F385649

General Info

Members Datasets Scaffolds Average Seq Length
283 209 271 281

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10045960|Ga0307515_100459603
Length 269
Sequence MAIRLRTLLGDHPGTAALKSSPTNKGFKPMVREAAFDVSELAIVTYLMAKSFDKPMVLLPNVLMARFQHGHALYNAKRGTLKPVDLNGKRVGIRSFTTTTGAWLRGILANDYGVDLNSIDWVKFEDAHVAEFKDTTKRAPAGKQIVQMLVDGELDAVLGEKSEHADLKPLFADVAAEEKAWAAKHSIVPINHMVVVSQRLCEKNPDAVREVHRLLVESAQASPAAPRFTTVEMRRSLELIVGYTAQQGLIPRAFSVDELFDDVTRALVL

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2791355199
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
5 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
6 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
7 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
8 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
9 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
206 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
207 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
208 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
209 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.1
Metatranscriptomes 0
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.9
Nodule 1.77
Rhizoplane 4.24
Rhizosphere 66.43
Stem 0
Stem Tuber 0
Unclassified 11.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10016009 3300003215 Bacteria 3026
2 Ga0070680_100107577 3300005336 Bacteria 2319
3 Ga0070682_100338585 3300005337 Bacteria 1117
4 Ga0068868_100028693 3300005338 Bacteria 4257
5 Ga0068868_100572486 3300005338 Bacteria 998
6 Ga0070660_100118479 3300005339 Bacteria 2111
7 Ga0070689_100230732 3300005340 Bacteria 1522
8 Ga0070661_100125958 3300005344 Bacteria 1922
9 Ga0070668_100170379 3300005347 Bacteria 1772
10 Ga0070668_100420799 3300005347 Bacteria 1144
11 Ga0070668_100492015 3300005347 Bacteria 1060
12 Ga0070674_100187960 3300005356 Bacteria 1587
13 Ga0070667_100473929 3300005367 Bacteria 1146
14 Ga0070711_100020886 3300005439 Bacteria 4227
15 Ga0070663_100055656 3300005455 Bacteria 2832
16 Ga0070678_100117733 3300005456 Bacteria 2090
17 Ga0070678_100281883 3300005456 Bacteria 1406
18 Ga0070662_100408426 3300005457 Bacteria 1122
19 Ga0070681_10004544 3300005458 Bacteria 13233
20 Ga0070681_10103453 3300005458 Bacteria 2792
21 Ga0070685_10286444 3300005466 Bacteria 1105
22 Ga0070706_100303000 3300005467 Bacteria 1491
23 Ga0070679_100021572 3300005530 Bacteria 6289
24 Ga0070679_100301260 3300005530 Bacteria 1553
25 Ga0070684_100225994 3300005535 Bacteria 1708
26 Ga0068853_100647486 3300005539 Bacteria 1005
27 Ga0070665_100059576 3300005548 Bacteria 3827
28 Ga0070665_100065998 3300005548 Bacteria 3630
29 Ga0070665_100125579 3300005548 Bacteria 2568
30 Ga0070665_100435454 3300005548 Bacteria 1320
31 Ga0068856_100099117 3300005614 Bacteria 2904
32 Ga0070702_100339613 3300005615 Bacteria 1054
33 Ga0068864_100712992 3300005618 Bacteria 981
34 Ga0068851_10004272 3300005834 Bacteria 6435
35 Ga0068858_100293788 3300005842 Bacteria 1549
36 Ga0068860_100144236 3300005843 Bacteria 2290
37 Ga0068862_100329406 3300005844 Bacteria 1412
38 Ga0081538_10034813 3300005981 Bacteria 3321
39 Ga0081540_1002690 3300005983 Bacteria 14454
40 Ga0081540_1017195 3300005983 Bacteria 4485
41 Ga0081540_1044360 3300005983 Bacteria 2270
42 Ga0075365_10075088 3300006038 Bacteria 2281
43 Ga0075365_10149439 3300006038 Bacteria 1625
44 Ga0075365_10180139 3300006038 Bacteria 1477
45 Ga0075364_10122667 3300006051 Bacteria 1740
46 Ga0075362_10022802 3300006177 Bacteria 2641
47 Ga0075367_10000988 3300006178 Bacteria 11650
48 Ga0075369_10008785 3300006186 Bacteria 3903
49 Ga0075369_10024805 3300006186 Bacteria 2488
50 Ga0075370_10213127 3300006353 Bacteria 1140
51 Ga0068871_100376650 3300006358 Bacteria 1260
52 Ga0075428_100079146 3300006844 Bacteria 3587
53 Ga0097620_100171379 3300006931 Bacteria 2251
54 Ga0099795_10028929 3300007788 Bacteria 1890
55 Ga0105240_10540784 3300009093 Bacteria 1290
56 Ga0114129_10111337 3300009147 Bacteria 3777
57 Ga0105241_10032147 3300009174 Bacteria 3931
58 Ga0105248_10263800 3300009177 Bacteria 1939
59 Ga0105248_10340617 3300009177 Bacteria 1688
