F385649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 283 | 209 | 271 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10045960|Ga0307515_100459603 |
| Length | 269 |
| Sequence | MAIRLRTLLGDHPGTAALKSSPTNKGFKPMVREAAFDVSELAIVTYLMAKSFDKPMVLLPNVLMARFQHGHALYNAKRGTLKPVDLNGKRVGIRSFTTTTGAWLRGILANDYGVDLNSIDWVKFEDAHVAEFKDTTKRAPAGKQIVQMLVDGELDAVLGEKSEHADLKPLFADVAAEEKAWAAKHSIVPINHMVVVSQRLCEKNPDAVREVHRLLVESAQASPAAPRFTTVEMRRSLELIVGYTAQQGLIPRAFSVDELFDDVTRALVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2791355199 | |||
| 3 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 4 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 5 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 6 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 7 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 8 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 9 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 96 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 97 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 98 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 99 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 103 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 104 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 105 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 106 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 111 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 117 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 118 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 119 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 172 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 173 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 174 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 175 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 182 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 190 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 193 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 194 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 195 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 197 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 198 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 200 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 202 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 204 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 205 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 206 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 207 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 208 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 209 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.1 |
| Metatranscriptomes | 0 |
| Isolates | 3.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.9 |
| Nodule | 1.77 |
| Rhizoplane | 4.24 |
| Rhizosphere | 66.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10016009 | 3300003215 | Bacteria | 3026 |
| 2 | Ga0070680_100107577 | 3300005336 | Bacteria | 2319 |
| 3 | Ga0070682_100338585 | 3300005337 | Bacteria | 1117 |
| 4 | Ga0068868_100028693 | 3300005338 | Bacteria | 4257 |
| 5 | Ga0068868_100572486 | 3300005338 | Bacteria | 998 |
| 6 | Ga0070660_100118479 | 3300005339 | Bacteria | 2111 |
| 7 | Ga0070689_100230732 | 3300005340 | Bacteria | 1522 |
| 8 | Ga0070661_100125958 | 3300005344 | Bacteria | 1922 |
| 9 | Ga0070668_100170379 | 3300005347 | Bacteria | 1772 |
| 10 | Ga0070668_100420799 | 3300005347 | Bacteria | 1144 |
| 11 | Ga0070668_100492015 | 3300005347 | Bacteria | 1060 |
| 12 | Ga0070674_100187960 | 3300005356 | Bacteria | 1587 |
| 13 | Ga0070667_100473929 | 3300005367 | Bacteria | 1146 |
| 14 | Ga0070711_100020886 | 3300005439 | Bacteria | 4227 |
| 15 | Ga0070663_100055656 | 3300005455 | Bacteria | 2832 |
| 16 | Ga0070678_100117733 | 3300005456 | Bacteria | 2090 |
| 17 | Ga0070678_100281883 | 3300005456 | Bacteria | 1406 |
| 18 | Ga0070662_100408426 | 3300005457 | Bacteria | 1122 |
| 19 | Ga0070681_10004544 | 3300005458 | Bacteria | 13233 |
| 20 | Ga0070681_10103453 | 3300005458 | Bacteria | 2792 |
| 21 | Ga0070685_10286444 | 3300005466 | Bacteria | 1105 |
| 22 | Ga0070706_100303000 | 3300005467 | Bacteria | 1491 |
| 23 | Ga0070679_100021572 | 3300005530 | Bacteria | 6289 |
| 24 | Ga0070679_100301260 | 3300005530 | Bacteria | 1553 |
| 25 | Ga0070684_100225994 | 3300005535 | Bacteria | 1708 |
| 26 | Ga0068853_100647486 | 3300005539 | Bacteria | 1005 |
| 27 | Ga0070665_100059576 | 3300005548 | Bacteria | 3827 |
| 28 | Ga0070665_100065998 | 3300005548 | Bacteria | 3630 |
| 29 | Ga0070665_100125579 | 3300005548 | Bacteria | 2568 |
| 30 | Ga0070665_100435454 | 3300005548 | Bacteria | 1320 |
| 31 | Ga0068856_100099117 | 3300005614 | Bacteria | 2904 |
| 32 | Ga0070702_100339613 | 3300005615 | Bacteria | 1054 |
| 33 | Ga0068864_100712992 | 3300005618 | Bacteria | 981 |
| 34 | Ga0068851_10004272 | 3300005834 | Bacteria | 6435 |
| 35 | Ga0068858_100293788 | 3300005842 | Bacteria | 1549 |
| 36 | Ga0068860_100144236 | 3300005843 | Bacteria | 2290 |
| 37 | Ga0068862_100329406 | 3300005844 | Bacteria | 1412 |
