F385217

General Info

Members Datasets Scaffolds Average Seq Length
282 195 564 259

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0150899|Ga0501077_0150899_515_1342
Length 275
Sequence MTPTDPLRRLERLPVEVLDPPDALARAVAERIANLIRSRASEGRGCVLGLATGSTPVPTYAELVARHRAGRGPSFDGVQVFLLDEYVGLPPGHPQSYRSTIARELSDDLGLPADRVHGPDPTDLPTAGAAYESQLVEAGGVDLQVLGIGSDGHLAFNEPGSSLASTTRLKTLTETTRRDNARFFGSLDEVPRHVLTQGLGTILRARHLLLIATGASKAQAVAAAVEGPITASCPASVLQLHPHATVLLDADAAARLERAEHYREVYEHKPDWQGL

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
54 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
96 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 2508501039 Frankia saprophytica CN3 Isolate Nodule
178 2643221615 Nocardioides sp. Root224 Isolate Unclassified
179 2643221617 Nocardioides sp. Root79 Isolate Unclassified
180 2643221620 Nocardioides sp. Root240 Isolate Unclassified
181 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
182 2643221711 Terrabacter sp. Root85 Isolate Unclassified
183 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
184 2687453737 Frankia sp. BMG5.36 Isolate Nodule
185 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
186 2738541305 Nocardioides sp. CF167 Isolate Unclassified
187 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
188 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
189 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
190 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
191 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
192 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
193 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
194 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
195 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 0.71
Isolates 6.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.06
Nodule 1.42
Rhizoplane 10.64
Rhizosphere 69.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0150899 3300049593 Bacteria 1475
2 Ga0070658_10052196 3300005327 Bacteria 3315
3 Ga0070683_100012545 3300005329 Bacteria 7366
4 Ga0070680_100055770 3300005336 Bacteria 3229
5 Ga0070660_100159889 3300005339 Bacteria 1815
6 Ga0070661_100074625 3300005344 Bacteria 2498
7 Ga0070692_10108216 3300005345 Bacteria 1534
8 Ga0070667_100003661 3300005367 Bacteria 13082
9 Ga0070667_100012190 3300005367 Bacteria 7114
10 Ga0070709_10139435 3300005434 Bacteria 1664
11 Ga0070714_100004404 3300005435 Bacteria 10596
12 Ga0070714_100253669 3300005435 Bacteria 1627
13 Ga0070714_100271620 3300005435 Bacteria 1572
14 Ga0070714_100357566 3300005435 Bacteria 1372
15 Ga0070714_100413205 3300005435 Bacteria 1277
16 Ga0070713_100049452 3300005436 Bacteria 3468
17 Ga0070713_100087908 3300005436 Bacteria 2666
18 Ga0070713_100175372 3300005436 Bacteria 1923
19 Ga0070713_100415457 3300005436 Bacteria 1258
20 Ga0070710_10109301 3300005437 Bacteria 1658
21 Ga0070711_100269672 3300005439 Bacteria 1342
