F385232

General Info

Members Datasets Scaffolds Average Seq Length
282 190 564 85

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_427370_c1|nmdc:mga09592_427370_c1_601_894
Length 97
Sequence MPAGAASPLPYDDSMAERELLSVGVECYAGHRGEQTPRTLILGDRRIAVAEVLDAWLAPDYRYFKLRGTDGDTYLVRHDERSDTWELTMFRASRVDG

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
126 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
173 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
174 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.13
Rhizosphere 97.87
Stem 0
Stem Tuber 0
Unclassified 32.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_427370_c1 3300050508 Bacteria 1144
2 JGI25406J46586_10221033 3300003203 Bacteria 554
3 Ga0065704_10484643 3300005289 Bacteria 672
4 Ga0065715_10202126 3300005293 Bacteria 1273
5 Ga0065715_10306278 3300005293 Archaea 1030
6 Ga0065715_10692001 3300005293 Bacteria 657
7 Ga0065707_10157140 3300005295 Bacteria 1598
8 Ga0070676_10122266 3300005328 Bacteria 1635
9 Ga0070690_100301158 3300005330 Bacteria 1150
10 Ga0070670_100085744 3300005331 Bacteria 2706
11 Ga0070666_10379255 3300005335 Bacteria 1015
12 Ga0070666_10713159 3300005335 Unclassified 736
13 Ga0070682_101587648 3300005337 Bacteria 565
14 Ga0068868_100409891 3300005338 Bacteria 1171
15 Ga0070660_100525027 3300005339 Bacteria 986
16 Ga0070660_101155328 3300005339 Unclassified 656
17 Ga0070689_101365145 3300005340 Unclassified 640
18 Ga0070687_100254320 3300005343 Bacteria 1093
19 Ga0070687_100430375 3300005343 Bacteria 873
20 Ga0070669_100061605 3300005353 Bacteria 2757
21 Ga0070669_100180673 3300005353 Unclassified 1650
22 Ga0070671_100226543 3300005355 Unclassified 1586
23 Ga0070673_100250516 3300005364 Bacteria 1543
24 Ga0070673_101671284 3300005364 Unclassified 602
25 Ga0070688_100045236 3300005365 Bacteria 2718
26 Ga0070659_100091458 3300005366 Bacteria 2439
27 Ga0070694_100109908 3300005444 Bacteria 1963
28 Ga0070694_100191812 3300005444 Bacteria 1518
29 Ga0070663_101788588 3300005455 Unclassified 551
30 Ga0070681_10063703 3300005458 Bacteria 3659
31 Ga0070706_100289024 3300005467 Unclassified 1530
32 Ga0070706_102162234 3300005467 Unclassified 503
33 Ga0070707_102331744 3300005468 Bacteria 502
34 Ga0070699_100204898 3300005518 Bacteria 1755
35 Ga0070697_102074958 3300005536 Bacteria 509
36 Ga0070672_100432637 3300005543 Bacteria 1131
37 Ga0070686_100035617 3300005544 Bacteria 3075
38 Ga0070695_100113043 3300005545 Bacteria 1846
39 Ga0070696_100535198 3300005546 Bacteria 937
40 Ga0070696_101534071 3300005546 Bacteria 571
41 Ga0070693_100963007 3300005547 Bacteria 643
42 Ga0070665_101698016 3300005548 Unclassified 639
43 Ga0070704_100151874 3300005549 Bacteria 1821
44 Ga0068854_100081301 3300005578 Unclassified 2393
45 Ga0068854_100552270 3300005578 Unclassified 977
