F385557

General Info

Members Datasets Scaffolds Average Seq Length
283 153 282 272

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10002914|Ga0157370_1000291414
Length 283
Sequence MKEVEMSDVRSQDAPTARQEDRKDPNPTGDFIWYELMTSDADAAKEFYDAVAGWNIGEGAPEFGGYRMIGRNDGGFAGGILPLTPEMKEHGAHPTWLGYVHVADVDQAVAAIERAGGKALMTADIPNVGRIAMVTDPQGAPFYVMKPIPPAGDPNAKSDVFDTKAEQRCGWNELSTSDPTAARGFYGEQFGWASEQFMPMGEHGEYRFFEQNGVTIGAVAKTMDGARPHWRYYFRVPSIASAKEIVEAKGGKIAVGPMEVPGGDHIIIGFDPQGAEFALVGGQ

Samples

Sample ID Description Type Environment
1 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
136 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
137 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
138 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
142 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 3.18
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 3.18
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001053 3300001976 Bacteria 3759
2 JGI24735J21928_10021250 3300002067 Bacteria 1982
3 Ga0070658_10003956 3300005327 Bacteria 12146
4 Ga0070658_10537240 3300005327 Bacteria 1011
5 Ga0070658_10722684 3300005327 Bacteria 865
6 Ga0070676_10222971 3300005328 Bacteria 1246
7 Ga0070683_100471406 3300005329 Bacteria 1199
8 Ga0070670_100016526 3300005331 Bacteria 6334
9 Ga0070666_10000111 3300005335 Bacteria 56117
10 Ga0070680_100000197 3300005336 Bacteria 39326
11 Ga0070680_100000883 3300005336 Bacteria 21248
12 Ga0070680_100050052 3300005336 Bacteria 3407
13 Ga0070680_100141303 3300005336 Bacteria 2019
14 Ga0070660_100085239 3300005339 Bacteria 2484
15 Ga0070660_100313498 3300005339 Bacteria 1287
16 Ga0070660_100567417 3300005339 Unclassified 947
17 Ga0070687_100417533 3300005343 Bacteria 884
18 Ga0070661_100025883 3300005344 Bacteria 4217
19 Ga0070661_100049631 3300005344 Bacteria 3072
20 Ga0070661_100212846 3300005344 Bacteria 1480
21 Ga0070669_100000012 3300005353 Bacteria 211302
22 Ga0070669_100184210 3300005353 Bacteria 1635
23 Ga0070675_100041860 3300005354 Bacteria 3742
24 Ga0070675_100254544 3300005354 Bacteria 1538
25 Ga0070671_100000019 3300005355 Bacteria 132341
26 Ga0070671_100164963 3300005355 Bacteria 1873
27 Ga0070659_100042866 3300005366 Bacteria 3538
28 Ga0070659_100087063 3300005366 Bacteria 2500
29 Ga0070659_100094100 3300005366 Bacteria 2406
30 Ga0070659_100116053 3300005366 Bacteria 2164
31 Ga0070659_100184133 3300005366 Bacteria 1715
32 Ga0070659_100269001 3300005366 Bacteria 1416
33 Ga0070667_100134463 3300005367 Bacteria 2161
34 Ga0070667_100412270 3300005367 Bacteria 1231
35 Ga0070705_100004405 3300005440 Bacteria 6859
36 Ga0070708_100072367 3300005445 Bacteria 3106
37 Ga0070663_100096243 3300005455 Bacteria 2202
38 Ga0070662_100098768 3300005457 Bacteria 2206
39 Ga0070681_10089014 3300005458 Bacteria 3038
40 Ga0070681_10169452 3300005458 Bacteria 2105
41 Ga0070679_100099396 3300005530 Bacteria 2897
42 Ga0070679_100125827 3300005530 Bacteria 2545
43 Ga0070679_100169006 3300005530 Bacteria 2159
44 Ga0070679_100325288 3300005530 Bacteria 1486
45 Ga0068853_100059068 3300005539 Bacteria 3312
46 Ga0068853_100187589 3300005539 Bacteria 1877
47 Ga0070672_100460585 3300005543 Bacteria 1096
48 Ga0070665_100167084 3300005548 Bacteria 2202
49 Ga0070665_100208268 3300005548 Bacteria 1956
50 Ga0068855_100025103 3300005563 Bacteria 7135
51 Ga0068855_100103048 3300005563 Bacteria 3284
52 Ga0068855_100105980 3300005563 Bacteria 3231
53 Ga0068855_100189224 3300005563 Bacteria 2323
54 Ga0068855_100223632 3300005563 Bacteria 2110
55 Ga0068855_100432691 3300005563 Bacteria 1438
56 Ga0070664_100129891 3300005564 Bacteria 2212
57 Ga0068857_100038795 3300005577 Bacteria 4217
58 Ga0068857_100062708 3300005577 Bacteria 3305
59 Ga0068854_100210955 3300005578 Bacteria 1532
60 Ga0068856_100068135 3300005614 Bacteria 3517
61 Ga0068852_100000335 3300005616 Bacteria 31883
62 Ga0068852_100039330 3300005616 Bacteria 3982
63 Ga0068852_100120223 3300005616 Bacteria 2403
64 Ga0068859_100000779 3300005617 Bacteria 32219
65 Ga0068859_100038532 3300005617 Bacteria 4795
66 Ga0068864_100000475 3300005618 Bacteria 34778
67 Ga0068864_100050171 3300005618 Bacteria 3591
68 Ga0068861_100002169 3300005719 Bacteria 12735
69 Ga0068863_100005824 3300005841 Bacteria 12076
70 Ga0068863_100111732 3300005841 Bacteria 2602
71 Ga0068860_100119685 3300005843 Bacteria 2521
72 Ga0068862_100000884 3300005844 Bacteria 29162
73 Ga0070712_100116958 3300006175 Bacteria 2000
74 Ga0068871_100440827 3300006358 Unclassified 1166
75 Ga0097620_100000779 3300006931 Bacteria 32219
76 Ga0097620_100038532 3300006931 Bacteria 4795
77 Ga0105251_10015937 3300009011 Bacteria 4086
78 Ga0105251_10039456 3300009011 Bacteria 2307
79 Ga0105247_10004441 3300009101 Bacteria 8942
80 Ga0105243_10122307 3300009148 Bacteria 2196
81 Ga0105248_10096452 3300009177 Bacteria 3331
82 Ga0105238_10043173 3300009551 Bacteria 4563
83 Ga0105249_10000553 3300009553 Bacteria 34593
84 Ga0105249_10308966 3300009553 Bacteria 1589
85 Ga0105246_10074392 3300011119 Bacteria 2401
86 Ga0157373_10104524 3300013100 Bacteria 1992
87 Ga0157373_10173654 3300013100 Bacteria 1516
88 Ga0157373_10181022 3300013100 Bacteria 1484
89 Ga0157373_10279572 3300013100 Bacteria 1183
90 Ga0157371_10034950 3300013102 Bacteria 3604
91 Ga0157371_10071437 3300013102 Bacteria 2457
92 Ga0157371_10140807 3300013102 Bacteria 1718
93 Ga0157370_10002914 3300013104 Bacteria 20381
94 Ga0157370_10031809 3300013104 Bacteria 5158
95 Ga0157369_10046960 3300013105 Bacteria 4691
96 Ga0157369_10061152 3300013105 Bacteria 4061
97 Ga0157369_10078998 3300013105 Bacteria 3524
98 Ga0157374_10003921 3300013296 Bacteria 12501
99 Ga0157374_10141684 3300013296 Bacteria 2334
100 Ga0163162_10031798 3300013306 Bacteria 5237
101 Ga0157372_10108758 3300013307 Bacteria 3174
102 Ga0157372_10153711 3300013307 Bacteria 2657
103 Ga0163163_10108426 3300014325 Bacteria 2804
104 Ga0163163_10148116 3300014325 Unclassified 2391
105 Ga0157380_10047344 3300014326 Bacteria 3382
106 Ga0182008_10043662 3300014497 Bacteria 2231
107 Ga0157379_10001174 3300014968 Bacteria 21344
108 Ga0157379_10057679 3300014968 Bacteria 3470
109 Ga0157379_10059760 3300014968 Bacteria 3409
110 Ga0206353_11737401 3300020082 Bacteria 2476
111 Ga0207697_10000003 3300025315 Bacteria 90538
112 Ga0207697_10028036 3300025315 Bacteria 2302
113 Ga0207710_10014089 3300025900 Bacteria 3368
114 Ga0207688_10088548 3300025901 Bacteria 1776
115 Ga0207680_10000142 3300025903 Bacteria 34278
116 Ga0207647_10096186 3300025904 Bacteria 1763
117 Ga0207705_10012840 3300025909 Bacteria 6047
118 Ga0207705_10024261 3300025909 Bacteria 4329
119 Ga0207705_10042473 3300025909 Bacteria 3264
120 Ga0207705_10057055 3300025909 Bacteria 2816
121 Ga0207705_10096402 3300025909 Bacteria 2171
122 Ga0207705_10284034 3300025909 Bacteria 1267
123 Ga0207707_10124753 3300025912 Bacteria 2252
124 Ga0207707_10152769 3300025912 Bacteria 2018
125 Ga0207707_10288936 3300025912 Bacteria 1419
126 Ga0207660_10001245 3300025917 Bacteria 17060
127 Ga0207660_10358682 3300025917 Bacteria 1169
128 Ga0207662_10388224 3300025918 Unclassified 944
129 Ga0207657_10091566 3300025919 Bacteria 2535
130 Ga0207657_10116073 3300025919 Bacteria 2206
131 Ga0207657_10160434 3300025919 Bacteria 1826
132 Ga0207657_10178880 3300025919 Bacteria 1715
133 Ga0207649_10040348 3300025920 Bacteria 2836
134 Ga0207649_10044088 3300025920 Bacteria 2730
135 Ga0207649_10075265 3300025920 Bacteria 2169
136 Ga0207649_10151972 3300025920 Bacteria 1595
137 Ga0207652_10082764 3300025921 Bacteria 2809
138 Ga0207652_10120245 3300025921 Bacteria 2336
139 Ga0207652_10180071 3300025921 Bacteria 1899
140 Ga0207681_10000004 3300025923 Bacteria 559005
141 Ga0207681_10061772 3300025923 Bacteria 2577
142 Ga0207694_10224855 3300025924 Bacteria 1532
143 Ga0207650_10005182 3300025925 Bacteria 8892
144 Ga0207659_10013351 3300025926 Bacteria 5256
145 Ga0207644_10000031 3300025931 Bacteria 134402
146 Ga0207690_10028246 3300025932 Bacteria 3554
147 Ga0207690_10186586 3300025932 Bacteria 1565
148 Ga0207690_10426539 3300025932 Bacteria 1062
149 Ga0207690_10593642 3300025932 Bacteria 903
150 Ga0207706_10023147 3300025933 Bacteria 5580
151 Ga0207706_10052604 3300025933 Bacteria 3595
152 Ga0207706_10137577 3300025933 Bacteria 2148
153 Ga0207669_10545490 3300025937 Bacteria 935
154 Ga0207667_10133852 3300025949 Bacteria 2553
155 Ga0207667_10249507 3300025949 Bacteria 1815
156 Ga0207667_10317150 3300025949 Bacteria 1592
157 Ga0207712_10088968 3300025961 Bacteria 2269
158 Ga0207668_10000135 3300025972 Bacteria 50909
159 Ga0207668_10127705 3300025972 Bacteria 1937
160 Ga0207640_10152885 3300025981 Bacteria 1698
161 Ga0207658_10003835 3300025986 Bacteria 10588
162 Ga0207658_10027084 3300025986 Bacteria 4025
163 Ga0207703_10482146 3300026035 Bacteria 1162
164 Ga0207639_10651771 3300026041 Unclassified 974
165 Ga0207678_10018808 3300026067 Bacteria 6068
166 Ga0207678_10139899 3300026067 Bacteria 2066
167 Ga0207678_10324562 3300026067 Bacteria 1325
168 Ga0207702_10044154 3300026078 Bacteria 3745
169 Ga0207641_10006924 3300026088 Bacteria 9488
170 Ga0207641_10179639 3300026088 Bacteria 1937
171 Ga0207676_10009376 3300026095 Bacteria 6966
172 Ga0207676_10423934 3300026095 Bacteria 1248
173 Ga0207674_10000859 3300026116 Bacteria 39717
174 Ga0207674_10077995 3300026116 Bacteria 3318
175 Ga0207675_100003319 3300026118 Bacteria 15755
176 Ga0207698_10006895 3300026142 Bacteria 7107
177 Ga0207698_10206355 3300026142 Bacteria 1764
178 Ga0207698_10214475 3300026142 Bacteria 1734
179 Ga0210002_1009230 3300027617 Bacteria 1506
180 Ga0209974_10074006 3300027876 Bacteria 1165
181 Ga0207428_10131285 3300027907 Bacteria 1916
182 Ga0268266_10125945 3300028379 Bacteria 2286
183 Ga0268265_10000525 3300028380 Bacteria 39061
184 Ga0268264_10000483 3300028381 Bacteria 52975
185 Ga0268264_10098861 3300028381 Bacteria 2531
186 Ga0307408_100020113 3300031548 Bacteria 4499
187 Ga0307412_10000615 3300031911 Bacteria 20954
188 Ga0307409_100010349 3300031995 Bacteria 5793
189 Ga0307414_10009548 3300032004 Bacteria 5580
190 Ga0307414_10305021 3300032004 Bacteria 1349
191 Ga0395899_0018077 3300037312 Bacteria 5365
192 Ga0395899_0106538 3300037312 Bacteria 2018
193 Ga0395899_0164124 3300037312 Bacteria 1567
194 Ga0395899_0260633 3300037312 Bacteria 1186
195 Ga0395900_0014503 3300037418 Bacteria 8041
196 Ga0395900_0018120 3300037418 Bacteria 7186
197 Ga0395900_0019494 3300037418 Bacteria 6915
198 Ga0395900_0035316 3300037418 Bacteria 5149
199 Ga0395900_0063753 3300037418 Bacteria 3788
200 Ga0395900_0067684 3300037418 Bacteria 3669
201 Ga0395900_0142279 3300037418 Bacteria 2455
202 Ga0395900_0168774 3300037418 Bacteria 2229
203 Ga0395900_0266778 3300037418 Bacteria 1708
204 Ga0395900_0292294 3300037418 Bacteria 1618
205 Ga0395900_0380769 3300037418 Bacteria 1379
206 Ga0395900_0594606 3300037418 Bacteria 1047
207 Ga0395898_0020718 3300037466 Bacteria 6675
208 Ga0395898_0041547 3300037466 Bacteria 4542
209 Ga0395898_0053527 3300037466 Bacteria 3942
210 Ga0395898_0145732 3300037466 Bacteria 2266
211 Ga0395898_0183373 3300037466 Bacteria 2000
212 Ga0395898_0235378 3300037466 Bacteria 1746
213 Ga0395898_0427305 3300037466 Bacteria 1262
214 Ga0395905_0008509 3300037471 Bacteria 10117
215 Ga0395905_0060318 3300037471 Bacteria 3547
216 Ga0395905_0110573 3300037471 Bacteria 2580
217 Ga0395905_0120139 3300037471 Bacteria 2470
218 Ga0395905_0131965 3300037471 Bacteria 2349
219 Ga0395905_0140265 3300037471 Bacteria 2274
220 Ga0395905_0160444 3300037471 Bacteria 2113
221 Ga0395905_0304775 3300037471 Bacteria 1481
222 Ga0395901_0000041 3300038443 Bacteria 202314
223 Ga0395901_0047215 3300038443 Bacteria 4471
224 Ga0395901_0084400 3300038443 Bacteria 3319
225 Ga0395901_0262156 3300038443 Bacteria 1798
226 Ga0395901_0289114 3300038443 Bacteria 1701
227 Ga0395901_0305093 3300038443 Bacteria 1650
228 Ga0466966_0113289 3300044684 Bacteria 1670
229 Ga0466961_0131784 3300044693 Bacteria 1567
230 Ga0466963_0027833 3300044694 Bacteria 3624
231 Ga0466963_0034780 3300044694 Bacteria 3280
232 Ga0466957_0235369 3300044842 Bacteria 1214
233 Ga0466958_0194306 3300045836 Bacteria 1290
234 Ga0466958_0244536 3300045836 Bacteria 1147
235 Ga0466967_0001609 3300045976 Bacteria 13321
236 Ga0466967_0128215 3300045976 Bacteria 2352
237 Ga0466967_0431801 3300045976 Bacteria 1285
238 Ga0466967_0454952 3300045976 Bacteria 1251
239 Ga0466967_0565243 3300045976 Bacteria 1120
240 Ga0466967_0576462 3300045976 Bacteria 1109
241 Ga0495638_0016458 3300046460 Bacteria 4953
242 Ga0495583_0000248 3300046506 Bacteria 89173
243 Ga0495606_0003536 3300046507 Bacteria 16520
244 Ga0495606_0141749 3300046507 Bacteria 1419
245 Ga0495661_0062122 3300046665 Bacteria 2214
246 Ga0495673_0006032 3300047469 Bacteria 7198
247 Ga0495686_0004350 3300047472 Bacteria 11698
248 Ga0495686_0006965 3300047472 Bacteria 8541
249 Ga0495686_0053879 3300047472 Bacteria 2520
250 Ga0496103_0052968 3300048906 Bacteria 2514
251 Ga0496106_0577090 3300048909 Unclassified 901
252 Ga0496107_0085495 3300048910 Bacteria 2301
253 Ga0496108_0054953 3300048911 Bacteria 3342
254 Ga0496109_0120934 3300048912 Bacteria 2439
255 Ga0496110_0062465 3300048913 Bacteria 3289
256 Ga0496111_0026747 3300048914 Bacteria 4075
257 Ga0496112_0052965 3300048915 Bacteria 3984
258 Ga0496113_0023595 3300048916 Bacteria 4362
259 Ga0496118_0035880 3300048921 Bacteria 4017
260 Ga0496124_0038521 3300048927 Bacteria 4151
261 Ga0496124_0159090 3300048927 Bacteria 1763
262 Ga0501034_0015586 3300049571 Bacteria 7807
263 Ga0501070_0112886 3300049586 Bacteria 2246
264 Ga0501198_011572 3300049649 Bacteria 1317
265 Ga0501223_000143 3300049663 Bacteria 19816
266 Ga0501224_000048 3300049664 Bacteria 18344
267 Ga0501233_000062 3300049668 Bacteria 14353
268 Ga0501235_002852 3300049669 Bacteria 3722
269 Ga0501225_0000210 3300049705 Bacteria 18362
270 Ga0501234_000021 3300049707 Bacteria 17010
271 Ga0501226_000105 3300049853 Bacteria 19836
272 Ga0500555_001303 3300053103 Bacteria 7904
273 Ga0500577_0014956 3300053142 Bacteria 2413
274 Ga0500616_0017363 3300053153 Bacteria 4082
275 Ga0587073_0020642 3300059492 Bacteria 1258
276 Ga0587077_013170 3300059493 Unclassified 1336
277 Ga0587090_009196 3300059510 Unclassified 1344
278 Ga0587091_009258 3300059511 Bacteria 1479
279 Ga0587106_006742 3300059605 Unclassified 1365
280 Ga0587128_006258 3300059630 Bacteria 1458
281 Ga0587075_002052 3300059644 Bacteria 2071
282 Ga0587071_005126 3300060344 Bacteria 1989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10088548 Ga0207688_100885481 217
2 3300037312 Ga0395899_0260633 Ga0395899_0260633_157_984 231
3 3300025937 Ga0207669_10545490 Ga0207669_105454901 241
4 3300037418 Ga0395900_0035316 Ga0395900_0035316_3881_4711 244
5 3300037471 Ga0395905_0008509 Ga0395905_0008509_2715_3545 244
6 3300038443 Ga0395901_0047215 Ga0395901_0047215_381_1211 244
7 3300047469 Ga0495673_0006032 Ga0495673_0006032_2969_3751 244
8 3300032004 Ga0307414_10305021 Ga0307414_103050212 246
9 3300005367 Ga0070667_100412270 Ga0070667_1004122702 247
10 3300014325 Ga0163163_10148116 Ga0163163_101481162 247
11 3300014968 Ga0157379_10057679 Ga0157379_100576793 247
12 3300005327 Ga0070658_10722684 Ga0070658_107226841 249
13 3300005336 Ga0070680_100000197 Ga0070680_10000019739 249
14 3300005344 Ga0070661_100025883 Ga0070661_1000258836 249
15 3300005366 Ga0070659_100087063 Ga0070659_1000870633 249
16 3300005367 Ga0070667_100134463 Ga0070667_1001344632 249
17 3300005457 Ga0070662_100098768 Ga0070662_1000987682 249
18 3300005563 Ga0068855_100103048 Ga0068855_1001030483 249
19 3300005563 Ga0068855_100105980 Ga0068855_1001059803 249
20 3300005563 Ga0068855_100223632 Ga0068855_1002236322 249
21 3300005563 Ga0068855_100432691 Ga0068855_1004326911 249
22 3300005564 Ga0070664_100129891 Ga0070664_1001298914 249
23 3300005577 Ga0068857_100038795 Ga0068857_1000387953 249
24 3300005616 Ga0068852_100039330 Ga0068852_1000393303 249
25 3300005617 Ga0068859_100038532 Ga0068859_1000385326 249
26 3300005618 Ga0068864_100050171 Ga0068864_1000501716 249
27 3300005841 Ga0068863_100111732 Ga0068863_1001117322 249
28 3300005843 Ga0068860_100119685 Ga0068860_1001196851 249
29 3300006931 Ga0097620_100038532 Ga0097620_1000385324 249
30 3300009011 Ga0105251_10015937 Ga0105251_100159374 249
31 3300011119 Ga0105246_10074392 Ga0105246_100743922 249
32 3300013104 Ga0157370_10002914 Ga0157370_1000291414 249
33 3300013105 Ga0157369_10046960 Ga0157369_100469605 249
34 3300013296 Ga0157374_10141684 Ga0157374_101416844 249
35 3300013307 Ga0157372_10153711 Ga0157372_101537113 249
36 3300014497 Ga0182008_10043662 Ga0182008_100436623 249
37 3300014968 Ga0157379_10059760 Ga0157379_100597604 249
38 3300025909 Ga0207705_10012840 Ga0207705_100128405 249
39 3300025909 Ga0207705_10284034 Ga0207705_102840341 249
40 3300025918 Ga0207662_10388224 Ga0207662_103882242 249
41 3300025920 Ga0207649_10044088 Ga0207649_100440882 249
42 3300025933 Ga0207706_10137577 Ga0207706_101375772 249
43 3300025949 Ga0207667_10133852 Ga0207667_101338523 249
44 3300025949 Ga0207667_10249507 Ga0207667_102495072 249
45 3300025949 Ga0207667_10317150 Ga0207667_103171502 249
46 3300025986 Ga0207658_10027084 Ga0207658_100270846 249
47 3300026035 Ga0207703_10482146 Ga0207703_104821462 249
48 3300026088 Ga0207641_10179639 Ga0207641_101796393 249
49 3300026095 Ga0207676_10423934 Ga0207676_104239342 249
50 3300026116 Ga0207674_10000859 Ga0207674_1000085919 249
51 3300026142 Ga0207698_10006895 Ga0207698_100068952 249
52 3300028381 Ga0268264_10098861 Ga0268264_100988611 249
53 3300037312 Ga0395899_0106538 Ga0395899_0106538_153_992 249
54 3300037418 Ga0395900_0014503 Ga0395900_0014503_6674_7510 249
55 3300037418 Ga0395900_0266778 Ga0395900_0266778_780_1619 249
56 3300037418 Ga0395900_0292294 Ga0395900_0292294_376_1203 249
57 3300037418 Ga0395900_0594606 Ga0395900_0594606_152_991 249
58 3300037466 Ga0395898_0183373 Ga0395898_0183373_1015_1851 249
59 3300037466 Ga0395898_0235378 Ga0395898_0235378_153_992 249
60 3300037471 Ga0395905_0120139 Ga0395905_0120139_1344_2174 249
61 3300037471 Ga0395905_0304775 Ga0395905_0304775_307_1146 249
62 3300038443 Ga0395901_0262156 Ga0395901_0262156_515_1354 249
63 3300044684 Ga0466966_0113289 Ga0466966_0113289_632_1471 249
64 3300044694 Ga0466963_0027833 Ga0466963_0027833_2456_3295 249
65 3300044842 Ga0466957_0235369 Ga0466957_0235369_211_1050 249
66 3300045976 Ga0466967_0454952 Ga0466967_0454952_106_942 249
67 3300046507 Ga0495606_0003536 Ga0495606_0003536_11196_11969 249
68 3300047472 Ga0495686_0006965 Ga0495686_0006965_4233_5006 249
69 3300048906 Ga0496103_0052968 Ga0496103_0052968_958_1785 249
70 3300048909 Ga0496106_0577090 Ga0496106_0577090_54_881 249
71 3300048910 Ga0496107_0085495 Ga0496107_0085495_465_1292 249
72 3300048911 Ga0496108_0054953 Ga0496108_0054953_666_1493 249
73 3300048912 Ga0496109_0120934 Ga0496109_0120934_22_849 249
74 3300048913 Ga0496110_0062465 Ga0496110_0062465_655_1482 249
75 3300048914 Ga0496111_0026747 Ga0496111_0026747_1012_1839 249
76 3300048915 Ga0496112_0052965 Ga0496112_0052965_2362_3189 249
77 3300048916 Ga0496113_0023595 Ga0496113_0023595_3140_3967 249
78 3300053142 Ga0500577_0014956 Ga0500577_0014956_604_1377 249
79 3300059493 Ga0587077_013170 Ga0587077_013170_404_1231 249
80 3300059510 Ga0587090_009196 Ga0587090_009196_61_888 249
81 3300059511 Ga0587091_009258 Ga0587091_009258_214_1041 249
82 3300059605 Ga0587106_006742 Ga0587106_006742_478_1305 249
83 3300059630 Ga0587128_006258 Ga0587128_006258_232_1059 249
84 3300059644 Ga0587075_002052 Ga0587075_002052_128_955 249
85 3300060344 Ga0587071_005126 Ga0587071_005126_110_937 249
86 3300005328 Ga0070676_10222971 Ga0070676_102229712 250
87 3300005329 Ga0070683_100471406 Ga0070683_1004714061 250
88 3300005336 Ga0070680_100050052 Ga0070680_1000500525 250
89 3300005339 Ga0070660_100085239 Ga0070660_1000852392 250
90 3300005339 Ga0070660_100313498 Ga0070660_1003134982 250
91 3300005344 Ga0070661_100049631 Ga0070661_1000496313 250
92 3300005344 Ga0070661_100212846 Ga0070661_1002128462 250
93 3300005353 Ga0070669_100184210 Ga0070669_1001842102 250
94 3300005354 Ga0070675_100041860 Ga0070675_1000418604 250
95 3300005354 Ga0070675_100254544 Ga0070675_1002545442 250
96 3300005355 Ga0070671_100164963 Ga0070671_1001649633 250
97 3300005366 Ga0070659_100042866 Ga0070659_1000428665 250
98 3300005366 Ga0070659_100116053 Ga0070659_1001160532 250
99 3300005366 Ga0070659_100184133 Ga0070659_1001841331 250
100 3300005366 Ga0070659_100269001 Ga0070659_1002690012 250
101 3300005458 Ga0070681_10169452 Ga0070681_101694523 250
102 3300005530 Ga0070679_100099396 Ga0070679_1000993962 250
103 3300005530 Ga0070679_100169006 Ga0070679_1001690062 250
104 3300005530 Ga0070679_100325288 Ga0070679_1003252882 250
105 3300005539 Ga0068853_100059068 Ga0068853_1000590683 250
106 3300005539 Ga0068853_100187589 Ga0068853_1001875892 250
107 3300005543 Ga0070672_100460585 Ga0070672_1004605851 250
108 3300005548 Ga0070665_100167084 Ga0070665_1001670841 250
109 3300005578 Ga0068854_100210955 Ga0068854_1002109552 250
110 3300005616 Ga0068852_100120223 Ga0068852_1001202233 250
111 3300006175 Ga0070712_100116958 Ga0070712_1001169581 250
112 3300006358 Ga0068871_100440827 Ga0068871_1004408272 250
113 3300009551 Ga0105238_10043173 Ga0105238_100431735 250
114 3300013100 Ga0157373_10173654 Ga0157373_101736542 250
115 3300013100 Ga0157373_10181022 Ga0157373_101810222 250
116 3300013100 Ga0157373_10279572 Ga0157373_102795722 250
117 3300013102 Ga0157371_10140807 Ga0157371_101408072 250
118 3300013104 Ga0157370_10031809 Ga0157370_100318097 250
119 3300025315 Ga0207697_10028036 Ga0207697_100280364 250
120 3300025909 Ga0207705_10024261 Ga0207705_100242615 250
121 3300025909 Ga0207705_10042473 Ga0207705_100424735 250
122 3300025912 Ga0207707_10152769 Ga0207707_101527692 250
123 3300025912 Ga0207707_10288936 Ga0207707_102889362 250
124 3300025919 Ga0207657_10091566 Ga0207657_100915662 250
125 3300025919 Ga0207657_10160434 Ga0207657_101604342 250
126 3300025919 Ga0207657_10178880 Ga0207657_101788802 250
127 3300025920 Ga0207649_10040348 Ga0207649_100403484 250
128 3300025920 Ga0207649_10075265 Ga0207649_100752652 250
129 3300025921 Ga0207652_10082764 Ga0207652_100827643 250
130 3300025921 Ga0207652_10120245 Ga0207652_101202452 250
131 3300025921 Ga0207652_10180071 Ga0207652_101800712 250
132 3300025923 Ga0207681_10061772 Ga0207681_100617722 250
133 3300025924 Ga0207694_10224855 Ga0207694_102248552 250
134 3300025926 Ga0207659_10013351 Ga0207659_100133513 250
135 3300025932 Ga0207690_10028246 Ga0207690_100282464 250
136 3300025932 Ga0207690_10186586 Ga0207690_101865862 250
137 3300025932 Ga0207690_10426539 Ga0207690_104265391 250
138 3300025932 Ga0207690_10593642 Ga0207690_105936421 250
139 3300025933 Ga0207706_10052604 Ga0207706_100526046 250
140 3300025981 Ga0207640_10152885 Ga0207640_101528852 250
141 3300026041 Ga0207639_10651771 Ga0207639_106517712 250
142 3300026067 Ga0207678_10139899 Ga0207678_101398992 250
143 3300026142 Ga0207698_10206355 Ga0207698_102063553 250
144 3300026142 Ga0207698_10214475 Ga0207698_102144753 250
145 3300037312 Ga0395899_0164124 Ga0395899_0164124_378_1211 250
146 3300037418 Ga0395900_0063753 Ga0395900_0063753_421_1263 250
147 3300037418 Ga0395900_0067684 Ga0395900_0067684_1811_2638 250
148 3300037418 Ga0395900_0168774 Ga0395900_0168774_617_1444 250
149 3300037418 Ga0395900_0380769 Ga0395900_0380769_518_1345 250
150 3300037466 Ga0395898_0041547 Ga0395898_0041547_2559_3386 250
151 3300037466 Ga0395898_0427305 Ga0395898_0427305_72_905 250
152 3300037471 Ga0395905_0131965 Ga0395905_0131965_520_1347 250
153 3300037471 Ga0395905_0140265 Ga0395905_0140265_817_1644 250
154 3300044693 Ga0466961_0131784 Ga0466961_0131784_201_1070 250
155 3300045976 Ga0466967_0001609 Ga0466967_0001609_11574_12413 250
156 3300045976 Ga0466967_0128215 Ga0466967_0128215_265_1104 250
157 3300045976 Ga0466967_0431801 Ga0466967_0431801_91_930 250
158 3300048927 Ga0496124_0038521 Ga0496124_0038521_1156_1932 250
159 3300049586 Ga0501070_0112886 Ga0501070_0112886_1365_2204 250
160 3300059492 Ga0587073_0020642 Ga0587073_0020642_297_1163 250
161 iso_pu_bacteria 2775506901 2776258768 250
162 3300005327 Ga0070658_10003956 Ga0070658_1000395615 251
163 3300037471 Ga0395905_0060318 Ga0395905_0060318_183_1025 251
164 3300046460 Ga0495638_0016458 Ga0495638_0016458_774_1553 251
165 3300046506 Ga0495583_0000248 Ga0495583_0000248_7440_8219 251
166 3300046507 Ga0495606_0141749 Ga0495606_0141749_149_928 251
167 3300046665 Ga0495661_0062122 Ga0495661_0062122_1317_2096 251
168 3300047472 Ga0495686_0004350 Ga0495686_0004350_7908_8687 251
169 3300047472 Ga0495686_0053879 Ga0495686_0053879_1226_2008 251
170 3300048921 Ga0496118_0035880 Ga0496118_0035880_623_1402 251
171 3300048927 Ga0496124_0159090 Ga0496124_0159090_339_1118 251
172 3300053103 Ga0500555_001303 Ga0500555_001303_5791_6570 251
173 3300053153 Ga0500616_0017363 Ga0500616_0017363_855_1634 251
174 3300002067 JGI24735J21928_10021250 JGI24735J21928_100212504 252
175 3300005327 Ga0070658_10537240 Ga0070658_105372401 252
176 3300005339 Ga0070660_100567417 Ga0070660_1005674171 252
177 3300005458 Ga0070681_10089014 Ga0070681_100890143 252
178 3300005530 Ga0070679_100125827 Ga0070679_1001258272 252
179 3300013102 Ga0157371_10071437 Ga0157371_100714372 252
180 3300013296 Ga0157374_10003921 Ga0157374_1000392113 252
181 3300025912 Ga0207707_10124753 Ga0207707_101247534 252
182 3300025920 Ga0207649_10151972 Ga0207649_101519721 252
183 3300025933 Ga0207706_10023147 Ga0207706_100231477 252
184 3300026067 Ga0207678_10018808 Ga0207678_100188086 252
185 3300031548 Ga0307408_100020113 Ga0307408_1000201137 252
186 3300031995 Ga0307409_100010349 Ga0307409_1000103494 252
187 3300037312 Ga0395899_0018077 Ga0395899_0018077_2128_2961 252
188 3300037418 Ga0395900_0019494 Ga0395900_0019494_3482_4315 252
189 3300037466 Ga0395898_0020718 Ga0395898_0020718_3638_4471 252
190 3300037471 Ga0395905_0110573 Ga0395905_0110573_1620_2453 252
191 3300038443 Ga0395901_0084400 Ga0395901_0084400_552_1385 252
192 3300005336 Ga0070680_100000883 Ga0070680_10000088316 254
193 3300005336 Ga0070680_100141303 Ga0070680_1001413032 254
194 3300005366 Ga0070659_100094100 Ga0070659_1000941003 254
195 3300005455 Ga0070663_100096243 Ga0070663_1000962433 254
196 3300005563 Ga0068855_100025103 Ga0068855_1000251037 254
197 3300005563 Ga0068855_100189224 Ga0068855_1001892243 254
198 3300005614 Ga0068856_100068135 Ga0068856_1000681352 254
199 3300005616 Ga0068852_100000335 Ga0068852_10000033520 254
200 3300009148 Ga0105243_10122307 Ga0105243_101223073 254
201 3300009553 Ga0105249_10308966 Ga0105249_103089662 254
202 3300013100 Ga0157373_10104524 Ga0157373_101045243 254
203 3300013102 Ga0157371_10034950 Ga0157371_100349505 254
204 3300013105 Ga0157369_10061152 Ga0157369_100611526 254
205 3300013105 Ga0157369_10078998 Ga0157369_100789985 254
206 3300013307 Ga0157372_10108758 Ga0157372_101087584 254
207 3300014326 Ga0157380_10047344 Ga0157380_100473443 254
208 3300020082 Ga0206353_11737401 Ga0206353_117374012 254
209 3300025904 Ga0207647_10096186 Ga0207647_100961862 254
210 3300025909 Ga0207705_10057055 Ga0207705_100570553 254
211 3300025909 Ga0207705_10096402 Ga0207705_100964022 254
212 3300025917 Ga0207660_10001245 Ga0207660_1000124512 254
213 3300025917 Ga0207660_10358682 Ga0207660_103586822 254
214 3300025919 Ga0207657_10116073 Ga0207657_101160732 254
215 3300025972 Ga0207668_10127705 Ga0207668_101277052 254
216 3300026067 Ga0207678_10324562 Ga0207678_103245622 254
217 3300026078 Ga0207702_10044154 Ga0207702_100441543 254
218 3300027617 Ga0210002_1009230 Ga0210002_10092302 254
219 3300027876 Ga0209974_10074006 Ga0209974_100740062 254
220 3300027907 Ga0207428_10131285 Ga0207428_101312851 254
221 3300037418 Ga0395900_0018120 Ga0395900_0018120_3780_4625 254
222 3300037418 Ga0395900_0142279 Ga0395900_0142279_238_1080 254
223 3300037466 Ga0395898_0053527 Ga0395898_0053527_959_1801 254
224 3300037466 Ga0395898_0145732 Ga0395898_0145732_696_1535 254
225 3300037471 Ga0395905_0160444 Ga0395905_0160444_562_1401 254
226 3300038443 Ga0395901_0000041 Ga0395901_0000041_195658_196503 254
227 3300038443 Ga0395901_0289114 Ga0395901_0289114_403_1242 254
228 3300044694 Ga0466963_0034780 Ga0466963_0034780_829_1671 254
229 3300045836 Ga0466958_0194306 Ga0466958_0194306_130_972 254
230 3300045836 Ga0466958_0244536 Ga0466958_0244536_194_1036 254
231 3300045976 Ga0466967_0565243 Ga0466967_0565243_145_987 254
232 3300045976 Ga0466967_0576462 Ga0466967_0576462_139_981 254
233 3300038443 Ga0395901_0305093 Ga0395901_0305093_298_1146 255
234 3300031911 Ga0307412_10000615 Ga0307412_100006157 256
235 3300032004 Ga0307414_10009548 Ga0307414_100095484 256
236 3300049571 Ga0501034_0015586 Ga0501034_0015586_4858_5649 256
237 3300049649 Ga0501198_011572 Ga0501198_011572_213_1004 256
238 3300049663 Ga0501223_000143 Ga0501223_000143_15358_16149 256
239 3300049664 Ga0501224_000048 Ga0501224_000048_2194_2985 256