22 Ga0070663_100175519 3300005455 Bacteria 1659
23 Ga0070698_100008311 3300005471 Bacteria 11223
24 Ga0070698_100095136 3300005471 Bacteria 2957
25 Ga0068857_100024314 3300005577 Bacteria 5332
26 Ga0068856_100118218 3300005614 Bacteria 2652
27 Ga0068859_100005984 3300005617 Bacteria 12354
28 Ga0068863_100001103 3300005841 Bacteria 26991
29 Ga0081539_10102519 3300005985 Bacteria 1456
30 Ga0081539_10117704 3300005985 Bacteria 1325
31 Ga0075365_10015007 3300006038 Bacteria 4674
32 Ga0075365_10018016 3300006038 Bacteria 4335
33 Ga0075365_10129478 3300006038 Bacteria 1746
34 Ga0075365_10140901 3300006038 Bacteria 1674
35 Ga0075365_10180689 3300006038 Bacteria 1475
36 Ga0075365_10233401 3300006038 Bacteria 1292
37 Ga0075365_10250516 3300006038 Bacteria 1244
38 Ga0075365_10434479 3300006038 Bacteria 927
39 Ga0075363_100030135 3300006048 Bacteria 2806
40 Ga0075363_100160931 3300006048 Bacteria 1271
41 Ga0075364_10001373 3300006051 Bacteria 13146
42 Ga0075364_10019730 3300006051 Bacteria 4234
43 Ga0075364_10039236 3300006051 Bacteria 3069
44 Ga0070712_100105661 3300006175 Bacteria 2091
45 Ga0070712_100120864 3300006175 Bacteria 1970
46 Ga0075362_10041952 3300006177 Bacteria 2020
47 Ga0075367_10112286 3300006178 Bacteria 1674
48 Ga0075367_10161464 3300006178 Bacteria 1394
49 Ga0075370_10026834 3300006353 Bacteria 3192
50 Ga0075370_10137105 3300006353 Bacteria 1430
51 Ga0097620_100005984 3300006931 Bacteria 12354
52 Ga0105243_10162104 3300009148 Bacteria 1929
53 Ga0105243_11006780 3300009148 Bacteria 836
54 Ga0105248_10001200 3300009177 Bacteria 28950
55 Ga0157370_10070813 3300013104 Bacteria 3291
56 Ga0157369_10044969 3300013105 Bacteria 4804
57 Ga0157369_10086146 3300013105 Bacteria 3356
58 Ga0157369_10154961 3300013105 Bacteria 2420
59 Ga0157375_10178405 3300013308 Bacteria 2275
60 Ga0157375_10181960 3300013308 Bacteria 2254
61 Ga0157375_10855633 3300013308 Bacteria 1056
62 Ga0163163_10080327 3300014325 Bacteria 3261
63 Ga0157380_10005538 3300014326 Bacteria 8828
64 Ga0163161_10410344 3300017792 Bacteria 1088
65 Ga0206354_11581465 3300020081 Bacteria 3835
66 Ga0206353_10274379 3300020082 Bacteria 1003
67 Ga0207657_10098321 3300025919 Bacteria 2432
68 Ga0207657_10246112 3300025919 Bacteria 1426
69 Ga0207652_10104442 3300025921 Bacteria 2506
70 Ga0207646_10434135 3300025922 Bacteria 1185
71 Ga0207700_10002644 3300025928 Bacteria 10313
72 Ga0207700_10307419 3300025928 Bacteria 1371
73 Ga0207664_10004991 3300025929 Bacteria 9017
74 Ga0207664_10131885 3300025929 Bacteria 2104
75 Ga0207664_10200859 3300025929 Bacteria 1721
76 Ga0207664_10356870 3300025929 Bacteria 1294
77 Ga0207709_10107725 3300025935 Bacteria 1856
78 Ga0207711_10000139 3300025941 Bacteria 77476
79 Ga0207661_10078493 3300025944 Bacteria 2718
80 Ga0207661_10335550 3300025944 Bacteria 1361
81 Ga0207658_10006389 3300025986 Bacteria 8050
82 Ga0207678_10005140 3300026067 Bacteria 11727
83 Ga0207702_10438482 3300026078 Bacteria 1266
