F385126

General Info

Members Datasets Scaffolds Average Seq Length
282 144 564 153

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0481817|Ga0466960_0481817_211_681
Length 141
Sequence MSAPQQGWHARLAELGIRLPSVAAPVASYVPAVRSGSLVFTGLRRTGKVGGSVDAEGAAADAKVCALNALAAVGDLVGLDSIVGYVASAEGFSGQPRVVNGASELLGKIFGPRGEHARSAVGVAELPMNSPVEVELTVELK

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
60 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
61 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
62 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
63 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
85 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
86 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
104 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
120 2558860280 Kutzneria sp. 744 Isolate Unclassified
121 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
122 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
123 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
124 2643221692 Nocardia sp. Root136 Isolate Unclassified
125 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
126 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
127 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
128 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
129 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
130 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
131 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
132 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
133 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
134 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
135 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
136 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
137 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
138 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
139 2922554459 Rhodococcus sp. 66b Isolate Unclassified
140 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
141 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
142 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
143 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
144 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.01
Metatranscriptomes 1.42
Isolates 9.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 3.19
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0481817 3300044901 Bacteria 725
2 Ga0070658_10030412 3300005327 Bacteria 4338
3 Ga0070658_11270242 3300005327 Bacteria 640
4 Ga0070683_100055603 3300005329 Bacteria 3673
5 Ga0070680_101127049 3300005336 Bacteria 678
6 Ga0070682_100878363 3300005337 Bacteria 735
7 Ga0068868_100055041 3300005338 Bacteria 3138
8 Ga0070668_100014478 3300005347 Bacteria 5895
9 Ga0070675_100891370 3300005354 Bacteria 815
10 Ga0070659_100299417 3300005366 Bacteria 1341
11 Ga0070714_101220896 3300005435 Bacteria 733
12 Ga0070714_101396383 3300005435 Bacteria 684
13 Ga0070714_101486186 3300005435 Bacteria 662
14 Ga0070710_10000597 3300005437 Bacteria 17198
15 Ga0070663_100015651 3300005455 Bacteria 4904
16 Ga0070663_100171981 3300005455 Bacteria 1675
17 Ga0070663_100371067 3300005455 Bacteria 1163
18 Ga0070681_10532118 3300005458 Bacteria 1089
19 Ga0070679_100089686 3300005530 Bacteria 3062
20 Ga0070679_100136724 3300005530 Bacteria 2432
21 Ga0070679_100989963 3300005530 Bacteria 785
22 Ga0070684_100199153 3300005535 Bacteria 1824
23 Ga0070684_100257423 3300005535 Bacteria 1596
24 Ga0070684_100433485 3300005535 Bacteria 1214
