F385277

General Info

Members Datasets Scaffolds Average Seq Length
282 224 159 691

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876818078
Length 784
Sequence VQKITLSPSRDIPFNKLVLSQSNVRRVKAGVSIEQLAESIAQRTLLQSLSVRAVVDADGNETGMFEVPAGGRRYRALELLVKQRRMSKTQAVPCVVREGGIAEDDSVAENDERVGLHPLDQFRAFQTLRDLGMTEEDIAARHFVKPAIVKQRLRLASVSPKLHEVYAEDGMTLEQLMAFSVTADHARQDQVWENVSRSGYDEPYQIRRMLTEKTVPGSDRRAQYVGIDAYEQAGGPVLRDLFENDDGGWLQDVALLDRLVTEKLKSEAETIAAEGWKWISVAVDFPYGHTGGLRELEGKPVDVTVEEQATIDALNAEHDRLEAEYQDADELPDAVDQRLGEIEAALLAFEDRSVVYDPADIVRAGVFVSIDSEGRLSIDRGYVRPEDEAPVGDPEIGQGADTSSTGGQEVAASVPGAVISVAGGPTEAEEDDEDVTKPLPDRLLIELTAHRTLALRDALAENPAIAFQAVLHNFVLATYYRFASSGSCLEIGLRTPTFPVQAPGLRESESAKAVEARYESWKARLPQSENDLWDALTALDGCGQASLFAHCASFAVNALYEPANRYNQGRVSAHGVRTRLDQANILARAVGLDMVQAGWRPTVDNYLGRVTKPRILEAVREAKGEQAAQLIDHLKKTDMATEAERLLDGVGWLPEPLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKPGRYRNFSPTTMIETAPATTIGHNWTPQNDFLIARRLRLPRTLWGPARSAGPLFHEKAKRERPAGKGLNRLGPRERRMVRPIPALPRHPAMTELTR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
14 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
15 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
16 2643221651 Afipia sp. Root123D2 Isolate Unclassified
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
26 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
27 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
28 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
29 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
30 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
34 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
35 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
36 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
37 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
40 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
41 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
42 2854911287 Brucella lupini LUP21 Isolate Unclassified
43 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
44 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
45 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
46 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
47 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
48 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
49 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
50 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
51 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
52 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
53 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
54 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
55 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
56 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
57 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
58 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
59 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
60 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
61 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
62 2904699407
63 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
64 2906610324
65 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
66 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
67 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
68 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
69 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
70 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
71 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
72 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
73 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
74 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