84 Ga0207641_10006155 3300026088 Bacteria 10154
85 Ga0207674_10052163 3300026116 Bacteria 4171
86 Ga0207674_10103193 3300026116 Bacteria 2831
87 Ga0268264_10000354 3300028381 Bacteria 69023
88 Ga0265337_1000751 3300028556 Bacteria 17116
89 Ga0265319_1013054 3300028563 Bacteria 3324
90 Ga0265334_10007811 3300028573 Bacteria 4577
91 Ga0265318_10074860 3300028577 Bacteria 1253
92 Ga0265323_10006579 3300028653 Bacteria 4880
93 Ga0265336_10086713 3300028666 Bacteria 933
94 Ga0265338_10002151 3300028800 Bacteria 30267
95 Ga0265338_10002709 3300028800 Bacteria 25994
96 Ga0265338_10017218 3300028800 Bacteria 7805
97 Ga0265338_10362786 3300028800 Bacteria 1039
98 Ga0265324_10001636 3300029957 Bacteria 12390
99 Ga0265332_10005125 3300031238 Bacteria 6072
100 Ga0265320_10001589 3300031240 Bacteria 16321
101 Ga0265325_10008953 3300031241 Bacteria 5879
102 Ga0265340_10021552 3300031247 Bacteria 3305
103 Ga0265316_10025383 3300031344 Bacteria 4946
104 Ga0307408_100169410 3300031548 Bacteria 1742
105 Ga0307408_100223873 3300031548 Bacteria 1536
106 Ga0265313_10007994 3300031595 Bacteria 7103
107 Ga0265314_10021465 3300031711 Bacteria 4963
108 Ga0265342_10016404 3300031712 Bacteria 4843
109 Ga0316576_10104786 3300031727 Bacteria 2117
110 Ga0316578_10017721 3300031728 Bacteria 3882
111 Ga0307405_10002448 3300031731 Bacteria 8180
112 Ga0307405_10231993 3300031731 Bacteria 1361
113 Ga0316577_10219511 3300031733 Bacteria 1075
114 Ga0307410_10076396 3300031852 Bacteria 2338
115 Ga0307410_10575513 3300031852 Bacteria 936
116 Ga0307406_10181227 3300031901 Bacteria 1534
117 Ga0307407_10008723 3300031903 Bacteria 4673
118 Ga0307407_10166748 3300031903 Bacteria 1447
119 Ga0307412_10003924 3300031911 Bacteria 8282
120 Ga0307415_100264017 3300032126 Bacteria 1406
121 Ga0316585_10025747 3300032137 Bacteria 1826
122 Ga0373951_0056827 3300035091 Bacteria 973
123 Ga0373954_0008632 3300035118 Bacteria 4481
124 Ga0373956_0065657 3300035119 Bacteria 1649
125 Ga0373955_0067007 3300035172 Bacteria 1997
126 Ga0316574_0014150 3300035398 Bacteria 4603
127 Ga0316574_0031913 3300035398 Bacteria 3198
128 Ga0316574_0138839 3300035398 Bacteria 1565
129 Ga0373924_0021671 3300035410 Bacteria 2507
130 Ga0373935_0176400 3300035692 Bacteria 1465
131 Ga0373933_0010242 3300035724 Bacteria 5136
132 Ga0373937_0013082 3300036401 Bacteria 7308
133 Ga0373925_0000001 3300037068 Bacteria 402692
134 Ga0395900_0071732 3300037418 Bacteria 3561
135 Ga0395898_0042622 3300037466 Bacteria 4476
136 Ga0395905_0532833 3300037471 Bacteria 1075
137 Ga0395901_0052539 3300038443 Bacteria 4235
138 Ga0395901_0305648 3300038443 Bacteria 1648
139 Ga0436360_1311813 3300039438 Bacteria 1713
140 Ga0439466_0036581 3300041411 Bacteria 1657
141 Ga0439457_015192 3300042014 Bacteria 1721
142 Ga0439462_0074855 3300042015 Bacteria 921
143 Ga0450907_003130 3300042146 Bacteria 2998
144 Ga0466965_0045299 3300044683 Bacteria 2175