| 38 | Ga0081538_10034813 | 3300005981 | Bacteria | 3321 |
| 39 | Ga0081540_1002690 | 3300005983 | Bacteria | 14454 |
| 40 | Ga0081540_1017195 | 3300005983 | Bacteria | 4485 |
| 41 | Ga0081540_1044360 | 3300005983 | Bacteria | 2270 |
| 42 | Ga0075365_10075088 | 3300006038 | Bacteria | 2281 |
| 43 | Ga0075365_10149439 | 3300006038 | Bacteria | 1625 |
| 44 | Ga0075365_10180139 | 3300006038 | Bacteria | 1477 |
| 45 | Ga0075364_10122667 | 3300006051 | Bacteria | 1740 |
| 46 | Ga0075362_10022802 | 3300006177 | Bacteria | 2641 |
| 47 | Ga0075367_10000988 | 3300006178 | Bacteria | 11650 |
| 48 | Ga0075369_10008785 | 3300006186 | Bacteria | 3903 |
| 49 | Ga0075369_10024805 | 3300006186 | Bacteria | 2488 |
| 50 | Ga0075370_10213127 | 3300006353 | Bacteria | 1140 |
| 51 | Ga0068871_100376650 | 3300006358 | Bacteria | 1260 |
| 52 | Ga0075428_100079146 | 3300006844 | Bacteria | 3587 |
| 53 | Ga0097620_100171379 | 3300006931 | Bacteria | 2251 |
| 54 | Ga0099795_10028929 | 3300007788 | Bacteria | 1890 |
| 55 | Ga0105240_10540784 | 3300009093 | Bacteria | 1290 |
| 56 | Ga0114129_10111337 | 3300009147 | Bacteria | 3777 |
| 57 | Ga0105241_10032147 | 3300009174 | Bacteria | 3931 |
| 58 | Ga0105248_10263800 | 3300009177 | Bacteria | 1939 |
| 59 | Ga0105248_10340617 | 3300009177 | Bacteria | 1688 |
| 60 | Ga0105237_10216485 | 3300009545 | Bacteria | 1915 |
| 61 | Ga0105238_10596953 | 3300009551 | Bacteria | 1112 |
| 62 | Ga0105238_10698344 | 3300009551 | Bacteria | 1026 |
| 63 | Ga0105249_10578209 | 3300009553 | Bacteria | 1176 |
| 64 | Ga0099796_10021898 | 3300010159 | Bacteria | 1976 |
| 65 | Ga0105239_10231697 | 3300010375 | Bacteria | 2072 |
| 66 | Ga0105239_10336744 | 3300010375 | Bacteria | 1702 |
| 67 | Ga0105239_10340438 | 3300010375 | Bacteria | 1692 |
| 68 | Ga0105246_10160772 | 3300011119 | Bacteria | 1711 |
| 69 | Ga0105246_10351569 | 3300011119 | Bacteria | 1208 |
| 70 | Ga0157369_10006547 | 3300013105 | Bacteria | 13481 |
| 71 | Ga0157378_10205993 | 3300013297 | Bacteria | 1863 |
| 72 | Ga0163162_10217372 | 3300013306 | Bacteria | 2041 |
| 73 | Ga0163162_10437901 | 3300013306 | Bacteria | 1439 |
| 74 | Ga0157372_10852397 | 3300013307 | Bacteria | 1058 |
| 75 | Ga0157375_10300634 | 3300013308 | Bacteria | 1768 |
| 76 | Ga0157380_10329795 | 3300014326 | Bacteria | 1419 |
| 77 | Ga0157379_10383594 | 3300014968 | Bacteria | 1290 |
| 78 | Ga0157376_10187855 | 3300014969 | Bacteria | 1893 |
| 79 | Ga0163161_10207570 | 3300017792 | Bacteria | 1512 |
| 80 | Ga0163161_10437643 | 3300017792 | Bacteria | 1055 |
| 81 | Ga0209564_1011501 | 3300025295 | Bacteria | 3958 |
| 82 | Ga0209758_1004785 | 3300025297 | Bacteria | 10950 |
| 83 | Ga0207710_10164087 | 3300025900 | Bacteria | 1084 |
| 84 | Ga0207699_10004016 | 3300025906 | Bacteria | 7041 |
| 85 | Ga0207684_10318289 | 3300025910 | Bacteria | 1341 |
| 86 | Ga0207654_10026739 | 3300025911 | Bacteria | 3128 |
| 87 | Ga0207707_10000359 | 3300025912 | Bacteria | 47942 |
| 88 | Ga0207707_10154833 | 3300025912 | Bacteria | 2004 |
| 89 | Ga0207707_10277057 | 3300025912 | Bacteria | 1453 |
| 90 | Ga0207693_10013028 | 3300025915 | Bacteria | 6710 |
| 91 | Ga0207693_10022195 | 3300025915 | Bacteria | 5045 |
| 92 | Ga0207660_10027186 | 3300025917 | Bacteria | 3902 |
| 93 | Ga0207662_10243303 | 3300025918 | Bacteria | 1178 |
| 94 | Ga0207657_10461258 | 3300025919 | Bacteria | 997 |
| 95 | Ga0207652_10003470 | 3300025921 | Bacteria | 12999 |
| 96 | Ga0207652_10281063 | 3300025921 | Bacteria | 1501 |
| 97 | Ga0207709_10114811 | 3300025935 | Bacteria | 1807 |
| 98 | Ga0207667_10162547 | 3300025949 | Bacteria | 2296 |
| 99 | Ga0207668_10124223 | 3300025972 | Bacteria | 1959 |
| 100 | Ga0207677_10031837 | 3300026023 | Bacteria | 3382 |
| 101 | Ga0207703_10341013 | 3300026035 | Bacteria | 1377 |
| 102 | Ga0207703_10450402 | 3300026035 | Bacteria | 1202 |
| 103 | Ga0207678_10035639 | 3300026067 | Bacteria | 4332 |
| 104 | Ga0207678_10212644 | 3300026067 | Bacteria | 1654 |
| 105 | Ga0207648_10266565 | 3300026089 | Bacteria | 1529 |
| 106 | Ga0207675_100266564 | 3300026118 | Bacteria | 1661 |
| 107 | Ga0207683_10084701 | 3300026121 | Bacteria | 2818 |
| 108 | Ga0207683_10115071 | 3300026121 | Bacteria | 2411 |
| 109 | Ga0207683_10369881 | 3300026121 | Bacteria | 1317 |
| 110 | Ga0207698_10350160 | 3300026142 | Bacteria | 1395 |
| 111 | Ga0268266_10002394 | 3300028379 | Bacteria | 20226 |
| 112 | Ga0268266_10003934 | 3300028379 | Bacteria | 14440 |
| 113 | Ga0268266_10027683 | 3300028379 | Bacteria | 4819 |
| 114 | Ga0268265_10181073 | 3300028380 | Bacteria | 1810 |
| 115 | Ga0268264_10027494 | 3300028381 | Bacteria | 4648 |
| 116 | Ga0307515_10045960 | 3300028794 | Bacteria | 6689 |
| 117 | Ga0307515_10212609 | 3300028794 | Bacteria | 1774 |
| 118 | Ga0307513_10184797 | 3300031456 | Bacteria | 1943 |
| 119 | Ga0307509_10180532 | 3300031507 | Bacteria | 1976 |
| 120 | Ga0307408_100277295 | 3300031548 | Bacteria | 1395 |
| 121 | Ga0307508_10156701 | 3300031616 | Bacteria | 1881 |
| 122 | Ga0307406_10213629 | 3300031901 | Bacteria | 1429 |
| 123 | Ga0307412_10082860 | 3300031911 | Bacteria | 2222 |
| 124 | Ga0307416_100328820 | 3300032002 | Bacteria | 1535 |