75 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
76 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
77 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
78 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
79 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
80 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
81 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
82 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
83 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
84 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
85 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
86 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
87 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
88 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
89 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
90 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
91 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
92 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
93 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
115 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
116 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
117 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
196 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
199 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
204 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
205 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
209 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
210 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
211 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
212 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
213 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
214 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
215 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
216 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
217 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
218 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
219 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
220 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
221 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
222 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
223 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
224 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.79
Metatranscriptomes 0
Isolates 43.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.77
Nodule 31.91
Rhizoplane 1.42
Rhizosphere 34.04
Stem 0
Stem Tuber 0
Unclassified 19.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1000618 3300005262 Bacteria 51600
2 Ga0065165_1013175 3300005262 Bacteria 3307
3 Ga0070668_100000040 3300005347 Bacteria 78926
4 Ga0070698_100086031 3300005471 Bacteria 3130
5 Ga0070665_100000164 3300005548 Bacteria 120601
6 Ga0068860_100002829 3300005843 Bacteria 18051
7 Ga0081455_10003107 3300005937 Bacteria 19320
8 Ga0081540_1002346 3300005983 Bacteria 15500
9 Ga0081540_1033683 3300005983 Bacteria 2777
10 Ga0081539_10015970 3300005985 Bacteria 5407
11 Ga0075368_10001305 3300006042 Bacteria 7895
12 Ga0075367_10000008 3300006178 Bacteria 43881
13 Ga0075369_10008448 3300006186 Bacteria 3962
14 Ga0075370_10032219 3300006353 Bacteria 2929
15 Ga0075370_10033676 3300006353 Bacteria 2869
16 Ga0099794_10004116 3300007265 Bacteria 5667
17 Ga0105240_10000005 3300009093 Bacteria 702630
18 Ga0105240_10000601 3300009093 Bacteria 66871
19 Ga0105248_10003587 3300009177 Bacteria 17203
20 Ga0105238_10022022 3300009551 Bacteria 6495
21 Ga0105249_10112809 3300009553 Bacteria 2571
22 Ga0099796_10014678 3300010159 Bacteria 2270
23 Ga0105239_10001235 3300010375 Bacteria 34834