145 Ga0466965_0072099 3300044683 Bacteria 1738
146 Ga0466966_0198343 3300044684 Bacteria 1215
147 Ga0466961_0107311 3300044693 Bacteria 1758
148 Ga0466957_0112882 3300044842 Bacteria 1725
149 Ga0466960_0000880 3300044901 Bacteria 10608
150 Ga0466960_0131099 3300044901 Bacteria 1323
151 Ga0466960_0192913 3300044901 Bacteria 1109
152 Ga0466967_0174372 3300045976 Bacteria 2025
153 Ga0466967_0415404 3300045976 Bacteria 1311
154 Ga0495590_0000456 3300046457 Bacteria 20157
155 Ga0495651_0020758 3300046462 Bacteria 5099
156 Ga0495653_0013152 3300046463 Bacteria 6748
157 Ga0495608_0037417 3300046511 Bacteria 3263
158 Ga0495618_0039057 3300046514 Bacteria 2984
159 Ga0495652_0040648 3300046529 Bacteria 4019
160 Ga0495640_0138798 3300046533 Bacteria 1568
161 Ga0495587_0059615 3300046536 Bacteria 2239
162 Ga0495667_0004094 3300046559 Bacteria 9793
163 Ga0495634_0059045 3300046642 Bacteria 2556
164 Ga0495635_0068062 3300046663 Bacteria 2442
165 Ga0495646_0190226 3300046680 Bacteria 1122
166 Ga0495600_0187458 3300046809 Bacteria 1331
167 Ga0495604_0061472 3300047317 Bacteria 2873
168 Ga0495672_0007860 3300047320 Bacteria 7961
169 Ga0495672_0032961 3300047320 Bacteria 3215
170 Ga0495680_0178409 3300047322 Bacteria 1534
171 Ga0495684_0012717 3300047471 Bacteria 6497
172 Ga0495602_0226726 3300048088 Bacteria 1406
173 Ga0496100_0031510 3300048903 Bacteria 3297
174 Ga0496101_0012270 3300048904 Bacteria 5713
175 Ga0496101_0108587 3300048904 Bacteria 2086
176 Ga0496102_0008257 3300048905 Bacteria 8918
177 Ga0496103_0004520 3300048906 Bacteria 8429
178 Ga0496104_0002208 3300048907 Bacteria 16834
179 Ga0496104_0028914 3300048907 Bacteria 5140
180 Ga0496104_0064235 3300048907 Bacteria 3482
181 Ga0496105_0009716 3300048908 Bacteria 7535
182 Ga0496105_0116509 3300048908 Bacteria 2204
183 Ga0496105_0117513 3300048908 Bacteria 2193
184 Ga0496106_0040210 3300048909 Bacteria 3502
185 Ga0496107_0697545 3300048910 Bacteria 747
186 Ga0496108_0014992 3300048911 Bacteria 6326
187 Ga0496108_0055619 3300048911 Bacteria 3323
188 Ga0496108_0063422 3300048911 Bacteria 3112
189 Ga0496110_0019585 3300048913 Bacteria 5699
190 Ga0496110_0322391 3300048913 Bacteria 1407
191 Ga0496110_0467831 3300048913 Bacteria 1149
192 Ga0496110_0478705 3300048913 Bacteria 1134
193 Ga0496111_0163813 3300048914 Bacteria 1651
194 Ga0496112_0037421 3300048915 Bacteria 4737
195 Ga0496112_0115975 3300048915 Bacteria 2649
196 Ga0496113_0221155 3300048916 Bacteria 1509
197 Ga0496114_0033412 3300048917 Bacteria 4238
198 Ga0496114_0034008 3300048917 Bacteria 4203
199 Ga0496114_0081185 3300048917 Bacteria 2739
200 Ga0496114_0094246 3300048917 Bacteria 2546
201 Ga0496114_0229882 3300048917 Bacteria 1629
202 Ga0496115_0104536 3300048918 Bacteria 2324
203 Ga0496118_0005564 3300048921 Bacteria 14270
204 Ga0496119_0131204 3300048922 Bacteria 1365
205 Ga0496119_0238433 3300048922 Bacteria 922