| 125 | Ga0307414_10168155 | 3300032004 | Bacteria | 1749 |
| 126 | Ga0307510_10001061 | 3300033180 | Bacteria | 29217 |
| 127 | Ga0316215_1004201 | 3300033544 | Bacteria | 1378 |
| 128 | Ga0373926_0072562 | 3300035083 | Bacteria | 1266 |
| 129 | Ga0373934_0014895 | 3300035086 | Bacteria | 2946 |
| 130 | Ga0373923_0003551 | 3300035111 | Bacteria | 5018 |
| 131 | Ga0373953_0007452 | 3300035117 | Bacteria | 3665 |
| 132 | Ga0373943_0026933 | 3300035170 | Bacteria | 2697 |
| 133 | Ga0373943_0097811 | 3300035170 | Bacteria | 1530 |
| 134 | Ga0373924_0101645 | 3300035410 | Bacteria | 1237 |
| 135 | Ga0373935_0129963 | 3300035692 | Bacteria | 1691 |
| 136 | Ga0373935_0173522 | 3300035692 | Bacteria | 1476 |
| 137 | Ga0373927_0016784 | 3300035695 | Bacteria | 4829 |
| 138 | Ga0373927_0093885 | 3300035695 | Bacteria | 1950 |
| 139 | Ga0373927_0147657 | 3300035695 | Bacteria | 1539 |
| 140 | Ga0373933_0006955 | 3300035724 | Bacteria | 6165 |
| 141 | Ga0373947_0025405 | 3300035725 | Bacteria | 3455 |
| 142 | Ga0373947_0183578 | 3300035725 | Bacteria | 1363 |
| 143 | Ga0373947_0198925 | 3300035725 | Bacteria | 1310 |
| 144 | Ga0373925_0112208 | 3300037068 | Bacteria | 2107 |
| 145 | Ga0451795_0309788 | 3300041456 | Bacteria | 941 |
| 146 | Ga0466957_0155221 | 3300044842 | Bacteria | 1483 |
| 147 | Ga0466959_0047117 | 3300045049 | Bacteria | 3171 |
| 148 | Ga0495603_0004410 | 3300046455 | Bacteria | 8389 |
| 149 | Ga0495603_0044718 | 3300046455 | Bacteria | 2642 |
| 150 | Ga0495603_0104863 | 3300046455 | Bacteria | 1650 |
| 151 | Ga0495629_0080943 | 3300046459 | Bacteria | 2267 |
| 152 | Ga0495638_0000646 | 3300046460 | Bacteria | 38171 |
| 153 | Ga0495638_0030281 | 3300046460 | Bacteria | 3485 |
| 154 | Ga0495641_0022963 | 3300046461 | Bacteria | 3110 |
| 155 | Ga0495650_0078082 | 3300046471 | Bacteria | 1283 |
| 156 | Ga0495580_0006636 | 3300046472 | Bacteria | 9401 |
| 157 | Ga0495662_0028790 | 3300046476 | Bacteria | 2682 |
| 158 | Ga0495664_0090586 | 3300046477 | Bacteria | 1838 |
| 159 | Ga0495585_0097809 | 3300046492 | Bacteria | 1573 |
| 160 | Ga0495585_0105615 | 3300046492 | Bacteria | 1502 |
| 161 | Ga0495585_0181340 | 3300046492 | Bacteria | 1082 |
| 162 | Ga0495606_0064798 | 3300046507 | Bacteria | 2324 |
| 163 | Ga0495616_0053672 | 3300046513 | Bacteria | 2002 |
| 164 | Ga0495618_0028419 | 3300046514 | Bacteria | 3485 |
| 165 | Ga0495620_0037103 | 3300046515 | Bacteria | 2174 |
| 166 | Ga0495628_0087625 | 3300046516 | Bacteria | 2413 |
| 167 | Ga0495630_0008895 | 3300046517 | Bacteria | 7209 |
| 168 | Ga0495631_0018759 | 3300046518 | Bacteria | 3253 |
| 169 | Ga0495631_0121508 | 3300046518 | Bacteria | 1123 |
| 170 | Ga0495632_0062420 | 3300046519 | Bacteria | 1806 |
| 171 | Ga0495643_0088896 | 3300046522 | Bacteria | 1596 |
| 172 | Ga0495644_0054690 | 3300046523 | Bacteria | 1499 |
| 173 | Ga0495654_0020090 | 3300046530 | Bacteria | 3485 |
| 174 | Ga0495640_0142508 | 3300046533 | Bacteria | 1544 |
| 175 | Ga0495598_0004011 | 3300046537 | Bacteria | 3162 |
| 176 | Ga0495598_0037755 | 3300046537 | Bacteria | 1395 |
| 177 | Ga0495621_0034827 | 3300046539 | Bacteria | 1741 |
| 178 | Ga0495597_0118696 | 3300046542 | Bacteria | 1104 |
| 179 | Ga0495656_0064812 | 3300046615 | Bacteria | 1605 |
| 180 | Ga0495634_0138428 | 3300046642 | Bacteria | 1547 |
| 181 | Ga0495625_0142375 | 3300046660 | Bacteria | 1617 |
| 182 | Ga0495625_0448111 | 3300046660 | Bacteria | 798 |
| 183 | Ga0495635_0055245 | 3300046663 | Bacteria | 2735 |
| 184 | Ga0495659_0019059 | 3300046664 | Bacteria | 2293 |
| 185 | Ga0495661_0056820 | 3300046665 | Bacteria | 2339 |
| 186 | Ga0495661_0249728 | 3300046665 | Bacteria | 906 |
| 187 | Ga0495588_0093296 | 3300046674 | Bacteria | 1578 |
| 188 | Ga0495599_0124582 | 3300046678 | Bacteria | 1602 |
| 189 | Ga0495646_0038325 | 3300046680 | Bacteria | 2960 |
| 190 | Ga0495647_0005841 | 3300046681 | Bacteria | 4050 |
| 191 | Ga0495658_0003337 | 3300046683 | Bacteria | 7963 |
| 192 | Ga0495624_0098752 | 3300046690 | Bacteria | 1798 |
| 193 | Ga0495624_0131199 | 3300046690 | Bacteria | 1536 |
| 194 | Ga0495670_0004878 | 3300046691 | Bacteria | 6588 |
| 195 | Ga0495670_0073154 | 3300046691 | Bacteria | 1737 |
| 196 | Ga0495670_0077203 | 3300046691 | Bacteria | 1693 |
| 197 | Ga0495660_0073830 | 3300046810 | Bacteria | 1803 |
| 198 | Ga0495604_0054391 | 3300047317 | Bacteria | 3089 |
| 199 | Ga0495674_0003465 | 3300047319 | Bacteria | 15330 |
| 200 | Ga0495674_0291603 | 3300047319 | Bacteria | 1334 |
| 201 | Ga0495676_0072253 | 3300047321 | Bacteria | 2650 |
| 202 | Ga0495684_0061283 | 3300047471 | Bacteria | 2862 |
| 203 | Ga0495593_0067345 | 3300047673 | Bacteria | 1864 |
| 204 | Ga0496101_0090807 | 3300048904 | Bacteria | 2272 |
| 205 | Ga0496102_0467703 | 3300048905 | Bacteria | 1182 |
| 206 | Ga0496102_0475059 | 3300048905 | Bacteria | 1171 |
| 207 | Ga0496104_0205595 | 3300048907 | Bacteria | 1881 |
| 208 | Ga0496104_0213858 | 3300048907 | Bacteria | 1839 |
| 209 | Ga0496105_0031745 | 3300048908 | Bacteria | 4331 |
| 210 | Ga0496108_0050214 | 3300048911 | Bacteria | 3491 |
| 211 | Ga0496108_0200664 | 3300048911 | Bacteria | 1731 |
