Bacteria 708
106 Ga0207684_10000049 3300025910 Bacteria 240008
107 Ga0207684_10013081 3300025910 Bacteria 7182
108 Ga0207684_10229827 3300025910 Bacteria 1601
109 Ga0207695_10149570 3300025913 Unclassified 2275
110 Ga0207660_11595206 3300025917 Bacteria 526
111 Ga0207657_10187723 3300025919 Bacteria 1669
112 Ga0207649_10075249 3300025920 Bacteria 2169
113 Ga0207649_10423343 3300025920 Bacteria 1000
114 Ga0207652_10426308 3300025921 Bacteria 1196
115 Ga0207646_10281682 3300025922 Unclassified 1502
116 Ga0207646_10364649 3300025922 Bacteria 1305
117 Ga0207650_10008936 3300025925 Bacteria 6846
118 Ga0207659_10473346 3300025926 Bacteria 1057
119 Ga0207644_10126326 3300025931 Bacteria 1952
120 Ga0207644_11058296 3300025931 Bacteria 681
121 Ga0207690_10230230 3300025932 Bacteria 1422
122 Ga0207706_10090903 3300025933 Bacteria 2684
123 Ga0207686_10023576 3300025934 Bacteria 3557
124 Ga0207709_10720208 3300025935 Bacteria 800
125 Ga0207691_10003117 3300025940 Bacteria 16191
126 Ga0207711_10051354 3300025941 Bacteria 3530
127 Ga0207711_11544487 3300025941 Bacteria 607
128 Ga0207661_10000001 3300025944 Bacteria 937688
129 Ga0207661_10326949 3300025944 Bacteria 1379
130 Ga0207661_11132502 3300025944 Unclassified 720
131 Ga0207679_10055173 3300025945 Bacteria 2928
132 Ga0207679_10465186 3300025945 Bacteria 1123
133 Ga0207667_10423619 3300025949 Bacteria 1354
134 Ga0207651_10000033 3300025960 Bacteria 65351
135 Ga0207712_11117290 3300025961 Bacteria 702
136 Ga0207640_10132277 3300025981 Bacteria 1805
137 Ga0207640_10321134 3300025981 Bacteria 1233
138 Ga0207658_11624134 3300025986 Unclassified 591
139 Ga0207677_10023207 3300026023 Bacteria 3827
140 Ga0207703_10918916 3300026035 Bacteria 838
141 Ga0207639_10106406 3300026041 Bacteria 2277
142 Ga0207639_10368495 3300026041 Bacteria 1287
143 Ga0207639_11555514 3300026041 Bacteria 620
144 Ga0207678_10002002 3300026067 Bacteria 18551
145 Ga0207702_11738899 3300026078 Bacteria 616
146 Ga0207641_10170447 3300026088 Bacteria 1986
147 Ga0207676_10107977 3300026095 Bacteria 2322
148 Ga0207674_10052468 3300026116 Bacteria 4159
149 Ga0207683_10033823 3300026121 Bacteria 4442
150 Ga0207698_10029296 3300026142 Bacteria 3941
151 Ga0207698_10579623 3300026142 Bacteria 1103
152 Ga0207698_10847278 3300026142 Bacteria 919
153 Ga0207698_12166839 3300026142 Bacteria 569
154 Ga0268266_10450117 3300028379 Viruses 1224
155 Ga0268266_11662683 3300028379 Bacteria 614
156 Ga0268265_10000108 3300028380 Bacteria 104423
157 Ga0265337_1054680 3300028556 Unclassified 1116
158 Ga0265337_1099550 3300028556 Bacteria 791
159 Ga0265326_10033731 3300028558 Unclassified 1457
160 Ga0265326_10058398 3300028558 Bacteria 1091
161 Ga0265319_1001547 3300028563 Bacteria 13588
162 Ga0265319_1071934 3300028563 Unclassified 1107
163 Ga0265334_10045999 3300028573 Bacteria 1688
164 Ga0265334_10207776 3300028573 Unclassified 679
165 Ga0265318_10001459 3300028577 Bacteria 13877
166 Ga0265318_10002823 3300028577 Bacteria 9065
167 Ga0265318_10073686 3300028577 Unclassified 1264
168 Ga0265322_10019364 3300028654 Unclassified 1954
169 Ga0265322_10038184 3300028654 Bacteria 1367
170 Ga0265336_10003972 3300028666 Bacteria 5662
171 Ga0307515_10771573 3300028794 Unclassified 582
172 Ga0265338_10031034 3300028800 Bacteria 5247
173 Ga0265338_10128983 3300028800 Bacteria 2001