206 Ga0496126_0053284 3300048929 Bacteria 3671
207 Ga0501031_0093615 3300049568 Bacteria 1961
208 Ga0501032_0198710 3300049569 Bacteria 1309
209 Ga0501033_0002852 3300049570 Bacteria 14483
210 Ga0501036_0011681 3300049572 Bacteria 7278
211 Ga0501037_0001756 3300049573 Bacteria 15756
212 Ga0501037_0006102 3300049573 Bacteria 8804
213 Ga0501038_0003412 3300049574 Bacteria 14806
214 Ga0501039_0460853 3300049575 Bacteria 998
215 Ga0501040_0158935 3300049576 Bacteria 1597
216 Ga0501041_0087363 3300049577 Bacteria 1924
217 Ga0501041_0165333 3300049577 Bacteria 1384
218 Ga0501042_0006944 3300049578 Bacteria 7389
219 Ga0501042_0402245 3300049578 Bacteria 992
220 Ga0501043_0006753 3300049579 Bacteria 9162
221 Ga0501043_0068041 3300049579 Bacteria 2796
222 Ga0501046_0003024 3300049580 Bacteria 15538
223 Ga0501046_0007961 3300049580 Bacteria 9273
224 Ga0501047_0122182 3300049581 Bacteria 2485
225 Ga0501048_0002376 3300049582 Bacteria 14366
226 Ga0501068_0188477 3300049584 Bacteria 1306
227 Ga0501069_0275639 3300049585 Bacteria 984
228 Ga0501070_0006086 3300049586 Bacteria 10281
229 Ga0501070_0049925 3300049586 Bacteria 3473
230 Ga0501070_0096181 3300049586 Bacteria 2450
231 Ga0501070_0219779 3300049586 Bacteria 1558
232 Ga0501071_0001998 3300049587 Bacteria 12189
233 Ga0501071_0074243 3300049587 Bacteria 2482
234 Ga0501073_0025258 3300049589 Bacteria 4263
235 Ga0501073_0064325 3300049589 Bacteria 2558
236 Ga0501074_0360891 3300049590 Bacteria 1031
237 Ga0501074_0452140 3300049590 Bacteria 911
238 Ga0501076_0071273 3300049592 Bacteria 2780
239 Ga0501080_0047040 3300049742 Bacteria 4016
240 Ga0501080_0563700 3300049742 Bacteria 1014
241 Ga0501083_0238153 3300049744 Bacteria 1185
242 Ga0501045_0064580 3300049824 Bacteria 2687
243 Ga0501045_0387453 3300049824 Bacteria 1040
244 nmdc:mga03n38_17796_c1 3300050490 Bacteria 2790
245 nmdc:mga03n38_49678_c1 3300050490 Bacteria 1866
246 nmdc:mga00v17_2725_c1 3300050491 Bacteria 9068
247 nmdc:mga0yw44_10858_c1 3300050492 Bacteria 4669
248 nmdc:mga0yw44_155177_c1 3300050492 Bacteria 1496
249 nmdc:mga0yw44_207584_c1 3300050492 Bacteria 1295
250 nmdc:mga0yw44_279475_c1 3300050492 Bacteria 1116
251 nmdc:mga0yw44_342698_c1 3300050492 Bacteria 1005
252 nmdc:mga0yw44_369031_c1 3300050492 Bacteria 968
253 nmdc:mga07m45_59776_c1 3300050496 Bacteria 2156
254 nmdc:mga0rr50_161560_c1 3300050513 Bacteria 1818
255 Ga0495612_0152975 3300053078 Bacteria 1005
256 Ga0495595_0173826 3300053084 Bacteria 1067
257 Ga0500556_0000972 3300053104 Bacteria 15260
258 Ga0500556_0001259 3300053104 Bacteria 11657
259 Ga0500593_000132 3300053117 Bacteria 29758
260 Ga0500559_0003645 3300053136 Bacteria 7529
261 Ga0500559_0050057 3300053136 Bacteria 1842
262 Ga0500573_0000584 3300053140 Bacteria 16001
263 Ga0501084_0188160 3300054114 Bacteria 1742
264 2508677827 2508501039 Bacteria 9978592
265 2644092783 2643221615 Bacteria 5487866
266 2644099701 2643221617 Bacteria 5139111