24 Ga0105239_10055773 3300010375 Bacteria 4334
25 Ga0157370_10000654 3300013104 Bacteria 43161
26 Ga0214544_1003743 3300021320 Bacteria 31045
27 Ga0214542_1003670 3300021321 Bacteria 31045
28 Ga0214545_1003270 3300021324 Bacteria 31045
29 Ga0214543_1003368 3300021327 Bacteria 31045
30 Ga0213876_10003610 3300021384 Bacteria 8798
31 Ga0213876_10042268 3300021384 Bacteria 2409
32 Ga0209233_1000325 3300025261 Bacteria 50496
33 Ga0209233_1003833 3300025261 Bacteria 5236
34 Ga0209758_1000509 3300025297 Bacteria 62676
35 Ga0209758_1011040 3300025297 Bacteria 5292
36 Ga0209758_1017310 3300025297 Bacteria 3599
37 Ga0207426_1000653 3300025302 Bacteria 42624
38 Ga0207426_1013941 3300025302 Bacteria 2962
39 Ga0207695_10000006 3300025913 Bacteria 1135309
40 Ga0207695_10000011 3300025913 Bacteria 910221
41 Ga0207694_10011578 3300025924 Bacteria 6655
42 Ga0207668_10000069 3300025972 Bacteria 79827
43 Ga0207675_100123931 3300026118 Bacteria 2447
44 Ga0209389_1051588 3300027296 Bacteria 2825
45 Ga0209489_118242 3300027361 Bacteria 2825
46 Ga0209813_10000166 3300027866 Bacteria 21790
47 Ga0268266_10000092 3300028379 Bacteria 192109
48 Ga0268264_10000260 3300028381 Bacteria 94934
49 Ga0265337_1000089 3300028556 Bacteria 44667
50 Ga0265337_1018965 3300028556 Bacteria 2176
51 Ga0265326_10014951 3300028558 Bacteria 2257
52 Ga0265334_10001977 3300028573 Bacteria 9742
53 Ga0265334_10003111 3300028573 Bacteria 7573
54 Ga0265318_10001097 3300028577 Bacteria 16996
55 Ga0265322_10011952 3300028654 Bacteria 2511
56 Ga0265336_10000173 3300028666 Bacteria 45371
57 Ga0307515_10052892 3300028794 Bacteria 6009
58 Ga0265338_10000151 3300028800 Bacteria 126283
59 Ga0265328_10000052 3300031239 Bacteria 75383
60 Ga0265328_10001950 3300031239 Bacteria 9372
61 Ga0265328_10004174 3300031239 Bacteria 6300
62 Ga0265331_10000441 3300031250 Bacteria 40882
63 Ga0265331_10009032 3300031250 Bacteria 5632
64 Ga0265331_10011369 3300031250 Bacteria 4878
65 Ga0265316_10020526 3300031344 Bacteria 5622
66 Ga0307509_10001618 3300031507 Bacteria 37777
67 Ga0307508_10000976 3300031616 Bacteria 33292
68 Ga0307416_100095655 3300032002 Bacteria 2566
69 Ga0373927_0029466 3300035695 Bacteria 3578
70 Ga0436364_1059777 3300037853 Bacteria 2819
71 Ga0395901_0001722 3300038443 Bacteria 22594
72 Ga0395901_0019331 3300038443 Bacteria 6964
73 Ga0436365_0442812 3300039437 Bacteria 4017
74 Ga0436365_1378859 3300039437 Bacteria 9588
75 Ga0466966_0005625 3300044684 Bacteria 8241
76 Ga0466961_0000004 3300044693 Bacteria 175855
77 Ga0466959_0006369 3300045049 Bacteria 8171
78 Ga0495651_0031080 3300046462 Bacteria 4165
79 Ga0495650_0000093 3300046471 Bacteria 221558
80 Ga0495606_0000209 3300046507 Bacteria 103525
81 Ga0495643_0001030 3300046522 Bacteria 28407
82 Ga0495587_0015880 3300046536 Bacteria 4691
83 Ga0495604_0041940 3300047317 Bacteria 3588
84 Ga0495672_0000160 3300047320 Bacteria 98077
85 Ga0495686_0000723 3300047472 Bacteria 44178
86 Ga0496104_0000056 3300048907 Bacteria 122670
87 Ga0496105_0000036 3300048908 Bacteria 122670
88 Ga0496112_0041663 3300048915 Bacteria 4493
89 Ga0496113_0007728 3300048916 Bacteria 6940
90 Ga0496121_0003528 3300048924 Bacteria 22198
91 Ga0496122_0000595 3300048925 Bacteria 74359
92 Ga0496122_0080450 3300048925 Bacteria 2272
93 Ga0496123_0000211 3300048926 Bacteria 118697
94 Ga0496124_0000918 3300048927 Bacteria 47568
95 Ga0496124_0003854 3300048927 Bacteria 17946
96 Ga0496125_0006444 3300048928 Bacteria 12688
97 Ga0496126_0000544 3300048929 Bacteria 72750
98 Ga0496126_0040117 3300048929 Bacteria 4341
99 Ga0496126_0049012 3300048929 Bacteria 3857
100 Ga0501032_0000069 3300049569 Bacteria 86501
101 Ga0501032_0000417 3300049569 Bacteria 35209
102 Ga0501033_0000062 3300049570 Bacteria 102791