60 Ga0105237_10216485 3300009545 Bacteria 1915
61 Ga0105238_10596953 3300009551 Bacteria 1112
62 Ga0105238_10698344 3300009551 Bacteria 1026
63 Ga0105249_10578209 3300009553 Bacteria 1176
64 Ga0099796_10021898 3300010159 Bacteria 1976
65 Ga0105239_10231697 3300010375 Bacteria 2072
66 Ga0105239_10336744 3300010375 Bacteria 1702
67 Ga0105239_10340438 3300010375 Bacteria 1692
68 Ga0105246_10160772 3300011119 Bacteria 1711
69 Ga0105246_10351569 3300011119 Bacteria 1208
70 Ga0157369_10006547 3300013105 Bacteria 13481
71 Ga0157378_10205993 3300013297 Bacteria 1863
72 Ga0163162_10217372 3300013306 Bacteria 2041
73 Ga0163162_10437901 3300013306 Bacteria 1439
74 Ga0157372_10852397 3300013307 Bacteria 1058
75 Ga0157375_10300634 3300013308 Bacteria 1768
76 Ga0157380_10329795 3300014326 Bacteria 1419
77 Ga0157379_10383594 3300014968 Bacteria 1290
78 Ga0157376_10187855 3300014969 Bacteria 1893
79 Ga0163161_10207570 3300017792 Bacteria 1512
80 Ga0163161_10437643 3300017792 Bacteria 1055
81 Ga0209564_1011501 3300025295 Bacteria 3958
82 Ga0209758_1004785 3300025297 Bacteria 10950
83 Ga0207710_10164087 3300025900 Bacteria 1084
84 Ga0207699_10004016 3300025906 Bacteria 7041
85 Ga0207684_10318289 3300025910 Bacteria 1341
86 Ga0207654_10026739 3300025911 Bacteria 3128
87 Ga0207707_10000359 3300025912 Bacteria 47942
88 Ga0207707_10154833 3300025912 Bacteria 2004
89 Ga0207707_10277057 3300025912 Bacteria 1453
90 Ga0207693_10013028 3300025915 Bacteria 6710
91 Ga0207693_10022195 3300025915 Bacteria 5045
92 Ga0207660_10027186 3300025917 Bacteria 3902
93 Ga0207662_10243303 3300025918 Bacteria 1178
94 Ga0207657_10461258 3300025919 Bacteria 997
95 Ga0207652_10003470 3300025921 Bacteria 12999
96 Ga0207652_10281063 3300025921 Bacteria 1501
97 Ga0207709_10114811 3300025935 Bacteria 1807
98 Ga0207667_10162547 3300025949 Bacteria 2296
99 Ga0207668_10124223 3300025972 Bacteria 1959
100 Ga0207677_10031837 3300026023 Bacteria 3382
101 Ga0207703_10341013 3300026035 Bacteria 1377
102 Ga0207703_10450402 3300026035 Bacteria 1202
103 Ga0207678_10035639 3300026067 Bacteria 4332
104 Ga0207678_10212644 3300026067 Bacteria 1654
105 Ga0207648_10266565 3300026089 Bacteria 1529
106 Ga0207675_100266564 3300026118 Bacteria 1661
107 Ga0207683_10084701 3300026121 Bacteria 2818
108 Ga0207683_10115071 3300026121 Bacteria 2411
109 Ga0207683_10369881 3300026121 Bacteria 1317
110 Ga0207698_10350160 3300026142 Bacteria 1395
111 Ga0268266_10002394 3300028379 Bacteria 20226
112 Ga0268266_10003934 3300028379 Bacteria 14440
113 Ga0268266_10027683 3300028379 Bacteria 4819
114 Ga0268265_10181073 3300028380 Bacteria 1810
115 Ga0268264_10027494 3300028381 Bacteria 4648
116 Ga0307515_10045960 3300028794 Bacteria 6689
117 Ga0307515_10212609 3300028794 Bacteria 1774
118 Ga0307513_10184797 3300031456 Bacteria 1943
119 Ga0307509_10180532 3300031507 Bacteria 1976
120 Ga0307408_100277295 3300031548 Bacteria 1395
121 Ga0307508_10156701 3300031616 Bacteria 1881
122 Ga0307406_10213629 3300031901 Bacteria 1429
123 Ga0307412_10082860 3300031911 Bacteria 2222
124 Ga0307416_100328820 3300032002 Bacteria 1535
125 Ga0307414_10168155 3300032004 Bacteria 1749
126 Ga0307510_10001061 3300033180 Bacteria 29217
127 Ga0316215_1004201 3300033544 Bacteria 1378
128 Ga0373926_0072562 3300035083 Bacteria 1266
129 Ga0373934_0014895 3300035086 Bacteria 2946
130 Ga0373923_0003551 3300035111 Bacteria 5018
131 Ga0373953_0007452 3300035117 Bacteria 3665
132 Ga0373943_0026933 3300035170 Bacteria 2697
133 Ga0373943_0097811 3300035170 Bacteria 1530
134 Ga0373924_0101645 3300035410 Bacteria 1237
135 Ga0373935_0129963 3300035692 Bacteria 1691
136 Ga0373935_0173522 3300035692 Bacteria 1476
137 Ga0373927_0016784 3300035695 Bacteria 4829
138 Ga0373927_0093885 3300035695 Bacteria 1950
139 Ga0373927_0147657 3300035695 Bacteria 1539
140 Ga0373933_0006955 3300035724 Bacteria 6165
141 Ga0373947_0025405 3300035725 Bacteria 3455
142 Ga0373947_0183578 3300035725 Bacteria 1363
143 Ga0373947_0198925 3300035725 Bacteria 1310
144 Ga0373925_0112208 3300037068 Bacteria 2107
145 Ga0451795_0309788 3300041456 Bacteria 941