267 2644116587 2643221620 Bacteria 5134593
268 2644322396 2643221657 Bacteria 5490246
269 2644608364 2643221711 Bacteria 4865335
270 2676204102 2675902999 Bacteria 9438463
271 2689962062 2687453737 Bacteria 11203906
272 2691515550 2690315906 Bacteria 4517044
273 2738870378 2738541305 Bacteria 4910150
274 2774848678 2773857921 Bacteria 9435764
275 2775657574 2775506735 Bacteria 4556596
276 2808828678 2808606357 Bacteria 4466944
277 2808849945 2808606360 Bacteria 4404006
278 2808892948 2808606370 Bacteria 4942454
279 2808898978 2808606371 Bacteria 4251511
280 2812319603 2811994871 Bacteria 4497550
281 2946061190 2946059875 Bacteria 4386623
282 2977264923 2977264416 Bacteria 3750737
283 Ga0501077_0150899
284 Ga0070658_10052196
285 Ga0070683_100012545
286 Ga0070680_100055770
287 Ga0070660_100159889
288 Ga0070661_100074625
289 Ga0070692_10108216
290 Ga0070667_100003661
291 Ga0070667_100012190
292 Ga0070709_10139435
293 Ga0070714_100004404
294 Ga0070714_100253669
295 Ga0070714_100271620
296 Ga0070714_100357566
297 Ga0070714_100413205
298 Ga0070713_100049452
299 Ga0070713_100087908
300 Ga0070713_100175372
301 Ga0070713_100415457
302 Ga0070710_10109301
303 Ga0070711_100269672
304 Ga0070663_100175519
305 Ga0070698_100008311
306 Ga0070698_100095136
307 Ga0068857_100024314
308 Ga0068856_100118218
309 Ga0068859_100005984
310 Ga0068863_100001103
311 Ga0081539_10102519
312 Ga0081539_10117704
313 Ga0075365_10015007
314 Ga0075365_10018016
315 Ga0075365_10129478
316 Ga0075365_10140901
317 Ga0075365_10180689
318 Ga0075365_10233401
319 Ga0075365_10250516
320 Ga0075365_10434479
321 Ga0075363_100030135
322 Ga0075363_100160931
323 Ga0075364_10001373
324 Ga0075364_10019730
325 Ga0075364_10039236
326 Ga0070712_100105661
327 Ga0070712_100120864
328 Ga0075362_10041952
329 Ga0075367_10112286
330 Ga0075367_10161464
331 Ga0075370_10026834
332 Ga0075370_10137105
333 Ga0097620_100005984
334 Ga0105243_10162104
335 Ga0105243_11006780
336 Ga0105248_10001200
337 Ga0157370_10070813
338 Ga0157369_10044969
339 Ga0157369_10086146
340 Ga0157369_10154961
341 Ga0157375_10178405
342 Ga0157375_10181960
343 Ga0157375_10855633
344 Ga0163163_10080327
345 Ga0157380_10005538
346 Ga0163161_10410344
347 Ga0206354_11581465
348 Ga0206353_10274379
349 Ga0207657_10098321
350 Ga0207657_10246112
351 Ga0207652_10104442
352 Ga0207646_10434135
353 Ga0207700_10002644
354 Ga0207700_10307419
355 Ga0207664_10004991
356 Ga0207664_10131885
357 Ga0207664_10200859
358 Ga0207664_10356870
359 Ga0207709_10107725
360 Ga0207711_10000139
361 Ga0207661_10078493
362 Ga0207661_10335550
363 Ga0207658_10006389
364 Ga0207678_10005140
365 Ga0207702_10438482
366 Ga0207641_10006155
367 Ga0207674_10052163
368 Ga0207674_10103193
369 Ga0268264_10000354
370 Ga0265337_1000751
371 Ga0265319_1013054
372 Ga0265334_10007811
373 Ga0265318_10074860
374 Ga0265323_10006579
375 Ga0265336_10086713
376 Ga0265338_10002151
377 Ga0265338_10002709