| 212 | Ga0496112_0235335 | 3300048915 | Bacteria | 1785 |
| 213 | Ga0496115_0458962 | 3300048918 | Bacteria | 1028 |
| 214 | Ga0496116_0006031 | 3300048919 | Bacteria | 11095 |
| 215 | Ga0496117_0046908 | 3300048920 | Bacteria | 3104 |
| 216 | Ga0496117_0058063 | 3300048920 | Bacteria | 2682 |
| 217 | Ga0496118_0049440 | 3300048921 | Bacteria | 3238 |
| 218 | Ga0496118_0063583 | 3300048921 | Bacteria | 2714 |
| 219 | Ga0496119_0153610 | 3300048922 | Bacteria | 1231 |
| 220 | Ga0496120_0065204 | 3300048923 | Bacteria | 2019 |
| 221 | Ga0496121_0006633 | 3300048924 | Bacteria | 14254 |
| 222 | Ga0496121_0017686 | 3300048924 | Bacteria | 7256 |
| 223 | Ga0496122_0010744 | 3300048925 | Bacteria | 9391 |
| 224 | Ga0496122_0152469 | 3300048925 | Bacteria | 1424 |
| 225 | Ga0496122_0274871 | 3300048925 | Bacteria | 925 |
| 226 | Ga0496123_0036404 | 3300048926 | Bacteria | 3491 |
| 227 | Ga0496123_0158828 | 3300048926 | Bacteria | 1208 |
| 228 | Ga0496124_0181898 | 3300048927 | Bacteria | 1617 |
| 229 | Ga0496124_0300869 | 3300048927 | Bacteria | 1159 |
| 230 | Ga0496125_0025922 | 3300048928 | Bacteria | 5356 |
| 231 | Ga0496125_0065181 | 3300048928 | Bacteria | 2888 |
| 232 | Ga0496125_0239608 | 3300048928 | Bacteria | 1153 |
| 233 | Ga0496126_0139555 | 3300048929 | Bacteria | 2087 |
| 234 | Ga0501067_0055938 | 3300049583 | Bacteria | 2186 |
| 235 | nmdc:mga03n38_53870_c1 | 3300050490 | Bacteria | 1806 |
| 236 | nmdc:mga00v17_233909_c1 | 3300050491 | Bacteria | 1191 |
| 237 | nmdc:mga00v17_27373_c1 | 3300050491 | Bacteria | 3328 |
| 238 | nmdc:mga00v17_299687_c1 | 3300050491 | Bacteria | 1044 |
| 239 | nmdc:mga0yw44_21367_c1 | 3300050492 | Bacteria | 3609 |
| 240 | nmdc:mga0yw44_27119_c1 | 3300050492 | Bacteria | 3278 |
| 241 | nmdc:mga0yw44_56798_c1 | 3300050492 | Bacteria | 2386 |
| 242 | nmdc:mga0yw44_6339_c1 | 3300050492 | Bacteria | 5709 |
| 243 | nmdc:mga06z11_192512_c1 | 3300050494 | Bacteria | 1181 |
| 244 | nmdc:mga06z11_30436_c1 | 3300050494 | Bacteria | 2612 |
| 245 | nmdc:mga06z11_59313_c1 | 3300050494 | Bacteria | 1989 |
| 246 | nmdc:mga07m45_118817_c1 | 3300050496 | Bacteria | 1526 |
| 247 | nmdc:mga07m45_13999_c1 | 3300050496 | Bacteria | 4265 |
| 248 | nmdc:mga07m45_73106_c1 | 3300050496 | Bacteria | 1952 |
| 249 | nmdc:mga0sz30_3474_c2 | 3300050516 | Bacteria | 4650 |
| 250 | Ga0495601_0051270 | 3300053077 | Bacteria | 2605 |
| 251 | Ga0495601_0074759 | 3300053077 | Bacteria | 2168 |
| 252 | Ga0495601_0102972 | 3300053077 | Bacteria | 1845 |
| 253 | Ga0495595_0107943 | 3300053084 | Bacteria | 1348 |
| 254 | Ga0500643_017749 | 3300053087 | Bacteria | 2376 |
| 255 | Ga0500644_0043361 | 3300053088 | Bacteria | 1504 |
| 256 | Ga0500581_064362 | 3300053089 | Bacteria | 1853 |
| 257 | Ga0500583_0047342 | 3300053092 | Bacteria | 1981 |
| 258 | Ga0500651_0046532 | 3300053093 | Bacteria | 2729 |
| 259 | Ga0500650_0000157 | 3300053098 | Bacteria | 17929 |
| 260 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 261 | Ga0500569_022573 | 3300053109 | Bacteria | 1678 |
| 262 | Ga0500592_003596 | 3300053116 | Bacteria | 2475 |
| 263 | Ga0500594_0011276 | 3300053118 | Bacteria | 2086 |
| 264 | Ga0500652_000564 | 3300053131 | Bacteria | 12958 |
| 265 | Ga0500658_0006618 | 3300053134 | Bacteria | 4294 |
| 266 | Ga0500559_0208071 | 3300053136 | Bacteria | 923 |
| 267 | Ga0500568_0008323 | 3300053139 | Bacteria | 5011 |
| 268 | Ga0500604_0000635 | 3300053151 | Bacteria | 9651 |
| 269 | Ga0500622_0000518 | 3300053156 | Bacteria | 35866 |
| 270 | Ga0500634_0192661 | 3300053161 | Bacteria | 904 |
| 271 | Ga0500609_004529 | 3300053731 | Bacteria | 1919 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0467703 | Ga0496102_0467703_52_789 | 237 |
| 2 | 3300046660 | Ga0495625_0448111 | Ga0495625_0448111_14_733 | 239 |
| 3 | 3300048924 | Ga0496121_0017686 | Ga0496121_0017686_6491_7213 | 239 |
| 4 | 3300050496 | nmdc:mga07m45_73106_c1 | nmdc:mga07m45_73106_c1_26_748 | 239 |
| 5 | 3300009177 | Ga0105248_10263800 | Ga0105248_102638002 | 266 |
| 6 | 3300028794 | Ga0307515_10045960 | Ga0307515_100459603 | 266 |
| 7 | 3300005467 | Ga0070706_100303000 | Ga0070706_1003030002 | 267 |
| 8 | 3300025910 | Ga0207684_10318289 | Ga0207684_103182892 | 267 |
| 9 | 3300017792 | Ga0163161_10437643 | Ga0163161_104376432 | 270 |
| 10 | 3300046492 | Ga0495585_0181340 | Ga0495585_0181340_114_956 | 272 |
| 11 | 3300046523 | Ga0495644_0054690 | Ga0495644_0054690_94_936 | 272 |
| 12 | 3300046537 | Ga0495598_0004011 | Ga0495598_0004011_670_1512 | 272 |
| 13 | 3300046664 | Ga0495659_0019059 | Ga0495659_0019059_893_1735 | 272 |
| 14 | 3300046665 | Ga0495661_0249728 | Ga0495661_0249728_20_862 | 272 |
| 15 | 3300046691 | Ga0495670_0077203 | Ga0495670_0077203_666_1508 | 272 |
| 16 | 3300005367 | Ga0070667_100473929 | Ga0070667_1004739291 | 275 |
| 17 | 3300035695 | Ga0373927_0016784 | Ga0373927_0016784_630_1460 | 276 |
| 18 | iso_pu_bacteria | 2602042107 | 2603856777 | 277 |
| 19 | iso_pu_bacteria | 2857524615 | 2857528255 | 277 |
| 20 | iso_pu_bacteria | 2919073203 | 2919075679 | 277 |
| 21 | iso_pu_bacteria | 2876808645 | 2876813029 | 278 |
| 22 | iso_pu_bacteria | 2879110137 | 2879115853 | 278 |