146 Ga0466957_0155221 3300044842 Bacteria 1483
147 Ga0466959_0047117 3300045049 Bacteria 3171
148 Ga0495603_0004410 3300046455 Bacteria 8389
149 Ga0495603_0044718 3300046455 Bacteria 2642
150 Ga0495603_0104863 3300046455 Bacteria 1650
151 Ga0495629_0080943 3300046459 Bacteria 2267
152 Ga0495638_0000646 3300046460 Bacteria 38171
153 Ga0495638_0030281 3300046460 Bacteria 3485
154 Ga0495641_0022963 3300046461 Bacteria 3110
155 Ga0495650_0078082 3300046471 Bacteria 1283
156 Ga0495580_0006636 3300046472 Bacteria 9401
157 Ga0495662_0028790 3300046476 Bacteria 2682
158 Ga0495664_0090586 3300046477 Bacteria 1838
159 Ga0495585_0097809 3300046492 Bacteria 1573
160 Ga0495585_0105615 3300046492 Bacteria 1502
161 Ga0495585_0181340 3300046492 Bacteria 1082
162 Ga0495606_0064798 3300046507 Bacteria 2324
163 Ga0495616_0053672 3300046513 Bacteria 2002
164 Ga0495618_0028419 3300046514 Bacteria 3485
165 Ga0495620_0037103 3300046515 Bacteria 2174
166 Ga0495628_0087625 3300046516 Bacteria 2413
167 Ga0495630_0008895 3300046517 Bacteria 7209
168 Ga0495631_0018759 3300046518 Bacteria 3253
169 Ga0495631_0121508 3300046518 Bacteria 1123
170 Ga0495632_0062420 3300046519 Bacteria 1806
171 Ga0495643_0088896 3300046522 Bacteria 1596
172 Ga0495644_0054690 3300046523 Bacteria 1499
173 Ga0495654_0020090 3300046530 Bacteria 3485
174 Ga0495640_0142508 3300046533 Bacteria 1544
175 Ga0495598_0004011 3300046537 Bacteria 3162
176 Ga0495598_0037755 3300046537 Bacteria 1395
177 Ga0495621_0034827 3300046539 Bacteria 1741
178 Ga0495597_0118696 3300046542 Bacteria 1104
179 Ga0495656_0064812 3300046615 Bacteria 1605
180 Ga0495634_0138428 3300046642 Bacteria 1547
181 Ga0495625_0142375 3300046660 Bacteria 1617
182 Ga0495625_0448111 3300046660 Bacteria 798
183 Ga0495635_0055245 3300046663 Bacteria 2735
184 Ga0495659_0019059 3300046664 Bacteria 2293
185 Ga0495661_0056820 3300046665 Bacteria 2339
186 Ga0495661_0249728 3300046665 Bacteria 906
187 Ga0495588_0093296 3300046674 Bacteria 1578
188 Ga0495599_0124582 3300046678 Bacteria 1602
189 Ga0495646_0038325 3300046680 Bacteria 2960
190 Ga0495647_0005841 3300046681 Bacteria 4050
191 Ga0495658_0003337 3300046683 Bacteria 7963
192 Ga0495624_0098752 3300046690 Bacteria 1798
193 Ga0495624_0131199 3300046690 Bacteria 1536
194 Ga0495670_0004878 3300046691 Bacteria 6588
195 Ga0495670_0073154 3300046691 Bacteria 1737
196 Ga0495670_0077203 3300046691 Bacteria 1693
197 Ga0495660_0073830 3300046810 Bacteria 1803
198 Ga0495604_0054391 3300047317 Bacteria 3089
199 Ga0495674_0003465 3300047319 Bacteria 15330
200 Ga0495674_0291603 3300047319 Bacteria 1334
201 Ga0495676_0072253 3300047321 Bacteria 2650
202 Ga0495684_0061283 3300047471 Bacteria 2862
203 Ga0495593_0067345 3300047673 Bacteria 1864
204 Ga0496101_0090807 3300048904 Bacteria 2272
205 Ga0496102_0467703 3300048905 Bacteria 1182
206 Ga0496102_0475059 3300048905 Bacteria 1171
207 Ga0496104_0205595 3300048907 Bacteria 1881
208 Ga0496104_0213858 3300048907 Bacteria 1839
209 Ga0496105_0031745 3300048908 Bacteria 4331
210 Ga0496108_0050214 3300048911 Bacteria 3491
211 Ga0496108_0200664 3300048911 Bacteria 1731
212 Ga0496112_0235335 3300048915 Bacteria 1785
213 Ga0496115_0458962 3300048918 Bacteria 1028
214 Ga0496116_0006031 3300048919 Bacteria 11095
215 Ga0496117_0046908 3300048920 Bacteria 3104
216 Ga0496117_0058063 3300048920 Bacteria 2682
217 Ga0496118_0049440 3300048921 Bacteria 3238
218 Ga0496118_0063583 3300048921 Bacteria 2714
219 Ga0496119_0153610 3300048922 Bacteria 1231
220 Ga0496120_0065204 3300048923 Bacteria 2019
221 Ga0496121_0006633 3300048924 Bacteria 14254
222 Ga0496121_0017686 3300048924 Bacteria 7256
223 Ga0496122_0010744 3300048925 Bacteria 9391
224 Ga0496122_0152469 3300048925 Bacteria 1424
225 Ga0496122_0274871 3300048925 Bacteria 925
226 Ga0496123_0036404 3300048926 Bacteria 3491
227 Ga0496123_0158828 3300048926 Bacteria 1208
228 Ga0496124_0181898 3300048927 Bacteria 1617
229 Ga0496124_0300869 3300048927 Bacteria 1159
230 Ga0496125_0025922 3300048928 Bacteria 5356
231 Ga0496125_0065181 3300048928 Bacteria 2888
232 Ga0496125_0239608 3300048928 Bacteria 1153
233 Ga0496126_0139555 3300048929 Bacteria 2087