378 Ga0265338_10017218
379 Ga0265338_10362786
380 Ga0265324_10001636
381 Ga0265332_10005125
382 Ga0265320_10001589
383 Ga0265325_10008953
384 Ga0265340_10021552
385 Ga0265316_10025383
386 Ga0307408_100169410
387 Ga0307408_100223873
388 Ga0265313_10007994
389 Ga0265314_10021465
390 Ga0265342_10016404
391 Ga0316576_10104786
392 Ga0316578_10017721
393 Ga0307405_10002448
394 Ga0307405_10231993
395 Ga0316577_10219511
396 Ga0307410_10076396
397 Ga0307410_10575513
398 Ga0307406_10181227
399 Ga0307407_10008723
400 Ga0307407_10166748
401 Ga0307412_10003924
402 Ga0307415_100264017
403 Ga0316585_10025747
404 Ga0373951_0056827
405 Ga0373954_0008632
406 Ga0373956_0065657
407 Ga0373955_0067007
408 Ga0316574_0014150
409 Ga0316574_0031913
410 Ga0316574_0138839
411 Ga0373924_0021671
412 Ga0373935_0176400
413 Ga0373933_0010242
414 Ga0373937_0013082
415 Ga0373925_0000001
416 Ga0395900_0071732
417 Ga0395898_0042622
418 Ga0395905_0532833
419 Ga0395901_0052539
420 Ga0395901_0305648
421 Ga0436360_1311813
422 Ga0439466_0036581
423 Ga0439457_015192
424 Ga0439462_0074855
425 Ga0450907_003130
426 Ga0466965_0045299
427 Ga0466965_0072099
428 Ga0466966_0198343
429 Ga0466961_0107311
430 Ga0466957_0112882
431 Ga0466960_0000880
432 Ga0466960_0131099
433 Ga0466960_0192913
434 Ga0466967_0174372
435 Ga0466967_0415404
436 Ga0495590_0000456
437 Ga0495651_0020758
438 Ga0495653_0013152
439 Ga0495608_0037417
440 Ga0495618_0039057
441 Ga0495652_0040648
442 Ga0495640_0138798
443 Ga0495587_0059615
444 Ga0495667_0004094
445 Ga0495634_0059045
446 Ga0495635_0068062
447 Ga0495646_0190226
448 Ga0495600_0187458
449 Ga0495604_0061472
450 Ga0495672_0007860
451 Ga0495672_0032961
452 Ga0495680_0178409
453 Ga0495684_0012717
454 Ga0495602_0226726
455 Ga0496100_0031510
456 Ga0496101_0012270
457 Ga0496101_0108587
458 Ga0496102_0008257
459 Ga0496103_0004520
460 Ga0496104_0002208
461 Ga0496104_0028914
462 Ga0496104_0064235
463 Ga0496105_0009716
464 Ga0496105_0116509
465 Ga0496105_0117513
466 Ga0496106_0040210
467 Ga0496107_0697545
468 Ga0496108_0014992
469 Ga0496108_0055619
470 Ga0496108_0063422
471 Ga0496110_0019585
472 Ga0496110_0322391
473 Ga0496110_0467831
474 Ga0496110_0478705
475 Ga0496111_0163813
476 Ga0496112_0037421
477 Ga0496112_0115975
478 Ga0496113_0221155
479 Ga0496114_0033412
480 Ga0496114_0034008
481 Ga0496114_0081185
482 Ga0496114_0094246
483 Ga0496114_0229882
484 Ga0496115_0104536
485 Ga0496118_0005564
486 Ga0496119_0131204
487 Ga0496119_0238433
488 Ga0496126_0053284
489 Ga0501031_0093615
490 Ga0501032_0198710
491 Ga0501033_0002852
492 Ga0501036_0011681
493 Ga0501037_0001756
494 Ga0501037_0006102
495 Ga0501038_0003412
496 Ga0501039_0460853
497 Ga0501040_0158935
498 Ga0501041_0087363
499 Ga0501041_0165333
500 Ga0501042_0006944
501 Ga0501042_0402245
502 Ga0501043_0006753
503 Ga0501043_0068041
504 Ga0501046_0003024
505 Ga0501046_0007961
506 Ga0501047_0122182
507 Ga0501048_0002376