| 23 | 3300005338 | Ga0068868_100572486 | Ga0068868_1005724861 | 279 |
| 24 | 3300005347 | Ga0070668_100420799 | Ga0070668_1004207992 | 279 |
| 25 | 3300005844 | Ga0068862_100329406 | Ga0068862_1003294061 | 279 |
| 26 | 3300025935 | Ga0207709_10114811 | Ga0207709_101148112 | 279 |
| 27 | 3300026118 | Ga0207675_100266564 | Ga0207675_1002665642 | 279 |
| 28 | 3300028380 | Ga0268265_10181073 | Ga0268265_101810732 | 279 |
| 29 | iso_pu_bacteria | 2791355199 | 2793079922 | 279 |
| 30 | iso_pu_bacteria | 2874604998 | 2874605539 | 279 |
| 31 | iso_pu_bacteria | 2889033259 | 2889039414 | 279 |
| 32 | iso_pu_bacteria | 2922386360 | 2922391298 | 279 |
| 33 | iso_pu_bacteria | 8006964411 | 8006972442 | 279 |
| 34 | iso_pu_bacteria | 8006984368 | 8006987901 | 279 |
| 35 | iso_pu_bacteria | 8056673599 | 8056677694 | 279 |
| 36 | 3300005340 | Ga0070689_100230732 | Ga0070689_1002307321 | 280 |
| 37 | 3300005983 | Ga0081540_1002690 | Ga0081540_100269015 | 280 |
| 38 | 3300005983 | Ga0081540_1044360 | Ga0081540_10443602 | 280 |
| 39 | 3300013307 | Ga0157372_10852397 | Ga0157372_108523971 | 280 |
| 40 | 3300031456 | Ga0307513_10184797 | Ga0307513_101847972 | 280 |
| 41 | 3300035725 | Ga0373947_0183578 | Ga0373947_0183578_142_984 | 280 |
| 42 | 3300046455 | Ga0495603_0044718 | Ga0495603_0044718_452_1294 | 280 |
| 43 | 3300046460 | Ga0495638_0030281 | Ga0495638_0030281_1079_1921 | 280 |
| 44 | 3300046471 | Ga0495650_0078082 | Ga0495650_0078082_391_1233 | 280 |
| 45 | 3300046492 | Ga0495585_0097809 | Ga0495585_0097809_345_1187 | 280 |
| 46 | 3300046492 | Ga0495585_0105615 | Ga0495585_0105615_446_1288 | 280 |
| 47 | 3300046518 | Ga0495631_0018759 | Ga0495631_0018759_1366_2208 | 280 |
| 48 | 3300046519 | Ga0495632_0062420 | Ga0495632_0062420_173_1015 | 280 |
| 49 | 3300046537 | Ga0495598_0037755 | Ga0495598_0037755_138_980 | 280 |
| 50 | 3300046539 | Ga0495621_0034827 | Ga0495621_0034827_563_1405 | 280 |
| 51 | 3300046615 | Ga0495656_0064812 | Ga0495656_0064812_532_1407 | 280 |
| 52 | 3300046691 | Ga0495670_0073154 | Ga0495670_0073154_76_918 | 280 |
| 53 | 3300047321 | Ga0495676_0072253 | Ga0495676_0072253_906_1748 | 280 |
| 54 | 3300003215 | JGI25153J46596_10016009 | JGI25153J46596_100160094 | 281 |
| 55 | 3300005336 | Ga0070680_100107577 | Ga0070680_1001075773 | 281 |
| 56 | 3300005337 | Ga0070682_100338585 | Ga0070682_1003385852 | 281 |
| 57 | 3300005338 | Ga0068868_100028693 | Ga0068868_1000286933 | 281 |
| 58 | 3300005339 | Ga0070660_100118479 | Ga0070660_1001184791 | 281 |
| 59 | 3300005344 | Ga0070661_100125958 | Ga0070661_1001259581 | 281 |
| 60 | 3300005347 | Ga0070668_100170379 | Ga0070668_1001703792 | 281 |
| 61 | 3300005347 | Ga0070668_100492015 | Ga0070668_1004920151 | 281 |
| 62 | 3300005356 | Ga0070674_100187960 | Ga0070674_1001879602 | 281 |
| 63 | 3300005439 | Ga0070711_100020886 | Ga0070711_1000208862 | 281 |
| 64 | 3300005455 | Ga0070663_100055656 | Ga0070663_1000556562 | 281 |
| 65 | 3300005456 | Ga0070678_100117733 | Ga0070678_1001177332 | 281 |
| 66 | 3300005456 | Ga0070678_100281883 | Ga0070678_1002818832 | 281 |
| 67 | 3300005457 | Ga0070662_100408426 | Ga0070662_1004084261 | 281 |
| 68 | 3300005458 | Ga0070681_10004544 | Ga0070681_100045445 | 281 |
| 69 | 3300005458 | Ga0070681_10103453 | Ga0070681_101034532 | 281 |
| 70 | 3300005466 | Ga0070685_10286444 | Ga0070685_102864442 | 281 |
| 71 | 3300005530 | Ga0070679_100021572 | Ga0070679_1000215726 | 281 |
| 72 | 3300005530 | Ga0070679_100301260 | Ga0070679_1003012602 | 281 |
| 73 | 3300005535 | Ga0070684_100225994 | Ga0070684_1002259943 | 281 |
| 74 | 3300005539 | Ga0068853_100647486 | Ga0068853_1006474861 | 281 |
| 75 | 3300005548 | Ga0070665_100059576 | Ga0070665_1000595763 | 281 |
| 76 | 3300005548 | Ga0070665_100065998 | Ga0070665_1000659984 | 281 |
| 77 | 3300005548 | Ga0070665_100125579 | Ga0070665_1001255792 | 281 |
| 78 | 3300005548 | Ga0070665_100435454 | Ga0070665_1004354541 | 281 |
| 79 | 3300005614 | Ga0068856_100099117 | Ga0068856_1000991173 | 281 |
| 80 | 3300005615 | Ga0070702_100339613 | Ga0070702_1003396131 | 281 |
| 81 | 3300005618 | Ga0068864_100712992 | Ga0068864_1007129922 | 281 |
| 82 | 3300005834 | Ga0068851_10004272 | Ga0068851_100042722 | 281 |
| 83 | 3300005842 | Ga0068858_100293788 | Ga0068858_1002937882 | 281 |
| 84 | 3300005843 | Ga0068860_100144236 | Ga0068860_1001442362 | 281 |
| 85 | 3300005981 | Ga0081538_10034813 | Ga0081538_100348132 | 281 |
| 86 | 3300005983 | Ga0081540_1017195 | Ga0081540_10171953 | 281 |
| 87 | 3300006038 | Ga0075365_10075088 | Ga0075365_100750882 | 281 |
| 88 | 3300006038 | Ga0075365_10149439 | Ga0075365_101494392 | 281 |
| 89 | 3300006038 | Ga0075365_10180139 | Ga0075365_101801392 | 281 |
| 90 | 3300006051 | Ga0075364_10122667 | Ga0075364_101226672 | 281 |
| 91 | 3300006177 | Ga0075362_10022802 | Ga0075362_100228022 | 281 |
| 92 | 3300006178 | Ga0075367_10000988 | Ga0075367_100009884 | 281 |
| 93 | 3300006186 | Ga0075369_10008785 | Ga0075369_100087854 | 281 |
| 94 | 3300006186 | Ga0075369_10024805 | Ga0075369_100248052 | 281 |
| 95 | 3300006353 | Ga0075370_10213127 | Ga0075370_102131272 | 281 |
| 96 | 3300006358 | Ga0068871_100376650 | Ga0068871_1003766502 | 281 |