234 Ga0501067_0055938 3300049583 Bacteria 2186
235 nmdc:mga03n38_53870_c1 3300050490 Bacteria 1806
236 nmdc:mga00v17_233909_c1 3300050491 Bacteria 1191
237 nmdc:mga00v17_27373_c1 3300050491 Bacteria 3328
238 nmdc:mga00v17_299687_c1 3300050491 Bacteria 1044
239 nmdc:mga0yw44_21367_c1 3300050492 Bacteria 3609
240 nmdc:mga0yw44_27119_c1 3300050492 Bacteria 3278
241 nmdc:mga0yw44_56798_c1 3300050492 Bacteria 2386
242 nmdc:mga0yw44_6339_c1 3300050492 Bacteria 5709
243 nmdc:mga06z11_192512_c1 3300050494 Bacteria 1181
244 nmdc:mga06z11_30436_c1 3300050494 Bacteria 2612
245 nmdc:mga06z11_59313_c1 3300050494 Bacteria 1989
246 nmdc:mga07m45_118817_c1 3300050496 Bacteria 1526
247 nmdc:mga07m45_13999_c1 3300050496 Bacteria 4265
248 nmdc:mga07m45_73106_c1 3300050496 Bacteria 1952
249 nmdc:mga0sz30_3474_c2 3300050516 Bacteria 4650
250 Ga0495601_0051270 3300053077 Bacteria 2605
251 Ga0495601_0074759 3300053077 Bacteria 2168
252 Ga0495601_0102972 3300053077 Bacteria 1845
253 Ga0495595_0107943 3300053084 Bacteria 1348
254 Ga0500643_017749 3300053087 Bacteria 2376
255 Ga0500644_0043361 3300053088 Bacteria 1504
256 Ga0500581_064362 3300053089 Bacteria 1853
257 Ga0500583_0047342 3300053092 Bacteria 1981
258 Ga0500651_0046532 3300053093 Bacteria 2729
259 Ga0500650_0000157 3300053098 Bacteria 17929
260 Ga0500556_0000002 3300053104 Bacteria 773626
261 Ga0500569_022573 3300053109 Bacteria 1678
262 Ga0500592_003596 3300053116 Bacteria 2475
263 Ga0500594_0011276 3300053118 Bacteria 2086
264 Ga0500652_000564 3300053131 Bacteria 12958
265 Ga0500658_0006618 3300053134 Bacteria 4294
266 Ga0500559_0208071 3300053136 Bacteria 923
267 Ga0500568_0008323 3300053139 Bacteria 5011
268 Ga0500604_0000635 3300053151 Bacteria 9651
269 Ga0500622_0000518 3300053156 Bacteria 35866
270 Ga0500634_0192661 3300053161 Bacteria 904
271 Ga0500609_004529 3300053731 Bacteria 1919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0467703 Ga0496102_0467703_52_789 237
2 3300046660 Ga0495625_0448111 Ga0495625_0448111_14_733 239
3 3300048924 Ga0496121_0017686 Ga0496121_0017686_6491_7213 239
4 3300050496 nmdc:mga07m45_73106_c1 nmdc:mga07m45_73106_c1_26_748 239
5 3300009177 Ga0105248_10263800 Ga0105248_102638002 266
6 3300028794 Ga0307515_10045960 Ga0307515_100459603 266
7 3300005467 Ga0070706_100303000 Ga0070706_1003030002 267
8 3300025910 Ga0207684_10318289 Ga0207684_103182892 267
9 3300017792 Ga0163161_10437643 Ga0163161_104376432 270
10 3300046492 Ga0495585_0181340 Ga0495585_0181340_114_956 272
11 3300046523 Ga0495644_0054690 Ga0495644_0054690_94_936 272
12 3300046537 Ga0495598_0004011 Ga0495598_0004011_670_1512 272
13 3300046664 Ga0495659_0019059 Ga0495659_0019059_893_1735 272
14 3300046665 Ga0495661_0249728 Ga0495661_0249728_20_862 272
15 3300046691 Ga0495670_0077203 Ga0495670_0077203_666_1508 272
16 3300005367 Ga0070667_100473929 Ga0070667_1004739291 275
17 3300035695 Ga0373927_0016784 Ga0373927_0016784_630_1460 276
18 iso_pu_bacteria 2602042107 2603856777 277
19 iso_pu_bacteria 2857524615 2857528255 277
20 iso_pu_bacteria 2919073203 2919075679 277
21 iso_pu_bacteria 2876808645 2876813029 278
22 iso_pu_bacteria 2879110137 2879115853 278
23 3300005338 Ga0068868_100572486 Ga0068868_1005724861 279
24 3300005347 Ga0070668_100420799 Ga0070668_1004207992 279
25 3300005844 Ga0068862_100329406 Ga0068862_1003294061 279
26 3300025935 Ga0207709_10114811 Ga0207709_101148112 279
27 3300026118 Ga0207675_100266564 Ga0207675_1002665642 279
28 3300028380 Ga0268265_10181073 Ga0268265_101810732 279
29 iso_pu_bacteria 2791355199 2793079922 279
30 iso_pu_bacteria 2874604998 2874605539 279
31 iso_pu_bacteria 2889033259 2889039414 279
32 iso_pu_bacteria 2922386360 2922391298 279
33 iso_pu_bacteria 8006964411 8006972442 279
34 iso_pu_bacteria 8006984368 8006987901 279
35 iso_pu_bacteria 8056673599 8056677694 279
36 3300005340 Ga0070689_100230732 Ga0070689_1002307321 280
37 3300005983 Ga0081540_1002690 Ga0081540_100269015 280
38 3300005983 Ga0081540_1044360 Ga0081540_10443602 280
39 3300013307 Ga0157372_10852397 Ga0157372_108523971 280
40 3300031456 Ga0307513_10184797 Ga0307513_101847972 280