508 Ga0501068_0188477
509 Ga0501069_0275639
510 Ga0501070_0006086
511 Ga0501070_0049925
512 Ga0501070_0096181
513 Ga0501070_0219779
514 Ga0501071_0001998
515 Ga0501071_0074243
516 Ga0501073_0025258
517 Ga0501073_0064325
518 Ga0501074_0360891
519 Ga0501074_0452140
520 Ga0501076_0071273
521 Ga0501080_0047040
522 Ga0501080_0563700
523 Ga0501083_0238153
524 Ga0501045_0064580
525 Ga0501045_0387453
526 nmdc:mga03n38_17796_c1
527 nmdc:mga03n38_49678_c1
528 nmdc:mga00v17_2725_c1
529 nmdc:mga0yw44_10858_c1
530 nmdc:mga0yw44_155177_c1
531 nmdc:mga0yw44_207584_c1
532 nmdc:mga0yw44_279475_c1
533 nmdc:mga0yw44_342698_c1
534 nmdc:mga0yw44_369031_c1
535 nmdc:mga07m45_59776_c1
536 nmdc:mga0rr50_161560_c1
537 Ga0495612_0152975
538 Ga0495595_0173826
539 Ga0500556_0000972
540 Ga0500556_0001259
541 Ga0500593_000132
542 Ga0500559_0003645
543 Ga0500559_0050057
544 Ga0500573_0000584
545 Ga0501084_0188160
546 2508677827
547 2644092783
548 2644099701
549 2644116587
550 2644322396
551 2644608364
552 2676204102
553 2689962062
554 2691515550
555 2738870378
556 2774848678
557 2775657574
558 2808828678
559 2808849945
560 2808892948
561 2808898978
562 2812319603
563 2946061190
564 2977264923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

19

247

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hn6-assembly1.cif.gz_D crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi 0.9648 1 253
3hn6-assembly1.cif.gz_E crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi 0.9544 1 253
7lqn-assembly2.cif.gz_I glucosamine-6-phosphate deaminase from h. influenzae 0.9533 1 252
4r7t-assembly1.cif.gz_B crystal structure of glucosamine-6-phosphate deaminase from vibrio cholerae 0.9528 1 253
2ri0-assembly2.cif.gz_B crystal structure of glucosamine 6-phosphate deaminase (nagb) from s. mutans 0.9504 1 242
ID Description Score Start End Superfamily
af_Q04802_1_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9509 1 240 3.40.50.1360
2ri0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9503 1 242 3.40.50.1360
2bkxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.943 1 242 3.40.50.1360
2ri0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9425 1 242 3.40.50.1360
af_M0RCH5_1_250_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9395 36 253 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A421B3W9-F1-model_v4 Glucosamine-6-phosphate deaminase 0.9872 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-U5ECU6-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.9867 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A7X6HCG4-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.9857 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-E2Q767-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.9846 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A421B3W9-F1-model_v4 Glucosamine-6-phosphate deaminase 0.9835 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802

Map