174 Ga0265338_10370143 3300028800 Bacteria 1026
175 Ga0265324_10091803 3300029957 Unclassified 1032
176 Ga0265324_10312653 3300029957 Bacteria 535
177 Ga0307511_10030143 3300030521 Bacteria 4880
178 Ga0265330_10437789 3300031235 Bacteria 554
179 Ga0265332_10104827 3300031238 Bacteria 1192
180 Ga0265328_10025260 3300031239 Unclassified 2239
181 Ga0265320_10003837 3300031240 Bacteria 9966
182 Ga0265320_10007835 3300031240 Bacteria 6595
183 Ga0265320_10015843 3300031240 Bacteria 4246
184 Ga0265325_10033724 3300031241 Bacteria 2728
185 Ga0265329_10090024 3300031242 Bacteria 973
186 Ga0265340_10027860 3300031247 Bacteria 2845
187 Ga0265340_10382431 3300031247 Unclassified 621
188 Ga0265331_10088298 3300031250 Bacteria 1435
189 Ga0265327_10000528 3300031251 Bacteria 65837
190 Ga0265327_10024676 3300031251 Bacteria 3523
191 Ga0265327_10174454 3300031251 Bacteria 986
192 Ga0265316_10085584 3300031344 Bacteria 2412
193 Ga0265316_10157405 3300031344 Bacteria 1699
194 Ga0265316_10496625 3300031344 Bacteria 872
195 Ga0265316_10656398 3300031344 Unclassified 741
196 Ga0265316_10660486 3300031344 Bacteria 739
197 Ga0307513_11000555 3300031456 Bacteria 546
198 Ga0307509_10573300 3300031507 Unclassified 804
199 Ga0265313_10074703 3300031595 Bacteria 1553
200 Ga0316575_10003585 3300031665 Bacteria 5375
201 Ga0265314_10022681 3300031711 Bacteria 4806
202 Ga0265342_10083844 3300031712 Bacteria 1836
203 Ga0265342_10122364 3300031712 Unclassified 1464
204 Ga0265342_10247397 3300031712 Bacteria 953
205 Ga0307405_10036555 3300031731 Bacteria 2944
206 Ga0316583_10066129 3300032133 Bacteria 1265
207 Ga0316585_10203921 3300032137 Bacteria 654
208 Ga0373943_0127644 3300035170 Bacteria 1358
209 Ga0373931_0356531 3300035691 Bacteria 917
210 Ga0395900_0211563 3300037418 Bacteria 1958
211 Ga0395900_1931620 3300037418 Bacteria 501
212 Ga0395905_0033609 3300037471 Bacteria 4816
213 Ga0400483_209521 3300039062 Bacteria 6251
214 Ga0400483_269098 3300039062 Bacteria 5537
215 Ga0400489_48709 3300039093 Bacteria 1039
216 Ga0436363_0674527 3300039450 Bacteria 998
217 Ga0451798_0921357 3300041458 Bacteria 650
218 Ga0451807_1852139 3300041486 Bacteria 711
219 Ga0439437_035865 3300042000 Bacteria 634
220 Ga0451577_0000883 3300042876 Bacteria 44502
221 Ga0451577_0014188 3300042876 Bacteria 7428
222 Ga0451577_0721314 3300042876 Bacteria 902
223 Ga0451577_1480805 3300042876 Bacteria 601
224 Ga0466969_0174578 3300044656 Bacteria 984
225 Ga0466966_0021957 3300044684 Bacteria 4190
226 Ga0466961_0055618 3300044693 Bacteria 2522
227 Ga0466961_0260639 3300044693 Bacteria 1063
228 Ga0453684_0000633 3300044712 Bacteria 127483
229 Ga0453684_0030633 3300044712 Bacteria 7593
230 Ga0453684_0036226 3300044712 Bacteria 6802
231 Ga0453684_0041595 3300044712 Bacteria 6212
232 Ga0453684_0056036 3300044712 Bacteria 5118
233 Ga0453684_0332997 3300044712 Bacteria 1716
234 Ga0453684_1362266 3300044712 Bacteria 737
235 Ga0466970_0087683 3300044765 Bacteria 1688
236 Ga0466959_0056980 3300045049 Bacteria 2850
237 Ga0451576_0027336 3300045051 Bacteria 6129
238 Ga0451576_0164098 3300045051 Bacteria 2318
239 Ga0451576_0253265 3300045051 Bacteria 1840
240 Ga0451576_1628144 3300045051 Bacteria 669
241 Ga0451576_2147479 3300045051 Bacteria 574
242 Ga0495653_0000094 3300046463 Bacteria 74354
243 Ga0495605_0000005 3300046474 Bacteria 376973
244 Ga0495607_0054850 3300046501 Bacteria 2295
245 Ga0495620_0411785 3300046515 Bacteria 512
246 Ga0495648_0005053 3300046524 Bacteria 11073
247 Ga0495587_0253035 3300046536 Unclassified 990
248 Ga0495625_0021976 3300046660 Bacteria 4899
249 Ga0495686_0657962 3300047472 Unclassified 538
250 Ga0496100_0661415 3300048903 Bacteria 814
251 Ga0496101_0416441 3300048904 Bacteria 1059
252 Ga0496108_0026909 3300048911 Bacteria 4746
253 Ga0496109_0039011 3300048912 Bacteria 4298
254 Ga0496110_0110564 3300048913 Bacteria 2469
255 Ga0496114_1066542 3300048917 Bacteria 692
256 Ga0496118_0306001 3300048921 Bacteria 870
257 Ga0496122_0000204 3300048925 Bacteria 132123
258 Ga0496122_0058704 3300048925 Bacteria 2845
259 Ga0496123_0000368 3300048926 Bacteria 84471
260 Ga0496123_0010989 3300048926 Bacteria 7912
261 Ga0496124_0400297 3300048927 Bacteria 953
262 Ga0501034_0788031 3300049571 Bacteria 844
263 Ga0501046_0000022 3300049580 Bacteria 215451
264 Ga0501047_0000021 3300049581 Bacteria 254841
265 Ga0501048_0003510 3300049582 Bacteria 11922
266 Ga0501073_0982304 3300049589 Bacteria 581
267 Ga0501075_0310905 3300049591 Bacteria 1201
268 Ga0501207_110380 3300049654 Unclassified 561
269 Ga0501216_125750 3300049660 Bacteria 590
270 Ga0501249_125689 3300049679 Viruses 629
271 Ga0501257_266827 3300049686 Unclassified 512
272 Ga0501221_184491 3300049704 Bacteria 572
273 Ga0501083_0376987 3300049744 Bacteria 923
274 Ga0501035_0559159 3300049822 Bacteria 936
275 Ga0501044_0125211 3300049823 Bacteria 2568
276 nmdc:mga0k408_64874_c1 3300050493 Bacteria 2125
277 nmdc:mga0n895_150700_c1 3300050512 Bacteria 2356
278 Ga0500651_0597373 3300053093 Bacteria 599
279 Ga0500591_197517 3300053115 Bacteria 701
280 Ga0500568_0249234 3300053139 Bacteria 647
281 Ga0500616_0029712 3300053153 Bacteria 3006
282 Ga0501084_0016709 3300054114 Bacteria 6094
283 Ga0501082_1162667 3300060353 Bacteria 674
284 Ga0265316_10490450
285 rootH2_10052587
286 Ga0065707_10695028
287 Ga0070658_10112627
288 Ga0070658_10315205
289 Ga0070658_10724665
290 Ga0070683_101228054
291 Ga0070670_100029636
292 Ga0070660_100396283
293 Ga0070661_100070239
294 Ga0070661_100687777
295 Ga0070661_101834884
296 Ga0070669_100523598
297 Ga0070675_100439875
298 Ga0070671_100001731
299 Ga0070673_100022482
300 Ga0070659_100212104
301 Ga0070659_100401471
302 Ga0070667_102293793
303 Ga0070703_10002955
304 Ga0070700_100304659
305 Ga0070708_100018471
306 Ga0070708_100734429
307 Ga0070663_100001890
308 Ga0070678_100004849
309 Ga0070662_100146102
310 Ga0070681_10129145
311 Ga0070706_100000248
312 Ga0070706_100059417
313 Ga0070706_100118386
314 Ga0070707_100151372
315 Ga0070698_101252274
316 Ga0070699_100089040
317 Ga0070679_100813017
318 Ga0070684_100000086
319 Ga0070684_101348639
320 Ga0070697_100260294
321 Ga0070697_100997647
322 Ga0068853_100127784
323 Ga0068853_100301687
324 Ga0070672_100021604
325 Ga0070686_101517979
326 Ga0070665_100699912
327 Ga0068855_100461804
328 Ga0070664_100091309
329 Ga0070664_100510680
330 Ga0068857_100047075
331 Ga0068857_100074689
332 Ga0068854_100024492
333 Ga0068854_100261936
334 Ga0068854_100407991
335 Ga0068856_100107057
336 Ga0068856_102232752
337 Ga0068852_100007569
338 Ga0068852_101447840
339 Ga0068852_101770862
340 Ga0068859_100839057
341 Ga0068859_101661025