103 Ga0501033_0000180 3300049570 Bacteria 60526
104 Ga0501033_0000739 3300049570 Bacteria 29995
105 Ga0501034_0000496 3300049571 Bacteria 63793
106 Ga0501034_0000642 3300049571 Bacteria 54268
107 Ga0501034_0002227 3300049571 Bacteria 23904
108 Ga0501036_0000079 3300049572 Bacteria 60047
109 Ga0501036_0000086 3300049572 Bacteria 58349
110 Ga0501037_0000087 3300049573 Bacteria 85372
111 Ga0501037_0000571 3300049573 Bacteria 29149
112 Ga0501037_0038515 3300049573 Bacteria 3522
113 Ga0501038_0000067 3300049574 Bacteria 85978
114 Ga0501038_0000095 3300049574 Bacteria 74178
115 Ga0501039_0000059 3300049575 Bacteria 85852
116 Ga0501043_0000178 3300049579 Bacteria 56959
117 Ga0501043_0000289 3300049579 Bacteria 45306
118 Ga0501046_0000260 3300049580 Bacteria 53763
119 Ga0501046_0030793 3300049580 Bacteria 4354
120 Ga0501047_0000146 3300049581 Bacteria 85790
121 Ga0501047_0000531 3300049581 Bacteria 41244
122 Ga0501047_0000789 3300049581 Bacteria 33142
123 Ga0501048_0000034 3300049582 Bacteria 64683
124 Ga0501067_0000060 3300049583 Bacteria 63335
125 Ga0501069_0000046 3300049585 Bacteria 74811
126 Ga0501070_0000073 3300049586 Bacteria 85801
127 Ga0501070_0001019 3300049586 Bacteria 25176
128 Ga0501073_0000253 3300049589 Bacteria 35227
129 Ga0501074_0000025 3300049590 Bacteria 68500
130 Ga0501080_0000037 3300049742 Bacteria 82435
131 Ga0501080_0103969 3300049742 Bacteria 2634
132 Ga0501083_0000082 3300049744 Bacteria 64305
133 Ga0501035_0000141 3300049822 Bacteria 87831
134 Ga0501035_0000400 3300049822 Bacteria 49438
135 Ga0501044_0000151 3300049823 Bacteria 85867
136 Ga0501044_0001453 3300049823 Bacteria 27846
137 nmdc:mga06z11_9_c1 3300050494 Bacteria 109982
138 nmdc:mga04h51_12_c1 3300050495 Bacteria 83117
139 nmdc:mga07m45_2302_c1 3300050496 Bacteria 8940
140 nmdc:mga07m45_291_c1 3300050496 Bacteria 20343
141 nmdc:mga0sz30_7516_c1 3300050516 Bacteria 4088
142 Ga0500643_000018 3300053087 Bacteria 296505
143 Ga0500566_0000169 3300053094 Bacteria 33123
144 Ga0500566_0000282 3300053094 Bacteria 27609
145 Ga0500640_001479 3300053095 Bacteria 7169
146 Ga0500556_0010182 3300053104 Bacteria 2752
147 Ga0500572_000319 3300053111 Bacteria 17155
148 Ga0500614_000085 3300053123 Bacteria 21129
149 Ga0500559_0001533 3300053136 Bacteria 12963
150 Ga0500559_0008721 3300053136 Bacteria 4425
151 Ga0500604_0000114 3300053151 Bacteria 24882
152 Ga0500627_0000032 3300053158 Bacteria 84395
153 Ga0500630_000963 3300053159 Bacteria 13450
154 Ga0500638_037079 3300053162 Bacteria 2365
155 Ga0500639_000069 3300053163 Bacteria 47153
156 Ga0500639_000845 3300053163 Bacteria 15623
157 Ga0500636_0033978 3300053177 Bacteria 3018
158 Ga0501082_0000355 3300060353 Bacteria 40463
159 Ga0501082_0000985 3300060353 Bacteria 25132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1018965 Ga0265337_10189651 541
2 3300028558 Ga0265326_10014951 Ga0265326_100149512 541
3 3300028573 Ga0265334_10003111 Ga0265334_100031115 541
4 3300028577 Ga0265318_10001097 Ga0265318_1000109718 541
5 3300028654 Ga0265322_10011952 Ga0265322_100119523 541
6 3300028666 Ga0265336_10000173 Ga0265336_1000017353 541
7 3300028800 Ga0265338_10000151 Ga0265338_10000151131 541
8 iso_pu_bacteria 2881665667 2881671402 565
9 iso_pu_bacteria 8056681323 8056687242 586
10 iso_pu_bacteria 2935608549 2935614096 591
11 3300005262 Ga0065165_1013175 Ga0065165_10131753 602
12 iso_pu_bacteria 2958092219 2958092472 606
13 3300025297 Ga0209758_1000509 Ga0209758_100050951 607
14 3300048929 Ga0496126_0000544 Ga0496126_0000544_38778_40913 608
15 3300048929 Ga0496126_0040117 Ga0496126_0040117_1479_3578 610
16 iso_pu_bacteria 2513237096 2513659734 610
17 iso_pu_bacteria 2513237145 2513921747 610