| 97 | 3300006844 | Ga0075428_100079146 | Ga0075428_1000791463 | 281 |
| 98 | 3300006931 | Ga0097620_100171379 | Ga0097620_1001713793 | 281 |
| 99 | 3300007788 | Ga0099795_10028929 | Ga0099795_100289291 | 281 |
| 100 | 3300009093 | Ga0105240_10540784 | Ga0105240_105407842 | 281 |
| 101 | 3300009147 | Ga0114129_10111337 | Ga0114129_101113371 | 281 |
| 102 | 3300009174 | Ga0105241_10032147 | Ga0105241_100321472 | 281 |
| 103 | 3300009177 | Ga0105248_10340617 | Ga0105248_103406172 | 281 |
| 104 | 3300009545 | Ga0105237_10216485 | Ga0105237_102164851 | 281 |
| 105 | 3300009551 | Ga0105238_10596953 | Ga0105238_105969532 | 281 |
| 106 | 3300009551 | Ga0105238_10698344 | Ga0105238_106983442 | 281 |
| 107 | 3300009553 | Ga0105249_10578209 | Ga0105249_105782092 | 281 |
| 108 | 3300010159 | Ga0099796_10021898 | Ga0099796_100218982 | 281 |
| 109 | 3300010375 | Ga0105239_10231697 | Ga0105239_102316972 | 281 |
| 110 | 3300010375 | Ga0105239_10336744 | Ga0105239_103367442 | 281 |
| 111 | 3300010375 | Ga0105239_10340438 | Ga0105239_103404382 | 281 |
| 112 | 3300011119 | Ga0105246_10160772 | Ga0105246_101607722 | 281 |
| 113 | 3300011119 | Ga0105246_10351569 | Ga0105246_103515691 | 281 |
| 114 | 3300013105 | Ga0157369_10006547 | Ga0157369_100065472 | 281 |
| 115 | 3300013297 | Ga0157378_10205993 | Ga0157378_102059933 | 281 |
| 116 | 3300013306 | Ga0163162_10217372 | Ga0163162_102173722 | 281 |
| 117 | 3300013306 | Ga0163162_10437901 | Ga0163162_104379012 | 281 |
| 118 | 3300013308 | Ga0157375_10300634 | Ga0157375_103006342 | 281 |
| 119 | 3300014326 | Ga0157380_10329795 | Ga0157380_103297952 | 281 |
| 120 | 3300014968 | Ga0157379_10383594 | Ga0157379_103835941 | 281 |
| 121 | 3300014969 | Ga0157376_10187855 | Ga0157376_101878552 | 281 |
| 122 | 3300017792 | Ga0163161_10207570 | Ga0163161_102075702 | 281 |
| 123 | 3300025295 | Ga0209564_1011501 | Ga0209564_10115012 | 281 |
| 124 | 3300025297 | Ga0209758_1004785 | Ga0209758_10047853 | 281 |
| 125 | 3300025900 | Ga0207710_10164087 | Ga0207710_101640872 | 281 |
| 126 | 3300025906 | Ga0207699_10004016 | Ga0207699_100040161 | 281 |
| 127 | 3300025911 | Ga0207654_10026739 | Ga0207654_100267393 | 281 |
| 128 | 3300025912 | Ga0207707_10000359 | Ga0207707_1000035944 | 281 |
| 129 | 3300025912 | Ga0207707_10154833 | Ga0207707_101548332 | 281 |
| 130 | 3300025912 | Ga0207707_10277057 | Ga0207707_102770572 | 281 |
| 131 | 3300025915 | Ga0207693_10013028 | Ga0207693_100130286 | 281 |
| 132 | 3300025915 | Ga0207693_10022195 | Ga0207693_100221955 | 281 |
| 133 | 3300025917 | Ga0207660_10027186 | Ga0207660_100271863 | 281 |
| 134 | 3300025918 | Ga0207662_10243303 | Ga0207662_102433033 | 281 |
| 135 | 3300025919 | Ga0207657_10461258 | Ga0207657_104612581 | 281 |
| 136 | 3300025921 | Ga0207652_10003470 | Ga0207652_100034702 | 281 |
| 137 | 3300025921 | Ga0207652_10281063 | Ga0207652_102810632 | 281 |
| 138 | 3300025949 | Ga0207667_10162547 | Ga0207667_101625472 | 281 |
| 139 | 3300025972 | Ga0207668_10124223 | Ga0207668_101242232 | 281 |
| 140 | 3300026023 | Ga0207677_10031837 | Ga0207677_100318372 | 281 |
| 141 | 3300026035 | Ga0207703_10341013 | Ga0207703_103410132 | 281 |
| 142 | 3300026035 | Ga0207703_10450402 | Ga0207703_104504022 | 281 |
| 143 | 3300026067 | Ga0207678_10035639 | Ga0207678_100356393 | 281 |
| 144 | 3300026067 | Ga0207678_10212644 | Ga0207678_102126442 | 281 |
| 145 | 3300026089 | Ga0207648_10266565 | Ga0207648_102665652 | 281 |
| 146 | 3300026121 | Ga0207683_10084701 | Ga0207683_100847013 | 281 |
| 147 | 3300026121 | Ga0207683_10115071 | Ga0207683_101150712 | 281 |
| 148 | 3300026121 | Ga0207683_10369881 | Ga0207683_103698811 | 281 |
| 149 | 3300026142 | Ga0207698_10350160 | Ga0207698_103501602 | 281 |
| 150 | 3300028379 | Ga0268266_10002394 | Ga0268266_100023943 | 281 |
| 151 | 3300028379 | Ga0268266_10003934 | Ga0268266_100039348 | 281 |
| 152 | 3300028379 | Ga0268266_10027683 | Ga0268266_100276832 | 281 |
| 153 | 3300028381 | Ga0268264_10027494 | Ga0268264_100274942 | 281 |
| 154 | 3300028794 | Ga0307515_10212609 | Ga0307515_102126092 | 281 |
| 155 | 3300031507 | Ga0307509_10180532 | Ga0307509_101805322 | 281 |
| 156 | 3300031548 | Ga0307408_100277295 | Ga0307408_1002772952 | 281 |
| 157 | 3300031616 | Ga0307508_10156701 | Ga0307508_101567012 | 281 |
| 158 | 3300031901 | Ga0307406_10213629 | Ga0307406_102136292 | 281 |
| 159 | 3300031911 | Ga0307412_10082860 | Ga0307412_100828601 | 281 |
| 160 | 3300032002 | Ga0307416_100328820 | Ga0307416_1003288201 | 281 |
| 161 | 3300032004 | Ga0307414_10168155 | Ga0307414_101681551 | 281 |
| 162 | 3300033180 | Ga0307510_10001061 | Ga0307510_100010619 | 281 |
| 163 | 3300033544 | Ga0316215_1004201 | Ga0316215_10042012 | 281 |
| 164 | 3300035083 | Ga0373926_0072562 | Ga0373926_0072562_346_1209 | 281 |
| 165 | 3300035086 | Ga0373934_0014895 | Ga0373934_0014895_123_974 | 281 |
| 166 | 3300035111 | Ga0373923_0003551 | Ga0373923_0003551_1923_2774 | 281 |
| 167 | 3300035117 | Ga0373953_0007452 | Ga0373953_0007452_882_1733 | 281 |
| 168 | 3300035170 | Ga0373943_0026933 | Ga0373943_0026933_1755_2606 | 281 |
| 169 | 3300035170 | Ga0373943_0097811 | Ga0373943_0097811_629_1477 | 281 |