46 Ga0070702_100128492 3300005615 Bacteria 1597
47 Ga0068861_100232501 3300005719 Unclassified 1564
48 Ga0068861_100514769 3300005719 Unclassified 1084
49 Ga0068870_10021436 3300005840 Bacteria 3160
50 Ga0068863_100379743 3300005841 Bacteria 1379
51 Ga0068858_100301087 3300005842 Bacteria 1530
52 Ga0068860_100430500 3300005843 Bacteria 1309
53 Ga0068860_101961847 3300005843 Bacteria 607
54 Ga0068862_100182022 3300005844 Bacteria 1887
55 Ga0081539_10028092 3300005985 Bacteria 3544
56 Ga0075432_10186790 3300006058 Unclassified 814
57 Ga0075428_100002092 3300006844 Bacteria 21524
58 Ga0075430_100049273 3300006846 Bacteria 3555
59 Ga0075430_100076053 3300006846 Unclassified 2814
60 Ga0075431_100000701 3300006847 Bacteria 28885
61 Ga0075433_10495716 3300006852 Bacteria 1075
62 Ga0075433_10761791 3300006852 Bacteria 847
63 Ga0099794_10151639 3300007265 Bacteria 1177
64 Ga0105250_10611030 3300009092 Unclassified 506
65 Ga0105240_10088558 3300009093 Unclassified 3787
66 Ga0105240_10227499 3300009093 Bacteria 2169
67 Ga0105240_10686647 3300009093 Bacteria 1119
68 Ga0111539_10015238 3300009094 Bacteria 9576
69 Ga0111539_10017543 3300009094 Bacteria 8860
70 Ga0111539_11933164 3300009094 Unclassified 684
71 Ga0111539_13029956 3300009094 Unclassified 543
72 Ga0105247_10538837 3300009101 Bacteria 856
73 Ga0114129_10013577 3300009147 Bacteria 11605
74 Ga0114129_11939976 3300009147 Bacteria 713
75 Ga0105241_10029825 3300009174 Unclassified 4072
76 Ga0105248_10045472 3300009177 Bacteria 4923
77 Ga0105248_10138007 3300009177 Bacteria 2751
78 Ga0105248_10667792 3300009177 Bacteria 1172
79 Ga0105248_10759032 3300009177 Bacteria 1094
80 Ga0105238_11495647 3300009551 Unclassified 704
81 Ga0105249_10182218 3300009553 Unclassified 2044
82 Ga0105249_10745688 3300009553 Bacteria 1041
83 Ga0105239_10944985 3300010375 Unclassified 990
84 Ga0157317_1014133 3300012475 Bacteria 650
85 Ga0157373_10405141 3300013100 Unclassified 978
86 Ga0157375_10055939 3300013308 Bacteria 3892
87 Ga0157375_10612237 3300013308 Bacteria 1248
88 Ga0163163_10747530 3300014325 Bacteria 1041
89 Ga0157380_10502883 3300014326 Bacteria 1178
90 Ga0182008_10261286 3300014497 Unclassified 896
91 Ga0157377_10127048 3300014745 Bacteria 1552
92 Ga0157377_11066616 3300014745 Unclassified 616
93 Ga0157379_10107650 3300014968 Bacteria 2502
94 Ga0157379_10110644 3300014968 Bacteria 2467
95 Ga0157376_10934111 3300014969 Bacteria 887
96 Ga0207710_10348533 3300025900 Unclassified 754
97 Ga0207688_10059447 3300025901 Bacteria 2153
98 Ga0207680_10036341 3300025903 Unclassified 2836
99 Ga0207645_10076062 3300025907 Bacteria 2149
100 Ga0207643_10013508 3300025908 Bacteria 4424
101 Ga0207684_10439465 3300025910 Bacteria 1120
102 Ga0207707_10026475 3300025912 Bacteria 5069
103 Ga0207695_10561550 3300025913 Bacteria 1023
104 Ga0207657_10090056 3300025919 Bacteria 2561