18 iso_pu_bacteria 8019530166 8019530455 612
19 3300005347 Ga0070668_100000040 Ga0070668_10000004055 614
20 3300025972 Ga0207668_10000069 Ga0207668_1000006955 615
21 3300031250 Ga0265331_10011369 Ga0265331_100113695 615
22 3300046462 Ga0495651_0031080 Ga0495651_0031080_2201_4117 615
23 3300028794 Ga0307515_10052892 Ga0307515_100528924 621
24 3300048927 Ga0496124_0000918 Ga0496124_0000918_14368_16506 622
25 3300010375 Ga0105239_10001235 Ga0105239_1000123524 625
26 3300048925 Ga0496122_0000595 Ga0496122_0000595_52022_54160 625
27 3300048926 Ga0496123_0000211 Ga0496123_0000211_86049_88187 625
28 3300048927 Ga0496124_0003854 Ga0496124_0003854_7602_9740 625
29 3300048928 Ga0496125_0006444 Ga0496125_0006444_5579_7717 625
30 3300053163 Ga0500639_000069 Ga0500639_000069_22852_24984 627
31 3300010159 Ga0099796_10014678 Ga0099796_100146781 628
32 3300028556 Ga0265337_1000089 Ga0265337_100008921 628
33 3300028573 Ga0265334_10001977 Ga0265334_100019773 628
34 3300037853 Ga0436364_1059777 Ga0436364_1059777_239_2371 628
35 3300053177 Ga0500636_0033978 Ga0500636_0033978_393_2516 629
36 3300009551 Ga0105238_10022022 Ga0105238_100220223 633
37 3300025924 Ga0207694_10011578 Ga0207694_100115783 633
38 3300048907 Ga0496104_0000056 Ga0496104_0000056_26843_28945 633
39 3300048908 Ga0496105_0000036 Ga0496105_0000036_106676_108778 633
40 3300048915 Ga0496112_0041663 Ga0496112_0041663_1785_3887 633
41 3300048916 Ga0496113_0007728 Ga0496113_0007728_1623_3725 633
42 3300009093 Ga0105240_10000005 Ga0105240_10000005232 637
43 3300013104 Ga0157370_10000654 Ga0157370_100006547 637
44 3300025913 Ga0207695_10000011 Ga0207695_10000011681 637
45 3300053136 Ga0500559_0008721 Ga0500559_0008721_1708_3831 637
46 3300005937 Ga0081455_10003107 Ga0081455_100031076 641
47 3300053158 Ga0500627_0000032 Ga0500627_0000032_61345_63477 644
48 3300031507 Ga0307509_10001618 Ga0307509_1000161816 645
49 3300009553 Ga0105249_10112809 Ga0105249_101128092 646
50 3300047320 Ga0495672_0000160 Ga0495672_0000160_36897_39020 646
51 3300053151 Ga0500604_0000114 Ga0500604_0000114_449_2581 646
52 3300053104 Ga0500556_0010182 Ga0500556_0010182_86_2203 649
53 3300009177 Ga0105248_10003587 Ga0105248_1000358710 650
54 3300046471 Ga0495650_0000093 Ga0495650_0000093_211781_213868 650
55 3300053094 Ga0500566_0000282 Ga0500566_0000282_6338_8461 652
56 3300053095 Ga0500640_001479 Ga0500640_001479_1661_3784 652
57 3300053111 Ga0500572_000319 Ga0500572_000319_11613_13736 652
58 3300053123 Ga0500614_000085 Ga0500614_000085_3934_6057 652
59 3300053136 Ga0500559_0001533 Ga0500559_0001533_2680_4803 652
60 3300053159 Ga0500630_000963 Ga0500630_000963_8658_10781 652
61 3300053162 Ga0500638_037079 Ga0500638_037079_124_2247 652
62 3300053163 Ga0500639_000845 Ga0500639_000845_13061_15184 652
63 iso_pu_bacteria 643348564 643597349 652
64 3300049573 Ga0501037_0038515 Ga0501037_0038515_62_2197 653
65 3300005983 Ga0081540_1002346 Ga0081540_10023467 654
66 iso_pu_bacteria 2643221627 2644157040 654
67 3300006042 Ga0075368_10001305 Ga0075368_100013052 655
68 3300006178 Ga0075367_10000008 Ga0075367_1000000816 655
69 3300006353 Ga0075370_10033676 Ga0075370_100336762 655
70 3300027866 Ga0209813_10000166 Ga0209813_100001667 655
71 3300050494 nmdc:mga06z11_9_c1 nmdc:mga06z11_9_c1_70798_72936 655
72 3300050495 nmdc:mga04h51_12_c1 nmdc:mga04h51_12_c1_37047_39185 655
73 3300050496 nmdc:mga07m45_2302_c1 nmdc:mga07m45_2302_c1_4407_6545 655
74 3300031239 Ga0265328_10000052 Ga0265328_100000526 656
75 3300031239 Ga0265328_10001950 Ga0265328_100019506 656
76 3300031250 Ga0265331_10009032 Ga0265331_100090322 656
77 3300031344 Ga0265316_10020526 Ga0265316_100205264 656
78 3300047472 Ga0495686_0000723 Ga0495686_0000723_17880_20042 656