25 Ga0068853_100638443 3300005539 Bacteria 1013
26 Ga0068853_100931123 3300005539 Bacteria 835
27 Ga0070686_100337771 3300005544 Bacteria 1128
28 Ga0070665_102484965 3300005548 Bacteria 520
29 Ga0068855_100742102 3300005563 Bacteria 1047
30 Ga0068854_101393275 3300005578 Bacteria 634
31 Ga0068856_101551323 3300005614 Bacteria 676
32 Ga0068852_100481555 3300005616 Bacteria 1233
33 Ga0068852_100488358 3300005616 Bacteria 1225
34 Ga0068852_100960259 3300005616 Bacteria 873
35 Ga0068851_10221087 3300005834 Bacteria 1064
36 Ga0068870_10151067 3300005840 Bacteria 1368
37 Ga0081539_10000027 3300005985 Bacteria 328691
38 Ga0097621_101169438 3300006237 Bacteria 724
39 Ga0105245_10529894 3300009098 Bacteria 1197
40 Ga0105238_10183626 3300009551 Bacteria 2068
41 Ga0105249_12892947 3300009553 Bacteria 551
42 Ga0157370_10382979 3300013104 Bacteria 1295
43 Ga0157369_10036824 3300013105 Bacteria 5359
44 Ga0157369_10486365 3300013105 Bacteria 1277
45 Ga0157374_10498110 3300013296 Bacteria 1223
46 Ga0157372_10282380 3300013307 Bacteria 1930
47 Ga0157372_11239931 3300013307 Bacteria 861
48 Ga0206354_10099075 3300020081 Bacteria 4487
49 Ga0206353_10698831 3300020082 Bacteria 3584
50 Ga0206353_10717764 3300020082 Bacteria 1745
51 Ga0206353_11579721 3300020082 Bacteria 1183
52 Ga0207688_10238451 3300025901 Bacteria 1099
53 Ga0207647_10062610 3300025904 Bacteria 2266
54 Ga0207647_10246237 3300025904 Bacteria 1026
55 Ga0207647_10344093 3300025904 Bacteria 845
56 Ga0207705_10064145 3300025909 Bacteria 2655
57 Ga0207705_10724051 3300025909 Bacteria 773
58 Ga0207663_10923778 3300025916 Bacteria 698
59 Ga0207660_11126717 3300025917 Bacteria 639
60 Ga0207657_10519834 3300025919 Bacteria 932
61 Ga0207649_11049516 3300025920 Bacteria 642
62 Ga0207652_10415447 3300025921 Bacteria 1213
63 Ga0207652_10999996 3300025921 Bacteria 735
64 Ga0207659_10660465 3300025926 Bacteria 894
65 Ga0207664_10289118 3300025929 Bacteria 1440
66 Ga0207664_11312592 3300025929 Bacteria 643
67 Ga0207661_10396321 3300025944 Bacteria 1251
68 Ga0207667_10182663 3300025949 Bacteria 2153
69 Ga0207668_10048197 3300025972 Bacteria 2922
70 Ga0207677_10075286 3300026023 Bacteria 2398
71 Ga0207703_10674570 3300026035 Bacteria 982
72 Ga0207639_10415657 3300026041 Bacteria 1215
73 Ga0207639_10894301 3300026041 Bacteria 830
74 Ga0207678_10000054 3300026067 Bacteria 87616
75 Ga0207678_10142275 3300026067 Bacteria 2047
76 Ga0207678_10368412 3300026067 Bacteria 1241
77 Ga0207708_10197040 3300026075 Bacteria 1605
78 Ga0207702_10306847 3300026078 Bacteria 1508
79 Ga0207674_10088614 3300026116 Bacteria 3087
80 Ga0207674_10547729 3300026116 Bacteria 1117
81 Ga0207698_10475961 3300026142 Bacteria 1210
82 Ga0268266_10966968 3300028379 Bacteria 824
83 Ga0307515_10046436 3300028794 Bacteria 6638
84 Ga0307512_10339161 3300030522 Bacteria 670
85 Ga0316176_1130975 3300030732 Bacteria 6512
86 Ga0314311_1086713 3300030733 Bacteria 5844
87 Ga0316180_1084180 3300030736 Bacteria 615
88 Ga0316180_1107919 3300030736 Bacteria 596
89 Ga0316182_1438379 3300030745 Bacteria 991
90 Ga0307509_10092976 3300031507 Bacteria 3081
91 Ga0307408_100161524 3300031548 Bacteria 1780
92 Ga0307408_100558789 3300031548 Bacteria 1011
93 Ga0307405_10047469 3300031731 Bacteria 2644
94 Ga0307405_10112358 3300031731 Bacteria 1848
95 Ga0307405_10863515 3300031731 Bacteria 763
96 Ga0307413_10024920 3300031824 Bacteria 3269
97 Ga0307413_10046335 3300031824 Bacteria 2584
98 Ga0307413_10179125 3300031824 Bacteria 1509
99 Ga0307410_10025835 3300031852 Bacteria 3689