105 Ga0207646_11163237 3300025922 Bacteria 677
106 Ga0207681_10629098 3300025923 Unclassified 889
107 Ga0207687_10601404 3300025927 Unclassified 927
108 Ga0207644_10304611 3300025931 Unclassified 1285
109 Ga0207690_10125066 3300025932 Bacteria 1874
110 Ga0207704_11963412 3300025938 Unclassified 503
111 Ga0207691_10141219 3300025940 Bacteria 2122
112 Ga0207711_10232218 3300025941 Unclassified 1690
113 Ga0207711_10263467 3300025941 Bacteria 1585
114 Ga0207689_10018093 3300025942 Bacteria 5950
115 Ga0207667_12227428 3300025949 Unclassified 505
116 Ga0207651_10571480 3300025960 Unclassified 985
117 Ga0207712_10074669 3300025961 Bacteria 2449
118 Ga0207712_11584164 3300025961 Unclassified 587
119 Ga0207712_11755166 3300025961 Bacteria 556
120 Ga0207640_10008719 3300025981 Bacteria 5642
121 Ga0207640_10503698 3300025981 Unclassified 1009
122 Ga0207639_10954820 3300026041 Bacteria 802
123 Ga0207639_12176960 3300026041 Unclassified 516
124 Ga0207648_11178831 3300026089 Unclassified 719
125 Ga0207675_100275426 3300026118 Unclassified 1634
126 Ga0207683_11491676 3300026121 Bacteria 624
127 Ga0268265_10392527 3300028380 Bacteria 1280
128 Ga0268264_10304303 3300028381 Unclassified 1502
129 Ga0268264_11152138 3300028381 Bacteria 784
130 Ga0307408_100111594 3300031548 Bacteria 2101
131 Ga0307408_100271823 3300031548 Unclassified 1407
132 Ga0307408_101836897 3300031548 Unclassified 580
133 Ga0307405_10010206 3300031731 Bacteria 4853
134 Ga0307410_10290787 3300031852 Bacteria 1286
135 Ga0307406_10832498 3300031901 Unclassified 781
136 Ga0307406_11413501 3300031901 Bacteria 610
137 Ga0307407_10153796 3300031903 Bacteria 1498
138 Ga0307407_10583426 3300031903 Unclassified 830
139 Ga0307412_10010975 3300031911 Bacteria 5231
140 Ga0307416_100253908 3300032002 Bacteria 1713
141 Ga0307416_101546418 3300032002 Bacteria 769
142 Ga0307411_10017790 3300032005 Bacteria 4062
143 Ga0307411_11873739 3300032005 Unclassified 558
144 Ga0307415_100071988 3300032126 Bacteria 2433
145 Ga0373950_0002879 3300034818 Unclassified 2416
146 Ga0373958_0020345 3300034819 Bacteria 1221
147 Ga0373959_0011227 3300034820 Unclassified 1578
148 Ga0373928_0008986 3300035084 Bacteria 1950
149 Ga0373929_0035195 3300035085 Unclassified 1089
150 Ga0373940_0022865 3300035088 Bacteria 1609
151 Ga0373949_0013563 3300035090 Unclassified 1808
152 Ga0373951_0006182 3300035091 Unclassified 2747
153 Ga0373952_0000151 3300035092 Bacteria 10295
154 Ga0373932_0006564 3300035112 Unclassified 2752
155 Ga0373939_0020537 3300035114 Bacteria 1795
156 Ga0373941_0018333 3300035115 Bacteria 1932
157 Ga0373960_0001359 3300035121 Bacteria 5395
158 Ga0373942_0001194 3300035207 Bacteria 6850
159 Ga0373961_0001049 3300035241 Bacteria 8914
160 Ga0373962_0110284 3300035242 Unclassified 867
161 Ga0395900_1242763 3300037418 Unclassified 660