79 3300048925 Ga0496122_0080450 Ga0496122_0080450_139_2256 656
80 3300007265 Ga0099794_10004116 Ga0099794_100041162 659
81 3300035695 Ga0373927_0029466 Ga0373927_0029466_1388_3484 660
82 3300038443 Ga0395901_0019331 Ga0395901_0019331_1661_3760 661
83 3300005843 Ga0068860_100002829 Ga0068860_10000282912 662
84 3300028381 Ga0268264_10000260 Ga0268264_1000026031 662
85 3300031239 Ga0265328_10004174 Ga0265328_100041745 662
86 3300031250 Ga0265331_10000441 Ga0265331_1000044132 662
87 iso_pu_bacteria 8019597564 8019597881 662
88 3300006353 Ga0075370_10032219 Ga0075370_100322192 663
89 3300050496 nmdc:mga07m45_291_c1 nmdc:mga07m45_291_c1_2027_4153 663
90 3300005548 Ga0070665_100000164 Ga0070665_100000164121 664
91 3300028379 Ga0268266_10000092 Ga0268266_100000922 664
92 3300049571 Ga0501034_0000642 Ga0501034_0000642_36120_38300 666
93 iso_pu_bacteria 2878781027 2878783375 666
94 iso_pu_bacteria 2888337043 2888340360 666
95 3300038443 Ga0395901_0001722 Ga0395901_0001722_18879_20999 667
96 3300006186 Ga0075369_10008448 Ga0075369_100084482 668
97 3300050516 nmdc:mga0sz30_7516_c1 nmdc:mga0sz30_7516_c1_1063_3177 668
98 3300053094 Ga0500566_0000169 Ga0500566_0000169_27701_29815 668
99 3300021384 Ga0213876_10003610 Ga0213876_100036103 671
100 3300039437 Ga0436365_1378859 Ga0436365_1378859_3857_5974 671
101 3300046507 Ga0495606_0000209 Ga0495606_0000209_100570_102726 671
102 3300046522 Ga0495643_0001030 Ga0495643_0001030_22371_24527 671
103 3300049571 Ga0501034_0002227 Ga0501034_0002227_5756_7873 671
104 iso_pu_bacteria 2854911287 2854913197 671
105 3300005983 Ga0081540_1033683 Ga0081540_10336831 672
106 3300021320 Ga0214544_1003743 Ga0214544_100374337 672
107 3300021321 Ga0214542_1003670 Ga0214542_100367037 672
108 3300021324 Ga0214545_1003270 Ga0214545_10032702 672
109 3300021327 Ga0214543_1003368 Ga0214543_100336837 672
110 3300025302 Ga0207426_1000653 Ga0207426_100065319 672
111 iso_pu_bacteria 2929615660 2929620291 672
112 iso_pu_bacteria 8006984368 8006994058 672
113 iso_pu_bacteria 2585427529 2585547010 673
114 3300026118 Ga0207675_100123931 Ga0207675_1001239311 674
115 3300031616 Ga0307508_10000976 Ga0307508_1000097630 674
116 iso_pu_bacteria 2744054633 2745077989 674
117 iso_pu_bacteria 2876761206 2876761569 674
118 3300032002 Ga0307416_100095655 Ga0307416_1000956551 675
119 iso_pu_bacteria 2513237094 2513644310 675
120 3300048924 Ga0496121_0003528 Ga0496121_0003528_17459_19576 676
121 iso_pu_bacteria 3005710791 3005717123 676
122 3300025261 Ga0209233_1003833 Ga0209233_10038332 677
123 3300044684 Ga0466966_0005625 Ga0466966_0005625_4594_6711 677
124 3300044693 Ga0466961_0000004 Ga0466961_0000004_163059_165176 677
125 3300045049 Ga0466959_0006369 Ga0466959_0006369_3308_5425 677
126 3300049569 Ga0501032_0000069 Ga0501032_0000069_40453_42567 677
127 3300049570 Ga0501033_0000062 Ga0501033_0000062_40453_42567 677
128 3300049570 Ga0501033_0000180 Ga0501033_0000180_30509_32617 677
129 3300049571 Ga0501034_0000496 Ga0501034_0000496_18132_20246 677
130 3300049572 Ga0501036_0000086 Ga0501036_0000086_40453_42567 677
131 3300049573 Ga0501037_0000087 Ga0501037_0000087_39549_41663 677
132 3300049574 Ga0501038_0000067 Ga0501038_0000067_43235_45349 677
133 3300049575 Ga0501039_0000059 Ga0501039_0000059_40453_42567 677
134 3300049579 Ga0501043_0000289 Ga0501043_0000289_5272_7386 677
135 3300049580 Ga0501046_0000260 Ga0501046_0000260_5204_7318 677
136 3300049581 Ga0501047_0000146 Ga0501047_0000146_40453_42567 677
137 3300049582 Ga0501048_0000034 Ga0501048_0000034_15519_17633 677
138 3300049583 Ga0501067_0000060 Ga0501067_0000060_17966_20080 677
139 3300049585 Ga0501069_0000046 Ga0501069_0000046_44197_46311 677
140 3300049586 Ga0501070_0000073 Ga0501070_0000073_43235_45349 677
141 3300049589 Ga0501073_0000253 Ga0501073_0000253_24615_26729 677
142 3300049590 Ga0501074_0000025 Ga0501074_0000025_40894_43008 677
143 3300049742 Ga0501080_0000037 Ga0501080_0000037_37018_39132 677
144 3300049744 Ga0501083_0000082 Ga0501083_0000082_18666_20780 677
145 3300049822 Ga0501035_0000141 Ga0501035_0000141_43225_45339 677
146 3300049823 Ga0501044_0000151 Ga0501044_0000151_43301_45415 677
147 3300060353 Ga0501082_0000355 Ga0501082_0000355_7733_9847 677
148 iso_pu_bacteria 2517572143 2517890852 677
149 iso_pu_bacteria 2791355197 2793066184 677
150 iso_pu_bacteria 2879083081 2879085161 677
151 iso_pu_bacteria 2879110137 2879117228 677
152 iso_pu_bacteria 2904690495 2904693570 677
153 iso_pu_bacteria 2908756301 2908764507 677
154 iso_pu_bacteria 3005474847 3005481934 677
155 3300005985 Ga0081539_10015970 Ga0081539_100159704 678
156 3300039437 Ga0436365_0442812 Ga0436365_0442812_1318_3438 678
157 iso_pu_bacteria 2524023205 2524442316 678
158 iso_pu_bacteria 2643221651 2644290371 678
159 iso_pu_bacteria 2721755755 2723847141 678
160 iso_pu_bacteria 2824773399 2824778731 678
161 iso_pu_bacteria 2842038055 2842045431 678
162 iso_pu_bacteria 2842045827 2842053340 678
163 iso_pu_bacteria 2876808645 2876818078 678
164 iso_pu_bacteria 2888378607 2888387338 678
165 iso_pu_bacteria 2906626472 2906629768 678
166 iso_pu_bacteria 2932794094 2932797160 678
167 iso_pu_bacteria 8056967851 8056974252 678
168 iso_pu_bacteria 2507262055 2507506290 679
169 iso_pu_bacteria 2508501009 2508540531 679
170 iso_pu_bacteria 2508501042 2508693162 679
171 iso_pu_bacteria 2508501042 2508696573 679
172 iso_pu_bacteria 2513237092 2513622108 679
173 iso_pu_bacteria 2513237094 2513645136 679
174 iso_pu_bacteria 2513237094 2513645139 679
175 iso_pu_bacteria 2513237102 2513705392 679
176 iso_pu_bacteria 2513237145 2513916144 679
177 iso_pu_bacteria 2513237145 2513920452 679
178 iso_pu_bacteria 2513237161 2514014803 679
179 iso_pu_bacteria 2515154112 2515630633 679
180 iso_pu_bacteria 2524023228 2524538901 679
181 iso_pu_bacteria 2728368998 2728749622 679
182 iso_pu_bacteria 2824617872 2824619914 679
183 iso_pu_bacteria 2824626560 2824628742 679
184 iso_pu_bacteria 2824635225 2824636472 679
185 iso_pu_bacteria 2824644064 2824645835 679
186 iso_pu_bacteria 2824671348 2824673138 679
187 iso_pu_bacteria 2824687955 2824689858 679
188 iso_pu_bacteria 2824696289 2824698075 679
189 iso_pu_bacteria 2824704595 2824706312 679
190 iso_pu_bacteria 2824714736 2824716147 679
191 iso_pu_bacteria 2824723954 2824725872 679
192 iso_pu_bacteria 2824753945 2824755115 679
193 iso_pu_bacteria 2824753945 2824755908 679
194 iso_pu_bacteria 2824763712 2824764257 679
195 iso_pu_bacteria 2824763712 2824764961 679
196 iso_pu_bacteria 2838122688 2838128054 679
197 iso_pu_bacteria 2841941048 2841947550 679
198 iso_pu_bacteria 2841957949 2841961734 679
199 iso_pu_bacteria 2841966195 2841971567 679
200 iso_pu_bacteria 2841974524 2841981366 679
201 iso_pu_bacteria 2841983080 2841986759 679
202 iso_pu_bacteria 2874590934 2874594930 679
203 iso_pu_bacteria 2874612657 2874619940 679
204 iso_pu_bacteria 2874620515 2874623635 679
205 iso_pu_bacteria 2876771140 2876774448 679
206 iso_pu_bacteria 2876818435 2876823186 679
207 iso_pu_bacteria 2879074833 2879079017 679
208 iso_pu_bacteria 2879083081 2879085108 679
209 iso_pu_bacteria 2885366525 2885374249 679
210 iso_pu_bacteria 2903768456 2903774977 679
211 iso_pu_bacteria 2904666416 2904670442 679
212 iso_pu_bacteria 2904699407 2904706313 679
213 iso_pu_bacteria 2904711408 2904712808 679
214 iso_pu_bacteria 2904711408 2904715960 679
215 iso_pu_bacteria 2906610324 2906612561 679
216 iso_pu_bacteria 2906635258 2906637007 679
217 iso_pu_bacteria 2906660503 2906664909 679
218 iso_pu_bacteria 2908775508 2908781928 679
219 iso_pu_bacteria 2932784394 2932791696 679
220 iso_pu_bacteria 2932801729 2932803595 679
221 iso_pu_bacteria 2932801729 2932806058 679
222 iso_pu_bacteria 2932818245 2932825020 679
223 iso_pu_bacteria 2935684952 2935693922 679
224 iso_pu_bacteria 2935713505 2935722501 679
225 iso_pu_bacteria 2935722832 2935731810 679
226 iso_pu_bacteria 2935732158 2935741218 679
227 iso_pu_bacteria 2935741537 2935750594 679
228 iso_pu_bacteria 2935750917 2935760069 679
229 iso_pu_bacteria 2935827899 2935836447 679
230 iso_pu_bacteria 2935837841 2935843606 679
231 iso_pu_bacteria 2935883170 2935887872 679
232 iso_pu_bacteria 2935883170 2935889084 679
233 iso_pu_bacteria 2935916978 2935925369 679
234 iso_pu_bacteria 2935959822 2935962276 679
235 iso_pu_bacteria 2940556831 2940565894 679
236 iso_pu_bacteria 2941538514 2941544079 679
237 iso_pu_bacteria 3005474847 3005477823 679
238 iso_pu_bacteria 8016603502 8016612853 679
239 iso_pu_bacteria 8019576017 8019585607 679
240 iso_pu_bacteria 8019586578 8019594624 679
241 iso_pu_bacteria 8019648815 8019651079 679
242 3300025297 Ga0209758_1017310 Ga0209758_10173102 680
243 3300027296 Ga0209389_1051588 Ga0209389_10515881 680
244 3300027361 Ga0209489_118242 Ga0209489_1182421 680
245 3300060353 Ga0501082_0000985 Ga0501082_0000985_1937_4057 680
246 3300005471 Ga0070698_100086031 Ga0070698_1000860312 681
247 3300046536 Ga0495587_0015880 Ga0495587_0015880_2477_4591 681
248 3300047317 Ga0495604_0041940 Ga0495604_0041940_1269_3383 681
249 3300053087 Ga0500643_000018 Ga0500643_000018_161137_163443 681
250 3300021384 Ga0213876_10042268 Ga0213876_100422681 682
251 3300025297 Ga0209758_1011040 Ga0209758_10110404 682
252 3300049581 Ga0501047_0000789 Ga0501047_0000789_5803_7929 682
253 3300049742 Ga0501080_0103969 Ga0501080_0103969_205_2331 682
254 3300005262 Ga0065165_1000618 Ga0065165_10006185 683
255 3300009093 Ga0105240_10000601 Ga0105240_1000060112 683
256 3300010375 Ga0105239_10055773 Ga0105239_100557732 683
257 3300025261 Ga0209233_1000325 Ga0209233_100032539 683
258 3300025302 Ga0207426_1013941 Ga0207426_10139412 683
259 3300025913 Ga0207695_10000006 Ga0207695_10000006386 683
260 3300048929 Ga0496126_0049012 Ga0496126_0049012_940_3057 683
261 3300049569 Ga0501032_0000417 Ga0501032_0000417_7877_9994 683
262 3300049570 Ga0501033_0000739 Ga0501033_0000739_2048_4165 683
263 3300049572 Ga0501036_0000079 Ga0501036_0000079_32682_34799 683
264 3300049573 Ga0501037_0000571 Ga0501037_0000571_25303_27420 683
265 3300049574 Ga0501038_0000095 Ga0501038_0000095_43269_45386 683
266 3300049579 Ga0501043_0000178 Ga0501043_0000178_29612_31729 683
267 3300049580 Ga0501046_0030793 Ga0501046_0030793_505_2622 683
268 3300049581 Ga0501047_0000531 Ga0501047_0000531_25533_27650 683
269 3300049586 Ga0501070_0001019 Ga0501070_0001019_16037_18154 683
270 3300049822 Ga0501035_0000400 Ga0501035_0000400_26756_28873 683
271 3300049823 Ga0501044_0001453 Ga0501044_0001453_25200_27317 683
272 iso_pu_bacteria 2879099564 2879100750 683
273 iso_pu_bacteria 2932794094 2932801168 683
274 iso_pu_bacteria 2935801545 2935810381 683
275 iso_pu_bacteria 2935864058 2935873152 683
276 iso_pu_bacteria 8016539877 8016544524 683
277 iso_pu_bacteria 8016548790 8016548881 683
278 iso_pu_bacteria 8016557553 8016566135 683
279 iso_pu_bacteria 8016566248 8016575241 683
280 iso_pu_bacteria 8016575299 8016575302 683
281 iso_pu_bacteria 8016595262 8016595307 683
282 iso_pu_bacteria 8016613128 8016613334 683

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02195

ParBc

ParB/Sulfiredoxin domain

10

112

0.89

Feature Viewer

pLDDT pTM Quality
71.13 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map