240 3300049668 Ga0501233_000062 Ga0501233_000062_13193_13984 256
241 3300049669 Ga0501235_002852 Ga0501235_002852_2492_3283 256
242 3300049705 Ga0501225_0000210 Ga0501225_0000210_15378_16169 256
243 3300049707 Ga0501234_000021 Ga0501234_000021_1852_2643 256
244 3300049853 Ga0501226_000105 Ga0501226_000105_15378_16169 256
245 3300001976 JGI24752J21851_1001053 JGI24752J21851_10010533 258
246 3300005331 Ga0070670_100016526 Ga0070670_1000165267 258
247 3300005335 Ga0070666_10000111 Ga0070666_1000011139 258
248 3300005343 Ga0070687_100417533 Ga0070687_1004175331 258
249 3300005353 Ga0070669_100000012 Ga0070669_10000001247 258
250 3300005355 Ga0070671_100000019 Ga0070671_10000001947 258
251 3300005440 Ga0070705_100004405 Ga0070705_1000044053 258
252 3300005445 Ga0070708_100072367 Ga0070708_1000723674 258
253 3300005548 Ga0070665_100208268 Ga0070665_1002082683 258
254 3300005577 Ga0068857_100062708 Ga0068857_1000627082 258
255 3300005617 Ga0068859_100000779 Ga0068859_1000007797 258
256 3300005618 Ga0068864_100000475 Ga0068864_10000047514 258
257 3300005719 Ga0068861_100002169 Ga0068861_1000021695 258
258 3300005841 Ga0068863_100005824 Ga0068863_1000058249 258
259 3300005844 Ga0068862_100000884 Ga0068862_10000088410 258
260 3300006931 Ga0097620_100000779 Ga0097620_1000007797 258
261 3300009011 Ga0105251_10039456 Ga0105251_100394564 258
262 3300009101 Ga0105247_10004441 Ga0105247_1000444112 258
263 3300009177 Ga0105248_10096452 Ga0105248_100964523 258
264 3300009553 Ga0105249_10000553 Ga0105249_1000055312 258
265 3300013306 Ga0163162_10031798 Ga0163162_100317987 258
266 3300014325 Ga0163163_10108426 Ga0163163_101084263 258
267 3300014968 Ga0157379_10001174 Ga0157379_1000117418 258
268 3300025315 Ga0207697_10000003 Ga0207697_10000003101 258
269 3300025900 Ga0207710_10014089 Ga0207710_100140895 258
270 3300025903 Ga0207680_10000142 Ga0207680_1000014237 258
271 3300025923 Ga0207681_10000004 Ga0207681_10000004524 258
272 3300025925 Ga0207650_10005182 Ga0207650_1000518213 258
273 3300025931 Ga0207644_10000031 Ga0207644_1000003148 258
274 3300025961 Ga0207712_10088968 Ga0207712_100889682 258
275 3300025972 Ga0207668_10000135 Ga0207668_1000013546 258
276 3300025986 Ga0207658_10003835 Ga0207658_1000383514 258
277 3300026088 Ga0207641_10006924 Ga0207641_100069246 258
278 3300026095 Ga0207676_10009376 Ga0207676_100093764 258
279 3300026116 Ga0207674_10077995 Ga0207674_100779952 258
280 3300026118 Ga0207675_100003319 Ga0207675_1000033196 258
281 3300028379 Ga0268266_10125945 Ga0268266_101259453 258
282 3300028380 Ga0268265_10000525 Ga0268265_1000052523 258
283 3300028381 Ga0268264_10000483 Ga0268264_1000048318 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

168

279

0.85

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

144

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

33

145

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8998 1 256
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8525 1 256
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7939 5 126
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7685 5 126
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7569 5 126
ID Description Score Start End Superfamily
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9287 5 124 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9284 3 125 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.913 3 125 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8925 5 124 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8667 1 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W7B4P2-F1-model_v4 Putative enzyme related to lactoylglutathione lyase/uncharacterized protein YbaA (DUF1428 family) 0.9916 2 258 GO:0016829
AF-A0A7W7B4P2-F1-model_v4 Putative enzyme related to lactoylglutathione lyase/uncharacterized protein YbaA (DUF1428 family) 0.984 2 258 GO:0016829
AF-A0A5N7MUD4-F1-model_v4 VOC family protein 0.9792 145 258
AF-A0A2M7LG43-F1-model_v4 deleted 0.9785 1 258
AF-A5PBN1-F1-model_v4 VOC domain-containing protein 0.9777 1 258

Feature Viewer

pLDDT pTM Quality
93.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map