41 3300035725 Ga0373947_0183578 Ga0373947_0183578_142_984 280
42 3300046455 Ga0495603_0044718 Ga0495603_0044718_452_1294 280
43 3300046460 Ga0495638_0030281 Ga0495638_0030281_1079_1921 280
44 3300046471 Ga0495650_0078082 Ga0495650_0078082_391_1233 280
45 3300046492 Ga0495585_0097809 Ga0495585_0097809_345_1187 280
46 3300046492 Ga0495585_0105615 Ga0495585_0105615_446_1288 280
47 3300046518 Ga0495631_0018759 Ga0495631_0018759_1366_2208 280
48 3300046519 Ga0495632_0062420 Ga0495632_0062420_173_1015 280
49 3300046537 Ga0495598_0037755 Ga0495598_0037755_138_980 280
50 3300046539 Ga0495621_0034827 Ga0495621_0034827_563_1405 280
51 3300046615 Ga0495656_0064812 Ga0495656_0064812_532_1407 280
52 3300046691 Ga0495670_0073154 Ga0495670_0073154_76_918 280
53 3300047321 Ga0495676_0072253 Ga0495676_0072253_906_1748 280
54 3300003215 JGI25153J46596_10016009 JGI25153J46596_100160094 281
55 3300005336 Ga0070680_100107577 Ga0070680_1001075773 281
56 3300005337 Ga0070682_100338585 Ga0070682_1003385852 281
57 3300005338 Ga0068868_100028693 Ga0068868_1000286933 281
58 3300005339 Ga0070660_100118479 Ga0070660_1001184791 281
59 3300005344 Ga0070661_100125958 Ga0070661_1001259581 281
60 3300005347 Ga0070668_100170379 Ga0070668_1001703792 281
61 3300005347 Ga0070668_100492015 Ga0070668_1004920151 281
62 3300005356 Ga0070674_100187960 Ga0070674_1001879602 281
63 3300005439 Ga0070711_100020886 Ga0070711_1000208862 281
64 3300005455 Ga0070663_100055656 Ga0070663_1000556562 281
65 3300005456 Ga0070678_100117733 Ga0070678_1001177332 281
66 3300005456 Ga0070678_100281883 Ga0070678_1002818832 281
67 3300005457 Ga0070662_100408426 Ga0070662_1004084261 281
68 3300005458 Ga0070681_10004544 Ga0070681_100045445 281
69 3300005458 Ga0070681_10103453 Ga0070681_101034532 281
70 3300005466 Ga0070685_10286444 Ga0070685_102864442 281
71 3300005530 Ga0070679_100021572 Ga0070679_1000215726 281
72 3300005530 Ga0070679_100301260 Ga0070679_1003012602 281
73 3300005535 Ga0070684_100225994 Ga0070684_1002259943 281
74 3300005539 Ga0068853_100647486 Ga0068853_1006474861 281
75 3300005548 Ga0070665_100059576 Ga0070665_1000595763 281
76 3300005548 Ga0070665_100065998 Ga0070665_1000659984 281
77 3300005548 Ga0070665_100125579 Ga0070665_1001255792 281
78 3300005548 Ga0070665_100435454 Ga0070665_1004354541 281
79 3300005614 Ga0068856_100099117 Ga0068856_1000991173 281
80 3300005615 Ga0070702_100339613 Ga0070702_1003396131 281
81 3300005618 Ga0068864_100712992 Ga0068864_1007129922 281
82 3300005834 Ga0068851_10004272 Ga0068851_100042722 281
83 3300005842 Ga0068858_100293788 Ga0068858_1002937882 281
84 3300005843 Ga0068860_100144236 Ga0068860_1001442362 281
85 3300005981 Ga0081538_10034813 Ga0081538_100348132 281
86 3300005983 Ga0081540_1017195 Ga0081540_10171953 281
87 3300006038 Ga0075365_10075088 Ga0075365_100750882 281
88 3300006038 Ga0075365_10149439 Ga0075365_101494392 281
89 3300006038 Ga0075365_10180139 Ga0075365_101801392 281
90 3300006051 Ga0075364_10122667 Ga0075364_101226672 281
91 3300006177 Ga0075362_10022802 Ga0075362_100228022 281
92 3300006178 Ga0075367_10000988 Ga0075367_100009884 281
93 3300006186 Ga0075369_10008785 Ga0075369_100087854 281
94 3300006186 Ga0075369_10024805 Ga0075369_100248052 281
95 3300006353 Ga0075370_10213127 Ga0075370_102131272 281
96 3300006358 Ga0068871_100376650 Ga0068871_1003766502 281
97 3300006844 Ga0075428_100079146 Ga0075428_1000791463 281
98 3300006931 Ga0097620_100171379 Ga0097620_1001713793 281
99 3300007788 Ga0099795_10028929 Ga0099795_100289291 281
100 3300009093 Ga0105240_10540784 Ga0105240_105407842 281
101 3300009147 Ga0114129_10111337 Ga0114129_101113371 281
102 3300009174 Ga0105241_10032147 Ga0105241_100321472 281
103 3300009177 Ga0105248_10340617 Ga0105248_103406172 281
104 3300009545 Ga0105237_10216485 Ga0105237_102164851 281
105 3300009551 Ga0105238_10596953 Ga0105238_105969532 281
106 3300009551 Ga0105238_10698344 Ga0105238_106983442 281
107 3300009553 Ga0105249_10578209 Ga0105249_105782092 281
108 3300010159 Ga0099796_10021898 Ga0099796_100218982 281
109 3300010375 Ga0105239_10231697 Ga0105239_102316972 281