| 170 | 3300035410 | Ga0373924_0101645 | Ga0373924_0101645_41_892 | 281 |
| 171 | 3300035692 | Ga0373935_0129963 | Ga0373935_0129963_259_1110 | 281 |
| 172 | 3300035692 | Ga0373935_0173522 | Ga0373935_0173522_317_1174 | 281 |
| 173 | 3300035695 | Ga0373927_0093885 | Ga0373927_0093885_309_1154 | 281 |
| 174 | 3300035695 | Ga0373927_0147657 | Ga0373927_0147657_642_1493 | 281 |
| 175 | 3300035724 | Ga0373933_0006955 | Ga0373933_0006955_4941_5792 | 281 |
| 176 | 3300035725 | Ga0373947_0025405 | Ga0373947_0025405_2023_2874 | 281 |
| 177 | 3300035725 | Ga0373947_0198925 | Ga0373947_0198925_247_1104 | 281 |
| 178 | 3300037068 | Ga0373925_0112208 | Ga0373925_0112208_982_1833 | 281 |
| 179 | 3300041456 | Ga0451795_0309788 | Ga0451795_0309788_65_916 | 281 |
| 180 | 3300044842 | Ga0466957_0155221 | Ga0466957_0155221_19_870 | 281 |
| 181 | 3300045049 | Ga0466959_0047117 | Ga0466959_0047117_29_880 | 281 |
| 182 | 3300046455 | Ga0495603_0004410 | Ga0495603_0004410_346_1191 | 281 |
| 183 | 3300046455 | Ga0495603_0104863 | Ga0495603_0104863_778_1623 | 281 |
| 184 | 3300046459 | Ga0495629_0080943 | Ga0495629_0080943_259_1110 | 281 |
| 185 | 3300046460 | Ga0495638_0000646 | Ga0495638_0000646_5080_5928 | 281 |
| 186 | 3300046461 | Ga0495641_0022963 | Ga0495641_0022963_2239_3084 | 281 |
| 187 | 3300046472 | Ga0495580_0006636 | Ga0495580_0006636_2154_3005 | 281 |
| 188 | 3300046476 | Ga0495662_0028790 | Ga0495662_0028790_670_1521 | 281 |
| 189 | 3300046477 | Ga0495664_0090586 | Ga0495664_0090586_414_1265 | 281 |
| 190 | 3300046507 | Ga0495606_0064798 | Ga0495606_0064798_948_1796 | 281 |
| 191 | 3300046513 | Ga0495616_0053672 | Ga0495616_0053672_183_1028 | 281 |
| 192 | 3300046514 | Ga0495618_0028419 | Ga0495618_0028419_1331_2182 | 281 |
| 193 | 3300046515 | Ga0495620_0037103 | Ga0495620_0037103_1031_1879 | 281 |
| 194 | 3300046516 | Ga0495628_0087625 | Ga0495628_0087625_219_1070 | 281 |
| 195 | 3300046517 | Ga0495630_0008895 | Ga0495630_0008895_3641_4492 | 281 |
| 196 | 3300046518 | Ga0495631_0121508 | Ga0495631_0121508_76_924 | 281 |
| 197 | 3300046522 | Ga0495643_0088896 | Ga0495643_0088896_245_1093 | 281 |
| 198 | 3300046530 | Ga0495654_0020090 | Ga0495654_0020090_2585_3433 | 281 |
| 199 | 3300046533 | Ga0495640_0142508 | Ga0495640_0142508_39_890 | 281 |
| 200 | 3300046542 | Ga0495597_0118696 | Ga0495597_0118696_130_975 | 281 |
| 201 | 3300046642 | Ga0495634_0138428 | Ga0495634_0138428_681_1532 | 281 |
| 202 | 3300046660 | Ga0495625_0142375 | Ga0495625_0142375_111_956 | 281 |
| 203 | 3300046663 | Ga0495635_0055245 | Ga0495635_0055245_1147_1998 | 281 |
| 204 | 3300046665 | Ga0495661_0056820 | Ga0495661_0056820_1434_2282 | 281 |
| 205 | 3300046674 | Ga0495588_0093296 | Ga0495588_0093296_290_1141 | 281 |
| 206 | 3300046678 | Ga0495599_0124582 | Ga0495599_0124582_213_1091 | 281 |
| 207 | 3300046680 | Ga0495646_0038325 | Ga0495646_0038325_1615_2466 | 281 |
| 208 | 3300046681 | Ga0495647_0005841 | Ga0495647_0005841_147_998 | 281 |
| 209 | 3300046683 | Ga0495658_0003337 | Ga0495658_0003337_3342_4193 | 281 |
| 210 | 3300046690 | Ga0495624_0098752 | Ga0495624_0098752_117_974 | 281 |
| 211 | 3300046690 | Ga0495624_0131199 | Ga0495624_0131199_525_1376 | 281 |
| 212 | 3300046691 | Ga0495670_0004878 | Ga0495670_0004878_2441_3289 | 281 |
| 213 | 3300046810 | Ga0495660_0073830 | Ga0495660_0073830_768_1616 | 281 |
| 214 | 3300047317 | Ga0495604_0054391 | Ga0495604_0054391_1327_2178 | 281 |
| 215 | 3300047319 | Ga0495674_0003465 | Ga0495674_0003465_3788_4639 | 281 |
| 216 | 3300047319 | Ga0495674_0291603 | Ga0495674_0291603_299_1147 | 281 |
| 217 | 3300047471 | Ga0495684_0061283 | Ga0495684_0061283_747_1598 | 281 |
| 218 | 3300047673 | Ga0495593_0067345 | Ga0495593_0067345_769_1620 | 281 |
| 219 | 3300048904 | Ga0496101_0090807 | Ga0496101_0090807_470_1330 | 281 |
| 220 | 3300048905 | Ga0496102_0475059 | Ga0496102_0475059_111_956 | 281 |
| 221 | 3300048907 | Ga0496104_0205595 | Ga0496104_0205595_723_1568 | 281 |
| 222 | 3300048907 | Ga0496104_0213858 | Ga0496104_0213858_170_1018 | 281 |
| 223 | 3300048908 | Ga0496105_0031745 | Ga0496105_0031745_209_1057 | 281 |
| 224 | 3300048911 | Ga0496108_0050214 | Ga0496108_0050214_1107_1985 | 281 |
| 225 | 3300048911 | Ga0496108_0200664 | Ga0496108_0200664_867_1718 | 281 |
| 226 | 3300048915 | Ga0496112_0235335 | Ga0496112_0235335_536_1408 | 281 |
| 227 | 3300048918 | Ga0496115_0458962 | Ga0496115_0458962_97_942 | 281 |
| 228 | 3300048919 | Ga0496116_0006031 | Ga0496116_0006031_5665_6513 | 281 |
| 229 | 3300048920 | Ga0496117_0046908 | Ga0496117_0046908_61_909 | 281 |
| 230 | 3300048920 | Ga0496117_0058063 | Ga0496117_0058063_1136_1984 | 281 |
| 231 | 3300048921 | Ga0496118_0049440 | Ga0496118_0049440_2125_2973 | 281 |
| 232 | 3300048921 | Ga0496118_0063583 | Ga0496118_0063583_724_1572 | 281 |
| 233 | 3300048922 | Ga0496119_0153610 | Ga0496119_0153610_236_1084 | 281 |
| 234 | 3300048923 | Ga0496120_0065204 | Ga0496120_0065204_910_1761 | 281 |
| 235 | 3300048924 | Ga0496121_0006633 | Ga0496121_0006633_6201_7049 | 281 |
| 236 | 3300048925 | Ga0496122_0010744 | Ga0496122_0010744_3095_3943 | 281 |
| 237 | 3300048925 | Ga0496122_0152469 | Ga0496122_0152469_95_943 | 281 |