162 Ga0395901_1396384 3300038443 Unclassified 659
163 Ga0242420_064447 3300038996 Unclassified 736
164 Ga0439439_0077649 3300041406 Unclassified 895
165 Ga0439453_0030063 3300041408 Bacteria 1025
166 Ga0439453_0130118 3300041408 Unclassified 584
167 Ga0439451_028146 3300042009 Bacteria 1133
168 Ga0439435_0270477 3300042436 Unclassified 576
169 Ga0439464_0091517 3300042439 Unclassified 917
170 Ga0439460_0022823 3300042461 Bacteria 1720
171 Ga0439460_0098215 3300042461 Unclassified 938
172 Ga0450893_0090069 3300042532 Unclassified 615
173 Ga0453683_0334854 3300044673 Bacteria 971
174 Ga0451576_0014409 3300045051 Bacteria 8802
175 Ga0451576_0272830 3300045051 Unclassified 1768
176 Ga0495654_0311645 3300046530 Unclassified 640
177 Ga0495622_0433841 3300046557 Unclassified 564
178 Ga0496102_0187897 3300048905 Bacteria 1947
179 Ga0496103_0031931 3300048906 Unclassified 3212
180 Ga0496106_0221266 3300048909 Bacteria 1510
181 Ga0496107_0195988 3300048910 Bacteria 1501
182 Ga0496110_0851793 3300048913 Bacteria 817
183 Ga0496112_0780814 3300048915 Bacteria 881
184 Ga0501291_035129 3300049514 Unclassified 861
185 Ga0501298_007311 3300049521 Bacteria 1829
186 Ga0501303_013591 3300049526 Unclassified 796
187 Ga0501033_0059069 3300049570 Bacteria 2832
188 Ga0501036_0004596 3300049572 Bacteria 11151
189 Ga0501036_0341786 3300049572 Bacteria 1250
190 Ga0501037_0204450 3300049573 Bacteria 1394
191 Ga0501038_0118958 3300049574 Bacteria 2181
192 Ga0501039_0014136 3300049575 Bacteria 6112
193 Ga0501039_0088069 3300049575 Unclassified 2419
194 Ga0501040_0075177 3300049576 Bacteria 2334
195 Ga0501040_0300150 3300049576 Unclassified 1148
196 Ga0501040_1297856 3300049576 Unclassified 528
197 Ga0501041_0006329 3300049577 Bacteria 6928
198 Ga0501042_0011247 3300049578 Bacteria 6032
199 Ga0501042_0187667 3300049578 Unclassified 1491
200 Ga0501042_0382275 3300049578 Bacteria 1019
201 Ga0501043_0112284 3300049579 Bacteria 2140
202 Ga0501046_0020538 3300049580 Bacteria 5460
203 Ga0501046_0207399 3300049580 Unclassified 1456
204 Ga0501048_0029725 3300049582 Bacteria 3960
205 Ga0501048_0065560 3300049582 Bacteria 2568
206 Ga0501048_0237368 3300049582 Bacteria 1294
207 Ga0501068_0082199 3300049584 Bacteria 1978
208 Ga0501070_0903581 3300049586 Bacteria 689
209 Ga0501071_0063828 3300049587 Bacteria 2671
210 Ga0501071_0150794 3300049587 Bacteria 1734
211 Ga0501071_0242740 3300049587 Bacteria 1358
212 Ga0501072_0065012 3300049588 Bacteria 2876
213 Ga0501072_0304850 3300049588 Unclassified 1266
214 Ga0501072_0379610 3300049588 Bacteria 1121
215 Ga0501074_0550869 3300049590 Unclassified 816
216 Ga0501075_0010577 3300049591 Bacteria 6488
217 Ga0501075_0103120 3300049591 Bacteria 2167
218 Ga0501076_0005824 3300049592 Bacteria 8889
219 Ga0501076_0074060 3300049592 Bacteria 2727
220 Ga0501076_0347515 3300049592 Bacteria 1218
221 Ga0501076_1448976 3300049592 Bacteria 564
222 Ga0501077_0098393 3300049593 Bacteria 1854
223 Ga0501077_0321917 3300049593 Bacteria 986
224 Ga0501077_0374878 3300049593 Bacteria 909
225 Ga0501202_113050 3300049652 Unclassified 674
226 Ga0501207_033652 3300049654 Unclassified 871
227 Ga0501217_006841 3300049661 Bacteria 2433
228 Ga0501235_014772 3300049669 Bacteria 1721
229 Ga0501257_068192 3300049686 Unclassified 906
230 Ga0501225_0031873 3300049705 Bacteria 1450
231 Ga0501079_0015887 3300049741 Bacteria 5754
232 Ga0501079_0061943 3300049741 Bacteria 2885
233 Ga0501080_0737281 3300049742 Unclassified 867
234 Ga0501081_0007799 3300049743 Bacteria 6940
235 Ga0501081_0620092 3300049743 Bacteria 810
236 Ga0501081_0742828 3300049743 Bacteria 737
237 Ga0501081_1122365 3300049743 Bacteria 595
238 Ga0501264_032926 3300049761 Unclassified 604
239 Ga0501267_023251 3300049764 Unclassified 695
240 Ga0501283_040139 3300049779 Unclassified 809
241 Ga0501035_0276094 3300049822 Unclassified 1421
242 Ga0501035_0873461 3300049822 Bacteria 714
243 Ga0501035_1413192 3300049822 Bacteria 533
244 Ga0501045_0001144 3300049824 Bacteria 17569
245 Ga0501045_0190377 3300049824 Bacteria 1529
246 Ga0501045_0351081 3300049824 Bacteria 1098
247 nmdc:mga05p37_150240_c1 3300050507 Bacteria 2850
248 nmdc:mga05p37_172306_c1 3300050507 Bacteria 2639
249 nmdc:mga05p37_296474_c1 3300050507 Bacteria 1923
250 nmdc:mga05p37_397489_c1 3300050507 Bacteria 1610
251 nmdc:mga05p37_521016_c1 3300050507 Bacteria 1360
252 nmdc:mga09592_623467_c1 3300050508 Bacteria 922
253 nmdc:mga0qj67_57177_c1 3300050509 Bacteria 3092
254 nmdc:mga0qj67_71733_c1 3300050509 Unclassified 2764
255 nmdc:mga06r32_1711053_c1 3300050510 Unclassified 566
256 nmdc:mga06r32_2870_c1 3300050510 Bacteria 15467
257 nmdc:mga06r32_325679_c1 3300050510 Bacteria 1522
258 nmdc:mga06r32_955926_c1 3300050510 Unclassified 811
259 nmdc:mga08y16_31596_c1 3300050511 Bacteria 5568
260 nmdc:mga08y16_630569_c1 3300050511 Bacteria 1078
261 nmdc:mga0n895_118245_c1 3300050512 Bacteria 2670
262 nmdc:mga0n895_1361218_c1 3300050512 Unclassified 679
263 nmdc:mga0n895_229411_c1 3300050512 Unclassified 1885
264 nmdc:mga0rr50_403833_c1 3300050513 Bacteria 1154
265 nmdc:mga0rr50_839363_c1 3300050513 Unclassified 784
266 nmdc:mga08x19_262267_c1 3300050514 Bacteria 1195
267 nmdc:mga08x19_69413_c1 3300050514 Bacteria 2295
268 nmdc:mga0a205_31490_c1 3300050515 Bacteria 5081
269 nmdc:mga0a205_315386_c1 3300050515 Bacteria 1435
270 nmdc:mga0a205_431364_c1 3300050515 Bacteria 1179
271 Ga0495655_0260334 3300053083 Bacteria 586
272 Ga0501084_0081609 3300054114 Bacteria 2712
273 Ga0501084_0179976 3300054114 Bacteria 1785
274 Ga0590075_072316 3300059424 Bacteria 892
275 Ga0590077_000163 3300059426 Bacteria 18754
276 Ga0590077_009435 3300059426 Bacteria 2001
277 Ga0590077_057941 3300059426 Bacteria 876
278 Ga0501082_0007724 3300060353 Bacteria 9284
279 Ga0501082_0388830 3300060353 Bacteria 1217
280 Ga0501082_0481372 3300060353 Unclassified 1085
281 Ga0530510_0022431 3300061734 Bacteria 4497
282 Ga0530510_0125532 3300061734 Bacteria 1886
283 nmdc:mga09592_427370_c1
284 JGI25406J46586_10221033
285 Ga0065704_10484643
286 Ga0065715_10202126
287 Ga0065715_10306278
288 Ga0065715_10692001
289 Ga0065707_10157140
290 Ga0070676_10122266
291 Ga0070690_100301158
292 Ga0070670_100085744
293 Ga0070666_10379255
294 Ga0070666_10713159
295 Ga0070682_101587648
296 Ga0068868_100409891
297 Ga0070660_100525027
298 Ga0070660_101155328
299 Ga0070689_101365145
300 Ga0070687_100254320
301 Ga0070687_100430375
302 Ga0070669_100061605
303 Ga0070669_100180673
304 Ga0070671_100226543
305 Ga0070673_100250516
306 Ga0070673_101671284
307 Ga0070688_100045236
308 Ga0070659_100091458
309 Ga0070694_100109908
310 Ga0070694_100191812
311 Ga0070663_101788588
312 Ga0070681_10063703
313 Ga0070706_100289024
314 Ga0070706_102162234
315 Ga0070707_102331744
316 Ga0070699_100204898
317 Ga0070697_102074958
318 Ga0070672_100432637
319 Ga0070686_100035617
320 Ga0070695_100113043
321 Ga0070696_100535198
322 Ga0070696_101534071
323 Ga0070693_100963007
324 Ga0070665_101698016
325 Ga0070704_100151874
326 Ga0068854_100081301
327 Ga0068854_100552270
328 Ga0070702_100128492
329 Ga0068861_100232501
330 Ga0068861_100514769
331 Ga0068870_10021436
332 Ga0068863_100379743
333 Ga0068858_100301087
334 Ga0068860_100430500
335 Ga0068860_101961847
336 Ga0068862_100182022
337 Ga0081539_10028092
338 Ga0075432_10186790
339 Ga0075428_100002092
340 Ga0075430_100049273
341 Ga0075430_100076053
342 Ga0075431_100000701
343 Ga0075433_10495716
344 Ga0075433_10761791
345 Ga0099794_10151639
346 Ga0105250_10611030
347 Ga0105240_10088558
348 Ga0105240_10227499
349 Ga0105240_10686647
350 Ga0111539_10015238
351 Ga0111539_10017543
352 Ga0111539_11933164
353 Ga0111539_13029956
354 Ga0105247_10538837
355 Ga0114129_10013577
356 Ga0114129_11939976
357 Ga0105241_10029825
358 Ga0105248_10045472
359 Ga0105248_10138007
360 Ga0105248_10667792
361 Ga0105248_10759032
362 Ga0105238_11495647
363 Ga0105249_10182218
364 Ga0105249_10745688
365 Ga0105239_10944985
366 Ga0157317_1014133
367 Ga0157373_10405141
368 Ga0157375_10055939
369 Ga0157375_10612237
370 Ga0163163_10747530
371 Ga0157380_10502883
372 Ga0182008_10261286
373 Ga0157377_10127048
374 Ga0157377_11066616
375 Ga0157379_10107650
376 Ga0157379_10110644
377 Ga0157376_10934111
378 Ga0207710_10348533
379 Ga0207688_10059447
380 Ga0207680_10036341
381 Ga0207645_10076062
382 Ga0207643_10013508
383 Ga0207684_10439465
384 Ga0207707_10026475
385 Ga0207695_10561550
386 Ga0207657_10090056
387 Ga0207646_11163237
388 Ga0207681_10629098
389 Ga0207687_10601404
390 Ga0207644_10304611
391 Ga0207690_10125066
392 Ga0207704_11963412
393 Ga0207691_10141219
394 Ga0207711_10232218
395 Ga0207711_10263467
396 Ga0207689_10018093
397 Ga0207667_12227428
398 Ga0207651_10571480
399 Ga0207712_10074669
400 Ga0207712_11584164
401 Ga0207712_11755166
402 Ga0207640_10008719
403 Ga0207640_10503698
404 Ga0207639_10954820
405 Ga0207639_12176960
406 Ga0207648_11178831
407 Ga0207675_100275426
408 Ga0207683_11491676
409 Ga0268265_10392527
410 Ga0268264_10304303
411 Ga0268264_11152138
412 Ga0307408_100111594
413 Ga0307408_100271823
414 Ga0307408_101836897
415 Ga0307405_10010206
416 Ga0307410_10290787
417 Ga0307406_10832498
418 Ga0307406_11413501
419 Ga0307407_10153796
420 Ga0307407_10583426
421 Ga0307412_10010975
422 Ga0307416_100253908
423 Ga0307416_101546418
424 Ga0307411_10017790
425 Ga0307411_11873739
426 Ga0307415_100071988
427 Ga0373950_0002879
428 Ga0373958_0020345
429 Ga0373959_0011227
430 Ga0373928_0008986
431 Ga0373929_0035195
432 Ga0373940_0022865
433 Ga0373949_0013563
434 Ga0373951_0006182
435 Ga0373952_0000151
436 Ga0373932_0006564
437 Ga0373939_0020537
438 Ga0373941_0018333
439 Ga0373960_0001359
440 Ga0373942_0001194
441 Ga0373961_0001049
442 Ga0373962_0110284
443 Ga0395900_1242763
444 Ga0395901_1396384
445 Ga0242420_064447
446 Ga0439439_0077649
447 Ga0439453_0030063
448 Ga0439453_0130118
449 Ga0439451_028146
450 Ga0439435_0270477
451 Ga0439464_0091517
452 Ga0439460_0022823
453 Ga0439460_0098215
454 Ga0450893_0090069
455 Ga0453683_0334854
456 Ga0451576_0014409
457 Ga0451576_0272830
458 Ga0495654_0311645
459 Ga0495622_0433841
460 Ga0496102_0187897
461 Ga0496103_0031931
462 Ga0496106_0221266
463 Ga0496107_0195988
464 Ga0496110_0851793
465 Ga0496112_0780814
466 Ga0501291_035129
467 Ga0501298_007311
468 Ga0501303_013591
469 Ga0501033_0059069
470 Ga0501036_0004596
471 Ga0501036_0341786
472 Ga0501037_0204450
473 Ga0501038_0118958
474 Ga0501039_0014136
475 Ga0501039_0088069
476 Ga0501040_0075177
477 Ga0501040_0300150
478 Ga0501040_1297856
479 Ga0501041_0006329
480 Ga0501042_0011247
481 Ga0501042_0187667
482 Ga0501042_0382275
483 Ga0501043_0112284
484 Ga0501046_0020538
485 Ga0501046_0207399
486 Ga0501048_0029725
487 Ga0501048_0065560
488 Ga0501048_0237368
489 Ga0501068_0082199
490 Ga0501070_0903581
491 Ga0501071_0063828
492 Ga0501071_0150794
493 Ga0501071_0242740
494 Ga0501072_0065012
495 Ga0501072_0304850
496 Ga0501072_0379610
497 Ga0501074_0550869
498 Ga0501075_0010577
499 Ga0501075_0103120
500 Ga0501076_0005824
501 Ga0501076_0074060
502 Ga0501076_0347515
503 Ga0501076_1448976
504 Ga0501077_0098393
505 Ga0501077_0321917
506 Ga0501077_0374878
507 Ga0501202_113050
508 Ga0501207_033652
509 Ga0501217_006841
510 Ga0501235_014772
511 Ga0501257_068192
512 Ga0501225_0031873
513 Ga0501079_0015887
514 Ga0501079_0061943
515 Ga0501080_0737281
516 Ga0501081_0007799
517 Ga0501081_0620092
518 Ga0501081_0742828
519 Ga0501081_1122365
520 Ga0501264_032926
521 Ga0501267_023251
522 Ga0501283_040139
523 Ga0501035_0276094
524 Ga0501035_0873461
525 Ga0501035_1413192
526 Ga0501045_0001144
527 Ga0501045_0190377
528 Ga0501045_0351081
529 nmdc:mga05p37_150240_c1
530 nmdc:mga05p37_172306_c1
531 nmdc:mga05p37_296474_c1
532 nmdc:mga05p37_397489_c1
533 nmdc:mga05p37_521016_c1
534 nmdc:mga09592_623467_c1
535 nmdc:mga0qj67_57177_c1
536 nmdc:mga0qj67_71733_c1
537 nmdc:mga06r32_1711053_c1
538 nmdc:mga06r32_2870_c1
539 nmdc:mga06r32_325679_c1
540 nmdc:mga06r32_955926_c1
541 nmdc:mga08y16_31596_c1
542 nmdc:mga08y16_630569_c1
543 nmdc:mga0n895_118245_c1
544 nmdc:mga0n895_1361218_c1
545 nmdc:mga0n895_229411_c1
546 nmdc:mga0rr50_403833_c1
547 nmdc:mga0rr50_839363_c1
548 nmdc:mga08x19_262267_c1
549 nmdc:mga08x19_69413_c1
550 nmdc:mga0a205_31490_c1
551 nmdc:mga0a205_315386_c1
552 nmdc:mga0a205_431364_c1
553 Ga0495655_0260334
554 Ga0501084_0081609
555 Ga0501084_0179976
556 Ga0590075_072316
557 Ga0590077_000163
558 Ga0590077_009435
559 Ga0590077_057941
560 Ga0501082_0007724
561 Ga0501082_0388830
562 Ga0501082_0481372
563 Ga0530510_0022431
564 Ga0530510_0125532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pwp-assembly2.cif.gz_B crystal structure of spermidine synthase from plasmodium falciparum in complex with spermidine 0.8491 31 63
2hte-assembly2.cif.gz_B the crystal structure of spermidine synthase from p. falciparum in complex with 5'-methylthioadenosine 0.8479 31 63
4cwa-assembly2.cif.gz_B structure of plasmodium falciparum spermidine synthase in complex with 1h-benzimidazole-2-pentanamine 0.8471 31 63
3b7p-assembly1.cif.gz_A crystal structure of spermidine synthase from plasmodium falciparum in complex with spermine 0.8439 31 63
3h3h-assembly1.cif.gz_B crystal structure of a snoal-like protein of unknown function (bth_ii0226) from burkholderia thailandensis e264 at 1.60 a resolution 0.8395 33 77
ID Description Score Start End Superfamily
af_P05030_388_532_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.869 37 65 3.40.1110.10
af_F4I312_1_529_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8455 44 73 2.130.10.10
af_Q00917_22_144_3.10.450.330 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8312 41 74 3.10.450.330
3h3hA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.83 33 77 3.10.450.50
af_A6PVA1_1_248_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8171 43 79 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A1G7WR28-F1-model_v4 Uncharacterized protein 0.9143 35 76
AF-A0A658G0Y2-F1-model_v4 deleted 0.9058 37 78
AF-K9VP04-F1-model_v4 Uncharacterized protein 0.9053 37 75 GO:0016020
AF-X1KDD8-F1-model_v4 Uncharacterized protein 0.9016 29 78
AF-A0A525CE26-F1-model_v4 Uncharacterized protein 0.9015 9 77

Map