110 3300010375 Ga0105239_10336744 Ga0105239_103367442 281
111 3300010375 Ga0105239_10340438 Ga0105239_103404382 281
112 3300011119 Ga0105246_10160772 Ga0105246_101607722 281
113 3300011119 Ga0105246_10351569 Ga0105246_103515691 281
114 3300013105 Ga0157369_10006547 Ga0157369_100065472 281
115 3300013297 Ga0157378_10205993 Ga0157378_102059933 281
116 3300013306 Ga0163162_10217372 Ga0163162_102173722 281
117 3300013306 Ga0163162_10437901 Ga0163162_104379012 281
118 3300013308 Ga0157375_10300634 Ga0157375_103006342 281
119 3300014326 Ga0157380_10329795 Ga0157380_103297952 281
120 3300014968 Ga0157379_10383594 Ga0157379_103835941 281
121 3300014969 Ga0157376_10187855 Ga0157376_101878552 281
122 3300017792 Ga0163161_10207570 Ga0163161_102075702 281
123 3300025295 Ga0209564_1011501 Ga0209564_10115012 281
124 3300025297 Ga0209758_1004785 Ga0209758_10047853 281
125 3300025900 Ga0207710_10164087 Ga0207710_101640872 281
126 3300025906 Ga0207699_10004016 Ga0207699_100040161 281
127 3300025911 Ga0207654_10026739 Ga0207654_100267393 281
128 3300025912 Ga0207707_10000359 Ga0207707_1000035944 281
129 3300025912 Ga0207707_10154833 Ga0207707_101548332 281
130 3300025912 Ga0207707_10277057 Ga0207707_102770572 281
131 3300025915 Ga0207693_10013028 Ga0207693_100130286 281
132 3300025915 Ga0207693_10022195 Ga0207693_100221955 281
133 3300025917 Ga0207660_10027186 Ga0207660_100271863 281
134 3300025918 Ga0207662_10243303 Ga0207662_102433033 281
135 3300025919 Ga0207657_10461258 Ga0207657_104612581 281
136 3300025921 Ga0207652_10003470 Ga0207652_100034702 281
137 3300025921 Ga0207652_10281063 Ga0207652_102810632 281
138 3300025949 Ga0207667_10162547 Ga0207667_101625472 281
139 3300025972 Ga0207668_10124223 Ga0207668_101242232 281
140 3300026023 Ga0207677_10031837 Ga0207677_100318372 281
141 3300026035 Ga0207703_10341013 Ga0207703_103410132 281
142 3300026035 Ga0207703_10450402 Ga0207703_104504022 281
143 3300026067 Ga0207678_10035639 Ga0207678_100356393 281
144 3300026067 Ga0207678_10212644 Ga0207678_102126442 281
145 3300026089 Ga0207648_10266565 Ga0207648_102665652 281
146 3300026121 Ga0207683_10084701 Ga0207683_100847013 281
147 3300026121 Ga0207683_10115071 Ga0207683_101150712 281
148 3300026121 Ga0207683_10369881 Ga0207683_103698811 281
149 3300026142 Ga0207698_10350160 Ga0207698_103501602 281
150 3300028379 Ga0268266_10002394 Ga0268266_100023943 281
151 3300028379 Ga0268266_10003934 Ga0268266_100039348 281
152 3300028379 Ga0268266_10027683 Ga0268266_100276832 281
153 3300028381 Ga0268264_10027494 Ga0268264_100274942 281
154 3300028794 Ga0307515_10212609 Ga0307515_102126092 281
155 3300031507 Ga0307509_10180532 Ga0307509_101805322 281
156 3300031548 Ga0307408_100277295 Ga0307408_1002772952 281
157 3300031616 Ga0307508_10156701 Ga0307508_101567012 281
158 3300031901 Ga0307406_10213629 Ga0307406_102136292 281
159 3300031911 Ga0307412_10082860 Ga0307412_100828601 281
160 3300032002 Ga0307416_100328820 Ga0307416_1003288201 281
161 3300032004 Ga0307414_10168155 Ga0307414_101681551 281
162 3300033180 Ga0307510_10001061 Ga0307510_100010619 281
163 3300033544 Ga0316215_1004201 Ga0316215_10042012 281
164 3300035083 Ga0373926_0072562 Ga0373926_0072562_346_1209 281
165 3300035086 Ga0373934_0014895 Ga0373934_0014895_123_974 281
166 3300035111 Ga0373923_0003551 Ga0373923_0003551_1923_2774 281
167 3300035117 Ga0373953_0007452 Ga0373953_0007452_882_1733 281
168 3300035170 Ga0373943_0026933 Ga0373943_0026933_1755_2606 281
169 3300035170 Ga0373943_0097811 Ga0373943_0097811_629_1477 281
170 3300035410 Ga0373924_0101645 Ga0373924_0101645_41_892 281
171 3300035692 Ga0373935_0129963 Ga0373935_0129963_259_1110 281
172 3300035692 Ga0373935_0173522 Ga0373935_0173522_317_1174 281
173 3300035695 Ga0373927_0093885 Ga0373927_0093885_309_1154 281
174 3300035695 Ga0373927_0147657 Ga0373927_0147657_642_1493 281
175 3300035724 Ga0373933_0006955 Ga0373933_0006955_4941_5792 281
176 3300035725 Ga0373947_0025405 Ga0373947_0025405_2023_2874 281
177 3300035725 Ga0373947_0198925 Ga0373947_0198925_247_1104 281
178 3300037068 Ga0373925_0112208 Ga0373925_0112208_982_1833 281