| 238 | 3300048925 | Ga0496122_0274871 | Ga0496122_0274871_61_909 | 281 |
| 239 | 3300048926 | Ga0496123_0036404 | Ga0496123_0036404_2478_3326 | 281 |
| 240 | 3300048926 | Ga0496123_0158828 | Ga0496123_0158828_71_919 | 281 |
| 241 | 3300048927 | Ga0496124_0181898 | Ga0496124_0181898_513_1364 | 281 |
| 242 | 3300048927 | Ga0496124_0300869 | Ga0496124_0300869_35_883 | 281 |
| 243 | 3300048928 | Ga0496125_0025922 | Ga0496125_0025922_3634_4482 | 281 |
| 244 | 3300048928 | Ga0496125_0065181 | Ga0496125_0065181_536_1384 | 281 |
| 245 | 3300048928 | Ga0496125_0239608 | Ga0496125_0239608_294_1139 | 281 |
| 246 | 3300048929 | Ga0496126_0139555 | Ga0496126_0139555_379_1227 | 281 |
| 247 | 3300049583 | Ga0501067_0055938 | Ga0501067_0055938_206_1051 | 281 |
| 248 | 3300050490 | nmdc:mga03n38_53870_c1 | nmdc:mga03n38_53870_c1_582_1427 | 281 |
| 249 | 3300050491 | nmdc:mga00v17_233909_c1 | nmdc:mga00v17_233909_c1_113_961 | 281 |
| 250 | 3300050491 | nmdc:mga00v17_27373_c1 | nmdc:mga00v17_27373_c1_84_932 | 281 |
| 251 | 3300050491 | nmdc:mga00v17_299687_c1 | nmdc:mga00v17_299687_c1_161_1006 | 281 |
| 252 | 3300050492 | nmdc:mga0yw44_21367_c1 | nmdc:mga0yw44_21367_c1_2281_3126 | 281 |
| 253 | 3300050492 | nmdc:mga0yw44_27119_c1 | nmdc:mga0yw44_27119_c1_310_1158 | 281 |
| 254 | 3300050492 | nmdc:mga0yw44_56798_c1 | nmdc:mga0yw44_56798_c1_146_994 | 281 |
| 255 | 3300050492 | nmdc:mga0yw44_6339_c1 | nmdc:mga0yw44_6339_c1_2608_3456 | 281 |
| 256 | 3300050494 | nmdc:mga06z11_192512_c1 | nmdc:mga06z11_192512_c1_257_1108 | 281 |
| 257 | 3300050494 | nmdc:mga06z11_30436_c1 | nmdc:mga06z11_30436_c1_1705_2553 | 281 |
| 258 | 3300050494 | nmdc:mga06z11_59313_c1 | nmdc:mga06z11_59313_c1_975_1820 | 281 |
| 259 | 3300050496 | nmdc:mga07m45_118817_c1 | nmdc:mga07m45_118817_c1_463_1308 | 281 |
| 260 | 3300050496 | nmdc:mga07m45_13999_c1 | nmdc:mga07m45_13999_c1_1864_2709 | 281 |
| 261 | 3300050516 | nmdc:mga0sz30_3474_c2 | nmdc:mga0sz30_3474_c2_1203_2051 | 281 |
| 262 | 3300053077 | Ga0495601_0051270 | Ga0495601_0051270_233_1084 | 281 |
| 263 | 3300053077 | Ga0495601_0074759 | Ga0495601_0074759_523_1401 | 281 |
| 264 | 3300053077 | Ga0495601_0102972 | Ga0495601_0102972_345_1193 | 281 |
| 265 | 3300053084 | Ga0495595_0107943 | Ga0495595_0107943_475_1326 | 281 |
| 266 | 3300053087 | Ga0500643_017749 | Ga0500643_017749_267_1115 | 281 |
| 267 | 3300053088 | Ga0500644_0043361 | Ga0500644_0043361_500_1348 | 281 |
| 268 | 3300053089 | Ga0500581_064362 | Ga0500581_064362_831_1679 | 281 |
| 269 | 3300053092 | Ga0500583_0047342 | Ga0500583_0047342_215_1066 | 281 |
| 270 | 3300053093 | Ga0500651_0046532 | Ga0500651_0046532_1160_2008 | 281 |
| 271 | 3300053098 | Ga0500650_0000157 | Ga0500650_0000157_1264_2112 | 281 |
| 272 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_381764_382612 | 281 |
| 273 | 3300053109 | Ga0500569_022573 | Ga0500569_022573_188_1036 | 281 |
| 274 | 3300053116 | Ga0500592_003596 | Ga0500592_003596_511_1359 | 281 |
| 275 | 3300053118 | Ga0500594_0011276 | Ga0500594_0011276_1120_1968 | 281 |
| 276 | 3300053131 | Ga0500652_000564 | Ga0500652_000564_10013_10861 | 281 |
| 277 | 3300053134 | Ga0500658_0006618 | Ga0500658_0006618_734_1582 | 281 |
| 278 | 3300053136 | Ga0500559_0208071 | Ga0500559_0208071_17_868 | 281 |
| 279 | 3300053139 | Ga0500568_0008323 | Ga0500568_0008323_1077_1925 | 281 |
| 280 | 3300053151 | Ga0500604_0000635 | Ga0500604_0000635_4479_5327 | 281 |
| 281 | 3300053156 | Ga0500622_0000518 | Ga0500622_0000518_29422_30270 | 281 |
| 282 | 3300053161 | Ga0500634_0192661 | Ga0500634_0192661_30_878 | 281 |
| 283 | 3300053731 | Ga0500609_004529 | Ga0500609_004529_813_1658 | 281 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7an6-assembly1.cif.gz_B | enzyme of biosynthetic pathway | 0.607 | 1 | 272 |
| 7an5-assembly1.cif.gz_A | enzyme of biosynthetic pathway | 0.6049 | 1 | 272 |
| 7an7-assembly1.cif.gz_A | enzyme of biosynthetic pathway | 0.6041 | 1 | 272 |
| 7an8-assembly1.cif.gz_B | enzyme of biosynthetic pathway | 0.6014 | 1 | 272 |
| 7ahr-assembly1.cif.gz_A | enzyme of biosynthetic pathway | 0.5995 | 1 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v25B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7163 | 82 | 186 | 3.40.190.10 |
| 2x7qA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7105 | 1 | 75 | 3.40.190.10 |
| 3uifA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6793 | 83 | 184 | 3.40.190.10 |
| af_O33182_88_189_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6729 | 83 | 171 | 3.40.190.10 |
| 1zbmA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6676 | 82 | 197 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R3LRR7-F1-model_v4 | SsuA/THI5-like domain-containing protein | 0.9344 | 1 | 281 |
|
| AF-A0A537Q7F1-F1-model_v4 | SsuA/THI5-like domain-containing protein | 0.9329 | 1 | 280 |
|
| AF-A0A537Q7F1-F1-model_v4 | SsuA/THI5-like domain-containing protein | 0.9266 | 1 | 280 |
|
| AF-A0A7X0FDV8-F1-model_v4 | 4,5-dihydroxyphthalate decarboxylase (EC 4.1.1.55) | 0.9224 | 2 | 277 |
GO:0018796
|
| AF-A0A3D9RB72-F1-model_v4 | deleted | 0.9148 | 1 | 277 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar