F385533

General Info

Members Datasets Scaffolds Average Seq Length
283 198 566 100

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10376238|Ga0114129_103762382
Length 116
Sequence MLRERGEQGMAATIRPLHDRVLIQRIDEKEQVRGGIIIPDTAKEKPQQGEVMAVGDGKINEDGTRRPPDVKPGDRVLFGKYSGSEVKIDDQEYLIMREDEILGVFVSAKKSSSAGR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
142 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.34
Metatranscriptomes 11.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10376238 3300009147 Bacteria 1876
2 MRS1b_contig_3782706 2162886011 Unclassified 852
3 JGI24751J29686_10000082 3300002459 Bacteria 53568
4 Ga0058863_11930525 3300004799 Bacteria 3856
5 Ga0058861_11861812 3300004800 Bacteria 2314
6 Ga0058862_12814194 3300004803 Bacteria 2793
7 Ga0065704_10003289 3300005289 Bacteria 4183
8 Ga0065712_10014776 3300005290 Bacteria 2378
9 Ga0065712_10122999 3300005290 Bacteria 1644
10 Ga0065715_10003348 3300005293 Bacteria 4067
11 Ga0065707_10036507 3300005295 Bacteria 1111
12 Ga0065707_10615207 3300005295 Bacteria 682
13 Ga0070658_10012894 3300005327 Bacteria 6710
14 Ga0070683_100020795 3300005329 Bacteria 5847
15 Ga0070690_100071349 3300005330 Bacteria 2257
16 Ga0070670_100024358 3300005331 Bacteria 5204
17 Ga0070677_10384092 3300005333 Bacteria 736
18 Ga0068869_100350687 3300005334 Bacteria 1203
19 Ga0070680_101173508 3300005336 Bacteria 664
20 Ga0070689_100882178 3300005340 Bacteria 791
21 Ga0070689_101752329 3300005340 Bacteria 566
22 Ga0070691_10041863 3300005341 Bacteria 2167
23 Ga0070691_10245226 3300005341 Bacteria 959
24 Ga0070661_100116901 3300005344 Bacteria 1995
25 Ga0070675_101103347 3300005354 Bacteria 730
26 Ga0070659_100500490 3300005366 Bacteria 1036
27 Ga0070659_101102887 3300005366 Bacteria 699
28 Ga0070710_10379307 3300005437 Bacteria 943
29 Ga0070701_10098396 3300005438 Bacteria 1616
30 Ga0070711_101495088 3300005439 Bacteria 589
31 Ga0070705_100009785 3300005440 Bacteria 4778
32 Ga0070705_100217297 3300005440 Bacteria 1321
33 Ga0070694_100000685 3300005444 Bacteria 18881
34 Ga0070694_100037538 3300005444 Bacteria 3213
35 Ga0070694_100678013 3300005444 Bacteria 836
36 Ga0070694_100899407 3300005444 Bacteria 731
37 Ga0070694_101125036 3300005444 Bacteria 656
38 Ga0070708_100254200 3300005445 Bacteria 1651
39 Ga0070708_100392438 3300005445 Bacteria 1309
40 Ga0070662_101203960 3300005457 Bacteria 651
41 Ga0070681_10066338 3300005458 Bacteria 3578
42 Ga0070706_100050189 3300005467 Bacteria 3850
43 Ga0070707_101546331 3300005468 Unclassified 630
44 Ga0070707_101763805 3300005468 Bacteria 586
45 Ga0070698_100011350 3300005471 Bacteria 9460
46 Ga0070698_100072389 3300005471 Bacteria 3454
47 Ga0070698_100285099 3300005471 Bacteria 1583
48 Ga0070698_101984505 3300005471 Unclassified 535
49 Ga0070699_100245077 3300005518 Bacteria 1600
50 Ga0070684_100474173 3300005535 Bacteria 1158
51 Ga0070697_100144510 3300005536 Bacteria 2002
52 Ga0070697_100199321 3300005536 Bacteria 1701
53 Ga0070697_100215290 3300005536 Bacteria 1636
54 Ga0070686_100117680 3300005544 Bacteria 1820
55 Ga0070695_100024110 3300005545 Bacteria 3745
56 Ga0070695_100113179 3300005545 Bacteria 1845