342 Ga0068864_100140394
343 Ga0068866_10613197
344 Ga0068851_10001036
345 Ga0068870_10056007
346 Ga0068870_10215058
347 Ga0068863_100775009
348 Ga0068858_101217014
349 Ga0068862_100002033
350 Ga0097621_100680598
351 Ga0068871_100047221
352 Ga0075434_100163862
353 Ga0097620_100839280
354 Ga0097620_101661016
355 Ga0105244_10108248
356 Ga0105240_10035362
357 Ga0111539_12854392
358 Ga0105245_10000066
359 Ga0105241_10028588
360 Ga0105248_10112949
361 Ga0105248_10707630
362 Ga0105238_11896410
363 Ga0105249_10203025
364 Ga0105249_10610319
365 Ga0105249_10731649
366 Ga0105239_10851210
367 Ga0157371_10593485
368 Ga0157370_10389161
369 Ga0157369_11034219
370 Ga0157369_11175709
371 Ga0157374_10001751
372 Ga0157374_10085632
373 Ga0157378_10081894
374 Ga0157372_10108403
375 Ga0157372_10260879
376 Ga0157375_10069594
377 Ga0163163_10000024
378 Ga0163163_10444105
379 Ga0157380_10356688
380 Ga0157379_10307715
381 Ga0154015_1002525
382 Ga0224712_10043587
383 Ga0207656_10000704
384 Ga0207653_10000022
385 Ga0207642_10520231
386 Ga0207705_10034528
387 Ga0207705_10038968
388 Ga0207705_10848447
389 Ga0207684_10000049
390 Ga0207684_10013081
391 Ga0207684_10229827
392 Ga0207695_10149570
393 Ga0207660_11595206
394 Ga0207657_10187723
395 Ga0207649_10075249
396 Ga0207649_10423343
397 Ga0207652_10426308
398 Ga0207646_10281682
399 Ga0207646_10364649
400 Ga0207650_10008936
401 Ga0207659_10473346
402 Ga0207644_10126326
403 Ga0207644_11058296
404 Ga0207690_10230230
405 Ga0207706_10090903
406 Ga0207686_10023576
407 Ga0207709_10720208
408 Ga0207691_10003117
409 Ga0207711_10051354
410 Ga0207711_11544487
411 Ga0207661_10000001
412 Ga0207661_10326949
413 Ga0207661_11132502
414 Ga0207679_10055173
415 Ga0207679_10465186
416 Ga0207667_10423619
417 Ga0207651_10000033
418 Ga0207712_11117290
419 Ga0207640_10132277
420 Ga0207640_10321134
421 Ga0207658_11624134
422 Ga0207677_10023207
423 Ga0207703_10918916
424 Ga0207639_10106406
425 Ga0207639_10368495
426 Ga0207639_11555514
427 Ga0207678_10002002
428 Ga0207702_11738899
429 Ga0207641_10170447
430 Ga0207676_10107977
431 Ga0207674_10052468
432 Ga0207683_10033823
433 Ga0207698_10029296
434 Ga0207698_10579623
435 Ga0207698_10847278
436 Ga0207698_12166839
437 Ga0268266_10450117
438 Ga0268266_11662683
439 Ga0268265_10000108
440 Ga0265337_1054680
441 Ga0265337_1099550
442 Ga0265326_10033731
443 Ga0265326_10058398
444 Ga0265319_1001547
445 Ga0265319_1071934
446 Ga0265334_10045999
447 Ga0265334_10207776
448 Ga0265318_10001459
449 Ga0265318_10002823
450 Ga0265318_10073686
451 Ga0265322_10019364
452 Ga0265322_10038184
453 Ga0265336_10003972
454 Ga0307515_10771573
455 Ga0265338_10031034
456 Ga0265338_10128983
457 Ga0265338_10370143
458 Ga0265324_10091803
459 Ga0265324_10312653
460 Ga0307511_10030143
461 Ga0265330_10437789
462 Ga0265332_10104827
463 Ga0265328_10025260
464 Ga0265320_10003837
465 Ga0265320_10007835
466 Ga0265320_10015843
467 Ga0265325_10033724
468 Ga0265329_10090024
469 Ga0265340_10027860
470 Ga0265340_10382431
471 Ga0265331_10088298
472 Ga0265327_10000528
473 Ga0265327_10024676
474 Ga0265327_10174454
475 Ga0265316_10085584
476 Ga0265316_10157405
477 Ga0265316_10496625
478 Ga0265316_10656398
479 Ga0265316_10660486
480 Ga0307513_11000555
481 Ga0307509_10573300
482 Ga0265313_10074703
483 Ga0316575_10003585
484 Ga0265314_10022681
485 Ga0265342_10083844
486 Ga0265342_10122364
487 Ga0265342_10247397
488 Ga0307405_10036555
489 Ga0316583_10066129
490 Ga0316585_10203921
491 Ga0373943_0127644
492 Ga0373931_0356531
493 Ga0395900_0211563
494 Ga0395900_1931620
495 Ga0395905_0033609
496 Ga0400483_209521
497 Ga0400483_269098
498 Ga0400489_48709
499 Ga0436363_0674527
500 Ga0451798_0921357
501 Ga0451807_1852139
502 Ga0439437_035865
503 Ga0451577_0000883
504 Ga0451577_0014188
505 Ga0451577_0721314
506 Ga0451577_1480805
507 Ga0466969_0174578
508 Ga0466966_0021957
509 Ga0466961_0055618
510 Ga0466961_0260639
511 Ga0453684_0000633
512 Ga0453684_0030633
513 Ga0453684_0036226
514 Ga0453684_0041595
515 Ga0453684_0056036
516 Ga0453684_0332997
517 Ga0453684_1362266
518 Ga0466970_0087683
519 Ga0466959_0056980
520 Ga0451576_0027336
521 Ga0451576_0164098
522 Ga0451576_0253265
523 Ga0451576_1628144
524 Ga0451576_2147479
525 Ga0495653_0000094
526 Ga0495605_0000005
527 Ga0495607_0054850
528 Ga0495620_0411785
529 Ga0495648_0005053
530 Ga0495587_0253035
531 Ga0495625_0021976
532 Ga0495686_0657962
533 Ga0496100_0661415
534 Ga0496101_0416441
535 Ga0496108_0026909
536 Ga0496109_0039011
537 Ga0496110_0110564
538 Ga0496114_1066542
539 Ga0496118_0306001
540 Ga0496122_0000204
541 Ga0496122_0058704
542 Ga0496123_0000368
543 Ga0496123_0010989
544 Ga0496124_0400297
545 Ga0501034_0788031
546 Ga0501046_0000022
547 Ga0501047_0000021
548 Ga0501048_0003510
549 Ga0501073_0982304
550 Ga0501075_0310905
551 Ga0501207_110380
552 Ga0501216_125750
553 Ga0501249_125689
554 Ga0501257_266827
555 Ga0501221_184491
556 Ga0501083_0376987
557 Ga0501035_0559159
558 Ga0501044_0125211
559 nmdc:mga0k408_64874_c1
560 nmdc:mga0n895_150700_c1
561 Ga0500651_0597373
562 Ga0500591_197517
563 Ga0500568_0249234
564 Ga0500616_0029712
565 Ga0501084_0016709
566 Ga0501082_1162667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

3

83

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.9009 4 86
7v5z-assembly1.cif.gz_D crystal structure of heterotetrameric complex of sa2yoeb-sa2yefm toxin-antitoxin from staphylococcus aureus 0.8975 1 87
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.8817 4 86
3oei-assembly4.cif.gz_O crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358-relbe3) 0.8746 5 86
4v8x-assembly2.cif.gz_CY structure of thermus thermophilus ribosome 0.8709 5 86
ID Description Score Start End Superfamily
af_Q2FVF8_1_87_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9367 2 86 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8792 3 86 3.30.2310.20
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8709 5 86 3.30.2310.20
af_Q58573_1_88_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.861 3 86 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8602 3 86 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A2V7XW29-F1-model_v4 Putative mRNA interferase YoeB 1.003 6 79 GO:0004519
GO:0006401
GO:0045892
AF-A0A2A4T218-F1-model_v4 Putative mRNA interferase YoeB 1.001 1 87 GO:0004519
GO:0006401
GO:0045892
AF-A0A1F2VF03-F1-model_v4 Putative mRNA interferase YoeB 1.001 1 79 GO:0004519
GO:0006401
GO:0045892
AF-A0A3P3R0H4-F1-model_v4 Putative mRNA interferase YoeB 1 3 87 GO:0004519
GO:0006401
GO:0045892
AF-A0A7X7DUD2-F1-model_v4 Putative mRNA interferase YoeB 0.9991 2 87 GO:0004519
GO:0006401
GO:0045892

Map