179 3300041456 Ga0451795_0309788 Ga0451795_0309788_65_916 281
180 3300044842 Ga0466957_0155221 Ga0466957_0155221_19_870 281
181 3300045049 Ga0466959_0047117 Ga0466959_0047117_29_880 281
182 3300046455 Ga0495603_0004410 Ga0495603_0004410_346_1191 281
183 3300046455 Ga0495603_0104863 Ga0495603_0104863_778_1623 281
184 3300046459 Ga0495629_0080943 Ga0495629_0080943_259_1110 281
185 3300046460 Ga0495638_0000646 Ga0495638_0000646_5080_5928 281
186 3300046461 Ga0495641_0022963 Ga0495641_0022963_2239_3084 281
187 3300046472 Ga0495580_0006636 Ga0495580_0006636_2154_3005 281
188 3300046476 Ga0495662_0028790 Ga0495662_0028790_670_1521 281
189 3300046477 Ga0495664_0090586 Ga0495664_0090586_414_1265 281
190 3300046507 Ga0495606_0064798 Ga0495606_0064798_948_1796 281
191 3300046513 Ga0495616_0053672 Ga0495616_0053672_183_1028 281
192 3300046514 Ga0495618_0028419 Ga0495618_0028419_1331_2182 281
193 3300046515 Ga0495620_0037103 Ga0495620_0037103_1031_1879 281
194 3300046516 Ga0495628_0087625 Ga0495628_0087625_219_1070 281
195 3300046517 Ga0495630_0008895 Ga0495630_0008895_3641_4492 281
196 3300046518 Ga0495631_0121508 Ga0495631_0121508_76_924 281
197 3300046522 Ga0495643_0088896 Ga0495643_0088896_245_1093 281
198 3300046530 Ga0495654_0020090 Ga0495654_0020090_2585_3433 281
199 3300046533 Ga0495640_0142508 Ga0495640_0142508_39_890 281
200 3300046542 Ga0495597_0118696 Ga0495597_0118696_130_975 281
201 3300046642 Ga0495634_0138428 Ga0495634_0138428_681_1532 281
202 3300046660 Ga0495625_0142375 Ga0495625_0142375_111_956 281
203 3300046663 Ga0495635_0055245 Ga0495635_0055245_1147_1998 281
204 3300046665 Ga0495661_0056820 Ga0495661_0056820_1434_2282 281
205 3300046674 Ga0495588_0093296 Ga0495588_0093296_290_1141 281
206 3300046678 Ga0495599_0124582 Ga0495599_0124582_213_1091 281
207 3300046680 Ga0495646_0038325 Ga0495646_0038325_1615_2466 281
208 3300046681 Ga0495647_0005841 Ga0495647_0005841_147_998 281
209 3300046683 Ga0495658_0003337 Ga0495658_0003337_3342_4193 281
210 3300046690 Ga0495624_0098752 Ga0495624_0098752_117_974 281
211 3300046690 Ga0495624_0131199 Ga0495624_0131199_525_1376 281
212 3300046691 Ga0495670_0004878 Ga0495670_0004878_2441_3289 281
213 3300046810 Ga0495660_0073830 Ga0495660_0073830_768_1616 281
214 3300047317 Ga0495604_0054391 Ga0495604_0054391_1327_2178 281
215 3300047319 Ga0495674_0003465 Ga0495674_0003465_3788_4639 281
216 3300047319 Ga0495674_0291603 Ga0495674_0291603_299_1147 281
217 3300047471 Ga0495684_0061283 Ga0495684_0061283_747_1598 281
218 3300047673 Ga0495593_0067345 Ga0495593_0067345_769_1620 281
219 3300048904 Ga0496101_0090807 Ga0496101_0090807_470_1330 281
220 3300048905 Ga0496102_0475059 Ga0496102_0475059_111_956 281
221 3300048907 Ga0496104_0205595 Ga0496104_0205595_723_1568 281
222 3300048907 Ga0496104_0213858 Ga0496104_0213858_170_1018 281
223 3300048908 Ga0496105_0031745 Ga0496105_0031745_209_1057 281
224 3300048911 Ga0496108_0050214 Ga0496108_0050214_1107_1985 281
225 3300048911 Ga0496108_0200664 Ga0496108_0200664_867_1718 281
226 3300048915 Ga0496112_0235335 Ga0496112_0235335_536_1408 281
227 3300048918 Ga0496115_0458962 Ga0496115_0458962_97_942 281
228 3300048919 Ga0496116_0006031 Ga0496116_0006031_5665_6513 281
229 3300048920 Ga0496117_0046908 Ga0496117_0046908_61_909 281
230 3300048920 Ga0496117_0058063 Ga0496117_0058063_1136_1984 281
231 3300048921 Ga0496118_0049440 Ga0496118_0049440_2125_2973 281
232 3300048921 Ga0496118_0063583 Ga0496118_0063583_724_1572 281
233 3300048922 Ga0496119_0153610 Ga0496119_0153610_236_1084 281
234 3300048923 Ga0496120_0065204 Ga0496120_0065204_910_1761 281
235 3300048924 Ga0496121_0006633 Ga0496121_0006633_6201_7049 281
236 3300048925 Ga0496122_0010744 Ga0496122_0010744_3095_3943 281
237 3300048925 Ga0496122_0152469 Ga0496122_0152469_95_943 281
238 3300048925 Ga0496122_0274871 Ga0496122_0274871_61_909 281
239 3300048926 Ga0496123_0036404 Ga0496123_0036404_2478_3326 281
240 3300048926 Ga0496123_0158828 Ga0496123_0158828_71_919 281
241 3300048927 Ga0496124_0181898 Ga0496124_0181898_513_1364 281
242 3300048927 Ga0496124_0300869 Ga0496124_0300869_35_883 281
243 3300048928 Ga0496125_0025922 Ga0496125_0025922_3634_4482 281
244 3300048928 Ga0496125_0065181 Ga0496125_0065181_536_1384 281
245 3300048928 Ga0496125_0239608 Ga0496125_0239608_294_1139 281
246 3300048929 Ga0496126_0139555 Ga0496126_0139555_379_1227 281
247 3300049583 Ga0501067_0055938 Ga0501067_0055938_206_1051 281
248 3300050490 nmdc:mga03n38_53870_c1 nmdc:mga03n38_53870_c1_582_1427 281
249 3300050491 nmdc:mga00v17_233909_c1 nmdc:mga00v17_233909_c1_113_961 281
250 3300050491 nmdc:mga00v17_27373_c1 nmdc:mga00v17_27373_c1_84_932 281
251 3300050491 nmdc:mga00v17_299687_c1 nmdc:mga00v17_299687_c1_161_1006 281
252 3300050492 nmdc:mga0yw44_21367_c1 nmdc:mga0yw44_21367_c1_2281_3126 281
253 3300050492 nmdc:mga0yw44_27119_c1 nmdc:mga0yw44_27119_c1_310_1158 281
254 3300050492 nmdc:mga0yw44_56798_c1 nmdc:mga0yw44_56798_c1_146_994 281
255 3300050492 nmdc:mga0yw44_6339_c1 nmdc:mga0yw44_6339_c1_2608_3456 281
256 3300050494 nmdc:mga06z11_192512_c1 nmdc:mga06z11_192512_c1_257_1108 281
257 3300050494 nmdc:mga06z11_30436_c1 nmdc:mga06z11_30436_c1_1705_2553 281
258 3300050494 nmdc:mga06z11_59313_c1 nmdc:mga06z11_59313_c1_975_1820 281
259 3300050496 nmdc:mga07m45_118817_c1 nmdc:mga07m45_118817_c1_463_1308 281
260 3300050496 nmdc:mga07m45_13999_c1 nmdc:mga07m45_13999_c1_1864_2709 281
261 3300050516 nmdc:mga0sz30_3474_c2 nmdc:mga0sz30_3474_c2_1203_2051 281
262 3300053077 Ga0495601_0051270 Ga0495601_0051270_233_1084 281
263 3300053077 Ga0495601_0074759 Ga0495601_0074759_523_1401 281
264 3300053077 Ga0495601_0102972 Ga0495601_0102972_345_1193 281
265 3300053084 Ga0495595_0107943 Ga0495595_0107943_475_1326 281
266 3300053087 Ga0500643_017749 Ga0500643_017749_267_1115 281
267 3300053088 Ga0500644_0043361 Ga0500644_0043361_500_1348 281
268 3300053089 Ga0500581_064362 Ga0500581_064362_831_1679 281
269 3300053092 Ga0500583_0047342 Ga0500583_0047342_215_1066 281
270 3300053093 Ga0500651_0046532 Ga0500651_0046532_1160_2008 281
271 3300053098 Ga0500650_0000157 Ga0500650_0000157_1264_2112 281
272 3300053104 Ga0500556_0000002 Ga0500556_0000002_381764_382612 281
273 3300053109 Ga0500569_022573 Ga0500569_022573_188_1036 281
274 3300053116 Ga0500592_003596 Ga0500592_003596_511_1359 281
275 3300053118 Ga0500594_0011276 Ga0500594_0011276_1120_1968 281
276 3300053131 Ga0500652_000564 Ga0500652_000564_10013_10861 281
277 3300053134 Ga0500658_0006618 Ga0500658_0006618_734_1582 281
278 3300053136 Ga0500559_0208071 Ga0500559_0208071_17_868 281
279 3300053139 Ga0500568_0008323 Ga0500568_0008323_1077_1925 281
280 3300053151 Ga0500604_0000635 Ga0500604_0000635_4479_5327 281
281 3300053156 Ga0500622_0000518 Ga0500622_0000518_29422_30270 281
282 3300053161 Ga0500634_0192661 Ga0500634_0192661_30_878 281
283 3300053731 Ga0500609_004529 Ga0500609_004529_813_1658 281

Structural Annotation

Top 5 Hits

ID Description Score Start End
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.607 1 272
7an5-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.6049 1 272
7an7-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.6041 1 272
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.6014 1 272
7ahr-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.5995 1 272
ID Description Score Start End Superfamily
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7163 82 186 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7105 1 75 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6793 83 184 3.40.190.10
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6729 83 171 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6676 82 197 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0R3LRR7-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9344 1 281
AF-A0A537Q7F1-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9329 1 280
AF-A0A537Q7F1-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9266 1 280
AF-A0A7X0FDV8-F1-model_v4 4,5-dihydroxyphthalate decarboxylase (EC 4.1.1.55) 0.9224 2 277 GO:0018796
AF-A0A3D9RB72-F1-model_v4 deleted 0.9148 1 277

Feature Viewer

pLDDT pTM Quality
87.73 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map