57 Ga0070695_100915942 3300005545 Bacteria 709
58 Ga0070695_100971209 3300005545 Bacteria 689
59 Ga0070693_100318893 3300005547 Bacteria 1054
60 Ga0070665_101002992 3300005548 Bacteria 847
61 Ga0070704_100024084 3300005549 Bacteria 3989
62 Ga0070704_100076266 3300005549 Bacteria 2451
63 Ga0070704_100092760 3300005549 Bacteria 2255
64 Ga0070704_100694871 3300005549 Bacteria 902
65 Ga0070704_101505935 3300005549 Bacteria 619
66 Ga0070664_101091000 3300005564 Bacteria 752
67 Ga0068857_100060085 3300005577 Bacteria 3377
68 Ga0068854_101132018 3300005578 Bacteria 698
69 Ga0068856_100080188 3300005614 Bacteria 3237
70 Ga0070702_100289789 3300005615 Bacteria 1128
71 Ga0070702_100304719 3300005615 Bacteria 1104
72 Ga0068859_100812020 3300005617 Bacteria 1022
73 Ga0068864_101433977 3300005618 Bacteria 693
74 Ga0068861_100990889 3300005719 Bacteria 801
75 Ga0068861_102647759 3300005719 Bacteria 506
76 Ga0068851_10439261 3300005834 Bacteria 774
77 Ga0068863_101388647 3300005841 Bacteria 710
78 Ga0068858_102421544 3300005842 Bacteria 519
79 Ga0068862_102518707 3300005844 Bacteria 526
80 Ga0070712_101006864 3300006175 Bacteria 721
81 Ga0068871_100474798 3300006358 Bacteria 1124
82 Ga0075428_100050372 3300006844 Bacteria 4568
83 Ga0075430_100075745 3300006846 Bacteria 2821
84 Ga0075430_100970868 3300006846 Bacteria 700
85 Ga0075431_100069173 3300006847 Bacteria 3643
86 Ga0075431_100183388 3300006847 Bacteria 2147
87 Ga0075431_100224236 3300006847 Bacteria 1917
88 Ga0075433_10133775 3300006852 Bacteria 2204
89 Ga0075433_10212125 3300006852 Bacteria 1720
90 Ga0075434_100417619 3300006871 Bacteria 1363
91 Ga0075434_101662442 3300006871 Bacteria 647
92 Ga0075429_100193253 3300006880 Bacteria 1783
93 Ga0075429_100682774 3300006880 Bacteria 900
94 Ga0075436_100041551 3300006914 Bacteria 3173
95 Ga0097620_100812050 3300006931 Bacteria 1022
96 Ga0097620_102513843 3300006931 Bacteria 567
97 Ga0075435_100136777 3300007076 Bacteria 2053
98 Ga0075435_100561523 3300007076 Bacteria 989
99 Ga0075435_100722903 3300007076 Bacteria 866
100 Ga0105240_10000002 3300009093 Bacteria 1924170
101 Ga0111539_10044474 3300009094 Bacteria 5320
102 Ga0111539_11210337 3300009094 Bacteria 877
103 Ga0111539_12875531 3300009094 Bacteria 557
104 Ga0105245_10539171 3300009098 Bacteria 1188
105 Ga0114129_10083456 3300009147 Bacteria 4438
106 Ga0114129_11512545 3300009147 Bacteria 824
107 Ga0114129_12502634 3300009147 Bacteria 617
108 Ga0114129_13144382 3300009147 Bacteria 538
109 Ga0114129_13312752 3300009147 Bacteria 521
110 Ga0105243_10698980 3300009148 Bacteria 988
111 Ga0105243_12516530 3300009148 Bacteria 554
112 Ga0105238_10958116 3300009551 Bacteria 876
113 Ga0105239_13499806 3300010375 Bacteria 510
114 Ga0157373_10107308 3300013100 Bacteria 1963
115 Ga0157370_10830410 3300013104 Bacteria 840
116 Ga0157369_10015074 3300013105 Bacteria 8725
117 Ga0157378_12977297 3300013297 Bacteria 525
118 Ga0163162_10939082 3300013306 Bacteria 976
119 Ga0163162_12483546 3300013306 Bacteria 596
120 Ga0157375_10106357 3300013308 Bacteria 2897
121 Ga0157375_12242993 3300013308 Unclassified 651
122 Ga0163163_10056191 3300014325 Bacteria 3890
123 Ga0163163_10178825 3300014325 Bacteria 2168
124 Ga0163163_10782364 3300014325 Bacteria 1018
125 Ga0163163_11358558 3300014325 Bacteria 772
126 Ga0157380_10478133 3300014326 Bacteria 1204
127 Ga0157377_10224850 3300014745 Bacteria 1203
128 Ga0157377_11209880 3300014745 Bacteria 585
129 Ga0157377_11754695 3300014745 Bacteria 502
130 Ga0157379_10209795 3300014968 Bacteria 1763
131 Ga0157376_11854981 3300014969 Unclassified 639
132 Ga0197907_11262085 3300020069 Bacteria 3404
133 Ga0206356_10946023 3300020070 Bacteria 2249
134 Ga0206352_10256532 3300020078 Bacteria 1917
135 Ga0206350_10995228 3300020080 Bacteria 850
136 Ga0206350_11076569 3300020080 Bacteria 555
137 Ga0206350_11564534 3300020080 Bacteria 777
138 Ga0206354_11124548 3300020081 Bacteria 2483
139 Ga0224712_10005207 3300022467 Bacteria 3595
140 Ga0247553_107262 3300023672 Bacteria 600
141 Ga0207697_10149301 3300025315 Unclassified 1016
142 Ga0207656_10327744 3300025321 Bacteria 761
143 Ga0207653_10102878 3300025885 Bacteria 1012
144 Ga0207643_10166126 3300025908 Bacteria 1330
145 Ga0207705_10038566 3300025909 Bacteria 3421
146 Ga0207684_10498715 3300025910 Bacteria 1044
147 Ga0207654_10664860 3300025911 Bacteria 747
148 Ga0207707_10893620 3300025912 Bacteria 735
149 Ga0207695_10000002 3300025913 Bacteria 2188391
150 Ga0207693_10579458 3300025915 Bacteria 874
151 Ga0207663_11180877 3300025916 Bacteria 616
152 Ga0207662_10150049 3300025918 Bacteria 1482
153 Ga0207649_10123417 3300025920 Bacteria 1749
154 Ga0207681_10566391 3300025923 Bacteria 936
155 Ga0207650_10000010 3300025925 Bacteria 454110
156 Ga0207650_11370755 3300025925 Bacteria 602
157 Ga0207690_10522265 3300025932 Bacteria 962
158 Ga0207670_10091434 3300025936 Bacteria 2152
159 Ga0207665_10561187 3300025939 Bacteria 888
160 Ga0207691_10207098 3300025940 Bacteria 1705
161 Ga0207711_11656123 3300025941 Unclassified 583
162 Ga0207689_10043255 3300025942 Bacteria 3723
163 Ga0207661_10013961 3300025944 Bacteria 5874
164 Ga0207661_11093603 3300025944 Bacteria 734
165 Ga0207661_11391493 3300025944 Bacteria 644
166 Ga0207679_10372996 3300025945 Unclassified 1249
167 Ga0207651_10627818 3300025960 Bacteria 942
168 Ga0207651_11186397 3300025960 Bacteria 685
169 Ga0207703_11109329 3300026035 Unclassified 760
170 Ga0207708_10266913 3300026075 Bacteria 1383
171 Ga0207702_10277791 3300026078 Bacteria 1582
172 Ga0207641_12572374 3300026088 Bacteria 507
173 Ga0207648_10264503 3300026089 Bacteria 1535
174 Ga0207676_10066726 3300026095 Bacteria 2871
175 Ga0207676_11403218 3300026095 Bacteria 694
176 Ga0207674_10078886 3300026116 Bacteria 3298
177 Ga0207675_100120524 3300026118 Bacteria 2482
178 Ga0210000_1048988 3300027462 Bacteria 677
179 Ga0207428_10353847 3300027907 Bacteria 1080
180 Ga0268266_10380695 3300028379 Bacteria 1331
181 Ga0268264_10347532 3300028381 Bacteria 1411
182 Ga0307408_101605636 3300031548 Bacteria 618
183 Ga0307408_101704096 3300031548 Bacteria 601
184 Ga0307406_10989342 3300031901 Bacteria 721
185 Ga0307412_11483423 3300031911 Unclassified 616
186 Ga0307409_101687603 3300031995 Bacteria 662
187 Ga0307416_102112208 3300032002 Bacteria 665
188 Ga0316593_10237451 3300032168 Bacteria 680
189 Ga0316592_1129025 3300033524 Bacteria 589
190 Ga0373946_0129814 3300035171 Bacteria 1158
191 Ga0316574_0834482 3300035398 Bacteria 560
192 Ga0373931_0562970 3300035691 Bacteria 742
193 Ga0373937_2006104 3300036401 Bacteria 525
194 Ga0316582_0074103 3300036647 Bacteria 2210
195 Ga0395900_0729183 3300037418 Bacteria 923
196 Ga0395905_0064459 3300037471 Bacteria 3429
197 Ga0395905_0108150 3300037471 Bacteria 2610
198 Ga0395905_1331897 3300037471 Bacteria 622
199 Ga0439453_0143913 3300041408 Bacteria 562
200 Ga0451807_2210070 3300041486 Bacteria 528
201 Ga0452271_31649 3300041916 Bacteria 509
202 Ga0439451_049348 3300042009 Bacteria 843
203 Ga0439444_0152786 3300042437 Bacteria 559
204 Ga0439460_0144790 3300042461 Unclassified 790
205 Ga0451577_0632509 3300042876 Bacteria 971
206 Ga0451577_0860608 3300042876 Bacteria 817
207 Ga0453683_0814602 3300044673 Bacteria 615
208 Ga0466966_0174437 3300044684 Bacteria 1306
209 Ga0466961_0042547 3300044693 Bacteria 2912
210 Ga0453684_0245228 3300044712 Bacteria 2060
211 Ga0453684_0920430 3300044712 Bacteria 935
212 Ga0451576_0966678 3300045051 Bacteria 893
213 Ga0451576_1485810 3300045051 Bacteria 704
214 Ga0495585_0231673 3300046492 Bacteria 928
215 Ga0495598_0076274 3300046537 Bacteria 1066
216 Ga0495621_0216647 3300046539 Bacteria 774
217 Ga0495668_0001287 3300046616 Bacteria 24816
218 Ga0495659_0034018 3300046664 Bacteria 1790
219 Ga0495669_0009079 3300046684 Bacteria 4190
220 Ga0495670_0129444 3300046691 Bacteria 1315
221 Ga0495636_0364060 3300047318 Bacteria 684
222 Ga0495677_0382771 3300047445 Bacteria 556
223 Ga0496104_0825911 3300048907 Bacteria 833
224 Ga0496109_0332365 3300048912 Bacteria 1435
225 Ga0496109_1791481 3300048912 Bacteria 547
226 Ga0496113_0089217 3300048916 Bacteria 2373
227 Ga0496115_0735313 3300048918 Bacteria 773
228 Ga0501306_006918 3300049127 Bacteria 1345
229 Ga0501306_013599 3300049127 Bacteria 1063
230 Ga0501306_037731 3300049127 Bacteria 740
231 Ga0501306_058939 3300049127 Bacteria 629
232 Ga0501308_023695 3300049128 Bacteria 785
233 Ga0501309_024418 3300049129 Bacteria 864
234 Ga0501309_095185 3300049129 Bacteria 511
235 Ga0501310_008964 3300049130 Bacteria 1094
236 Ga0501304_019098 3300049160 Bacteria 667
237 Ga0501305_030828 3300049161 Bacteria 835
238 Ga0501305_031727 3300049161 Bacteria 826
239 Ga0501307_022334 3300049162 Bacteria 831
240 Ga0501307_062707 3300049162 Bacteria 580
241 Ga0501312_094386 3300049528 Bacteria 555
242 Ga0501312_098891 3300049528 Bacteria 545
243 Ga0501318_026597 3300049534 Bacteria 765
244 Ga0501034_0272832 3300049571 Bacteria 1632
245 Ga0501038_0993711 3300049574 Bacteria 616
246 Ga0501040_0164982 3300049576 Bacteria 1567
247 Ga0501040_0439812 3300049576 Bacteria 938
248 Ga0501041_0221939 3300049577 Bacteria 1186
249 Ga0501042_0071826 3300049578 Bacteria 2476
250 Ga0501046_0510053 3300049580 Bacteria 861
251 Ga0501047_0076340 3300049581 Bacteria 3225
252 Ga0501048_0209334 3300049582 Bacteria 1383
253 Ga0501072_0400595 3300049588 Bacteria 1089
254 Ga0501076_1583628 3300049592 Bacteria 538
255 Ga0501081_0051261 3300049743 Bacteria 2846
256 Ga0501081_0163723 3300049743 Bacteria 1604
257 Ga0501081_1016079 3300049743 Bacteria 627
258 Ga0501083_0836643 3300049744 Bacteria 599
259 Ga0501035_0065445 3300049822 Bacteria 3228
260 nmdc:mga05p37_1072518_c1 3300050507 Bacteria 847
261 nmdc:mga05p37_220659_c1 3300050507 Bacteria 2288
262 nmdc:mga05p37_569315_c1 3300050507 Bacteria 1285
263 nmdc:mga05p37_743136_c1 3300050507 Bacteria 1083
264 nmdc:mga09592_1386290_c1 3300050508 Unclassified 575
265 nmdc:mga09592_59620_c1 3300050508 Bacteria 3226
266 nmdc:mga0qj67_1209895_c1 3300050509 Bacteria 587
267 nmdc:mga0qj67_1596714_c1 3300050509 Bacteria 500
268 nmdc:mga0qj67_470887_c1 3300050509 Bacteria 1011
269 nmdc:mga06r32_226621_c1 3300050510 Bacteria 1857
270 nmdc:mga06r32_626593_c1 3300050510 Bacteria 1045
271 nmdc:mga08y16_30841_c1 3300050511 Bacteria 5638
272 nmdc:mga0n895_1307726_c1 3300050512 Bacteria 696
273 nmdc:mga0n895_1976229_c1 3300050512 Bacteria 541
274 nmdc:mga0rr50_1493044_c1 3300050513 Bacteria 571
275 nmdc:mga0rr50_227151_c1 3300050513 Bacteria 1543
276 nmdc:mga0a205_265818_c1 3300050515 Bacteria 1593
277 nmdc:mga0a205_402361_c1 3300050515 Bacteria 1233
278 nmdc:mga0a205_542196_c1 3300050515 Bacteria 1019
279 nmdc:mga0sz30_457690_c1 3300050516 Bacteria 573
280 Ga0501084_1458074 3300054114 Bacteria 573
281 Ga0587092_143923 3300059512 Bacteria 527
282 Ga0587109_066183 3300059624 Bacteria 772
283 Ga0530510_0748497 3300061734 Bacteria 745
284 Ga0114129_10376238
285 MRS1b_contig_3782706
286 JGI24751J29686_10000082
287 Ga0058863_11930525
288 Ga0058861_11861812
289 Ga0058862_12814194
290 Ga0065704_10003289
291 Ga0065712_10014776
292 Ga0065712_10122999
293 Ga0065715_10003348
294 Ga0065707_10036507
295 Ga0065707_10615207
296 Ga0070658_10012894
297 Ga0070683_100020795
298 Ga0070690_100071349
299 Ga0070670_100024358
300 Ga0070677_10384092
301 Ga0068869_100350687
302 Ga0070680_101173508
303 Ga0070689_100882178
304 Ga0070689_101752329
305 Ga0070691_10041863
306 Ga0070691_10245226
307 Ga0070661_100116901
308 Ga0070675_101103347
309 Ga0070659_100500490
310 Ga0070659_101102887
311 Ga0070710_10379307
312 Ga0070701_10098396
313 Ga0070711_101495088
314 Ga0070705_100009785
315 Ga0070705_100217297
316 Ga0070694_100000685
317 Ga0070694_100037538
318 Ga0070694_100678013
319 Ga0070694_100899407
320 Ga0070694_101125036
321 Ga0070708_100254200
322 Ga0070708_100392438
323 Ga0070662_101203960
324 Ga0070681_10066338
325 Ga0070706_100050189
326 Ga0070707_101546331
327 Ga0070707_101763805
328 Ga0070698_100011350
329 Ga0070698_100072389
330 Ga0070698_100285099
331 Ga0070698_101984505
332 Ga0070699_100245077
333 Ga0070684_100474173
334 Ga0070697_100144510
335 Ga0070697_100199321
336 Ga0070697_100215290
337 Ga0070686_100117680
338 Ga0070695_100024110
339 Ga0070695_100113179
340 Ga0070695_100915942
341 Ga0070695_100971209
342 Ga0070693_100318893
343 Ga0070665_101002992
344 Ga0070704_100024084
345 Ga0070704_100076266
346 Ga0070704_100092760
347 Ga0070704_100694871
348 Ga0070704_101505935
349 Ga0070664_101091000
350 Ga0068857_100060085
351 Ga0068854_101132018
352 Ga0068856_100080188
353 Ga0070702_100289789
354 Ga0070702_100304719
355 Ga0068859_100812020
356 Ga0068864_101433977
357 Ga0068861_100990889
358 Ga0068861_102647759
359 Ga0068851_10439261
360 Ga0068863_101388647
361 Ga0068858_102421544
362 Ga0068862_102518707
363 Ga0070712_101006864
364 Ga0068871_100474798
365 Ga0075428_100050372
366 Ga0075430_100075745
367 Ga0075430_100970868
368 Ga0075431_100069173
369 Ga0075431_100183388
370 Ga0075431_100224236
371 Ga0075433_10133775
372 Ga0075433_10212125
373 Ga0075434_100417619
374 Ga0075434_101662442
375 Ga0075429_100193253
376 Ga0075429_100682774
377 Ga0075436_100041551
378 Ga0097620_100812050
379 Ga0097620_102513843
380 Ga0075435_100136777
381 Ga0075435_100561523
382 Ga0075435_100722903
383 Ga0105240_10000002
384 Ga0111539_10044474
385 Ga0111539_11210337
386 Ga0111539_12875531
387 Ga0105245_10539171
388 Ga0114129_10083456
389 Ga0114129_11512545
390 Ga0114129_12502634
391 Ga0114129_13144382
392 Ga0114129_13312752
393 Ga0105243_10698980
394 Ga0105243_12516530
395 Ga0105238_10958116
396 Ga0105239_13499806
397 Ga0157373_10107308
398 Ga0157370_10830410
399 Ga0157369_10015074
400 Ga0157378_12977297
401 Ga0163162_10939082
402 Ga0163162_12483546
403 Ga0157375_10106357
404 Ga0157375_12242993
405 Ga0163163_10056191
406 Ga0163163_10178825
407 Ga0163163_10782364
408 Ga0163163_11358558
409 Ga0157380_10478133
410 Ga0157377_10224850
411 Ga0157377_11209880
412 Ga0157377_11754695
413 Ga0157379_10209795
414 Ga0157376_11854981
415 Ga0197907_11262085
416 Ga0206356_10946023
417 Ga0206352_10256532
418 Ga0206350_10995228
419 Ga0206350_11076569
420 Ga0206350_11564534
421 Ga0206354_11124548
422 Ga0224712_10005207
423 Ga0247553_107262
424 Ga0207697_10149301
425 Ga0207656_10327744
426 Ga0207653_10102878
427 Ga0207643_10166126
428 Ga0207705_10038566
429 Ga0207684_10498715
430 Ga0207654_10664860
431 Ga0207707_10893620
432 Ga0207695_10000002
433 Ga0207693_10579458
434 Ga0207663_11180877
435 Ga0207662_10150049
436 Ga0207649_10123417
437 Ga0207681_10566391
438 Ga0207650_10000010
439 Ga0207650_11370755
440 Ga0207690_10522265
441 Ga0207670_10091434
442 Ga0207665_10561187
443 Ga0207691_10207098
444 Ga0207711_11656123
445 Ga0207689_10043255
446 Ga0207661_10013961
447 Ga0207661_11093603
448 Ga0207661_11391493
449 Ga0207679_10372996
450 Ga0207651_10627818
451 Ga0207651_11186397
452 Ga0207703_11109329
453 Ga0207708_10266913
454 Ga0207702_10277791
455 Ga0207641_12572374
456 Ga0207648_10264503
457 Ga0207676_10066726
458 Ga0207676_11403218
459 Ga0207674_10078886
460 Ga0207675_100120524
461 Ga0210000_1048988
462 Ga0207428_10353847
463 Ga0268266_10380695
464 Ga0268264_10347532
465 Ga0307408_101605636
466 Ga0307408_101704096
467 Ga0307406_10989342
468 Ga0307412_11483423
469 Ga0307409_101687603
470 Ga0307416_102112208
471 Ga0316593_10237451
472 Ga0316592_1129025
473 Ga0373946_0129814
474 Ga0316574_0834482
475 Ga0373931_0562970
476 Ga0373937_2006104
477 Ga0316582_0074103
478 Ga0395900_0729183
479 Ga0395905_0064459
480 Ga0395905_0108150
481 Ga0395905_1331897
482 Ga0439453_0143913
483 Ga0451807_2210070
484 Ga0452271_31649
485 Ga0439451_049348
486 Ga0439444_0152786
487 Ga0439460_0144790
488 Ga0451577_0632509
489 Ga0451577_0860608
490 Ga0453683_0814602
491 Ga0466966_0174437
492 Ga0466961_0042547
493 Ga0453684_0245228
494 Ga0453684_0920430
495 Ga0451576_0966678
496 Ga0451576_1485810
497 Ga0495585_0231673
498 Ga0495598_0076274
499 Ga0495621_0216647
500 Ga0495668_0001287
501 Ga0495659_0034018
502 Ga0495669_0009079
503 Ga0495670_0129444
504 Ga0495636_0364060
505 Ga0495677_0382771
506 Ga0496104_0825911
507 Ga0496109_0332365
508 Ga0496109_1791481
509 Ga0496113_0089217
510 Ga0496115_0735313
511 Ga0501306_006918
512 Ga0501306_013599
513 Ga0501306_037731
514 Ga0501306_058939
515 Ga0501308_023695
516 Ga0501309_024418
517 Ga0501309_095185
518 Ga0501310_008964
519 Ga0501304_019098
520 Ga0501305_030828
521 Ga0501305_031727
522 Ga0501307_022334
523 Ga0501307_062707
524 Ga0501312_094386
525 Ga0501312_098891
526 Ga0501318_026597
527 Ga0501034_0272832
528 Ga0501038_0993711
529 Ga0501040_0164982
530 Ga0501040_0439812
531 Ga0501041_0221939
532 Ga0501042_0071826
533 Ga0501046_0510053
534 Ga0501047_0076340
535 Ga0501048_0209334
536 Ga0501072_0400595
537 Ga0501076_1583628
538 Ga0501081_0051261
539 Ga0501081_0163723
540 Ga0501081_1016079
541 Ga0501083_0836643
542 Ga0501035_0065445
543 nmdc:mga05p37_1072518_c1
544 nmdc:mga05p37_220659_c1
545 nmdc:mga05p37_569315_c1
546 nmdc:mga05p37_743136_c1
547 nmdc:mga09592_1386290_c1
548 nmdc:mga09592_59620_c1
549 nmdc:mga0qj67_1209895_c1
550 nmdc:mga0qj67_1596714_c1
551 nmdc:mga0qj67_470887_c1
552 nmdc:mga06r32_226621_c1
553 nmdc:mga06r32_626593_c1
554 nmdc:mga08y16_30841_c1
555 nmdc:mga0n895_1307726_c1
556 nmdc:mga0n895_1976229_c1
557 nmdc:mga0rr50_1493044_c1
558 nmdc:mga0rr50_227151_c1
559 nmdc:mga0a205_265818_c1
560 nmdc:mga0a205_402361_c1
561 nmdc:mga0a205_542196_c1
562 nmdc:mga0sz30_457690_c1
563 Ga0501084_1458074
564 Ga0587092_143923
565 Ga0587109_066183
566 Ga0530510_0748497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

13

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.9606 3 95
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9548 3 95
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.9439 3 95
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.9391 3 95
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9302 3 95
ID Description Score Start End Superfamily
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9627 3 95 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9439 3 95 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9376 3 95 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9198 3 95 2.30.33.40
af_Q8I5Q3_1_103_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.822 3 95 2.30.33.40
ID Description Score Start End GO Terms
AF-K8ZA13-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9518 3 95 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-F3MU37-F1-model_v4 deleted 0.9486 3 94
AF-A0A2E5NXF0-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9472 3 95 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-M1N8J4-F1-model_v4 10 kDa chaperonin 0.9472 3 95 GO:0005524
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-A0A535IRM4-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9457 3 95 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087

Map