100 Ga0307410_10072580 3300031852 Bacteria 2390
101 Ga0307410_10295247 3300031852 Bacteria 1277
102 Ga0307410_10469404 3300031852 Bacteria 1030
103 Ga0307410_11011938 3300031852 Bacteria 717
104 Ga0307410_11579383 3300031852 Bacteria 579
105 Ga0307406_10016228 3300031901 Bacteria 4324
106 Ga0307406_10380814 3300031901 Bacteria 1112
107 Ga0307406_11175363 3300031901 Bacteria 665
108 Ga0307407_10121158 3300031903 Bacteria 1658
109 Ga0307407_10128066 3300031903 Bacteria 1620
110 Ga0307407_10153037 3300031903 Bacteria 1501
111 Ga0307407_10189058 3300031903 Bacteria 1371
112 Ga0307407_10269789 3300031903 Bacteria 1174
113 Ga0307407_10612608 3300031903 Bacteria 812
114 Ga0307407_10631714 3300031903 Bacteria 800
115 Ga0307407_10780969 3300031903 Bacteria 725
116 Ga0307412_10116067 3300031911 Bacteria 1920
117 Ga0307412_10151408 3300031911 Bacteria 1712
118 Ga0307409_100064569 3300031995 Bacteria 2876
119 Ga0307409_100073484 3300031995 Bacteria 2727
120 Ga0307409_100177501 3300031995 Bacteria 1882
121 Ga0307409_100211450 3300031995 Bacteria 1743
122 Ga0307409_100360519 3300031995 Bacteria 1375
123 Ga0307409_100656013 3300031995 Bacteria 1044
124 Ga0307409_100830688 3300031995 Bacteria 933
125 Ga0307409_100956753 3300031995 Bacteria 872
126 Ga0307409_101339903 3300031995 Bacteria 741
127 Ga0307409_101717474 3300031995 Bacteria 656
128 Ga0307416_100050265 3300032002 Bacteria 3322
129 Ga0307416_100107800 3300032002 Bacteria 2446
130 Ga0307416_100187715 3300032002 Bacteria 1945
131 Ga0307416_100437886 3300032002 Bacteria 1356
132 Ga0307416_100533262 3300032002 Bacteria 1244
133 Ga0307416_100614183 3300032002 Bacteria 1168
134 Ga0307416_101132629 3300032002 Bacteria 887
135 Ga0307416_101344629 3300032002 Bacteria 820
136 Ga0307416_102335784 3300032002 Bacteria 635
137 Ga0307414_10137039 3300032004 Bacteria 1910
138 Ga0307414_10393829 3300032004 Bacteria 1201
139 Ga0307411_10112214 3300032005 Bacteria 1953
140 Ga0307411_10331551 3300032005 Bacteria 1233
141 Ga0307411_10794488 3300032005 Bacteria 833
142 Ga0307415_100046619 3300032126 Bacteria 2912
143 Ga0307415_100082658 3300032126 Bacteria 2298
144 Ga0307415_100202754 3300032126 Bacteria 1575
145 Ga0307415_100361930 3300032126 Bacteria 1225
146 Ga0307415_100408914 3300032126 Bacteria 1161
147 Ga0307415_100568947 3300032126 Bacteria 1003
148 Ga0307415_101090619 3300032126 Bacteria 747
149 Ga0307415_101810133 3300032126 Bacteria 591
150 Ga0307415_101890534 3300032126 Bacteria 579
151 Ga0395899_0125497 3300037312 Bacteria 1836
152 Ga0395900_0010305 3300037418 Bacteria 9563
153 Ga0395900_0025678 3300037418 Bacteria 6031
154 Ga0395898_0076966 3300037466 Bacteria 3221
155 Ga0395898_0133589 3300037466 Bacteria 2376
156 Ga0395898_0511444 3300037466 Bacteria 1142
157 Ga0395898_0564909 3300037466 Bacteria 1080
158 Ga0436364_0693135 3300037853 Bacteria 33773
159 Ga0395901_0034850 3300038443 Bacteria 5199
160 Ga0395901_0098344 3300038443 Bacteria 3068
161 Ga0451797_0666677 3300041453 Bacteria 829
162 Ga0451802_1455311 3300041460 Bacteria 921
163 Ga0451839_0580076 3300041496 Bacteria 642
164 Ga0451847_0950629 3300041503 Bacteria 905
165 Ga0450923_151790 3300042125 Bacteria 561
166 Ga0466969_0027802 3300044656 Bacteria 2894
167 Ga0466969_0106063 3300044656 Bacteria 1319
168 Ga0466969_0192451 3300044656 Bacteria 932
169 Ga0466972_0032764 3300044658 Bacteria 2550
170 Ga0466965_0000950 3300044683 Bacteria 11162
171 Ga0466965_0040277 3300044683 Bacteria 2300
172 Ga0466965_0068745 3300044683 Bacteria 1779
173 Ga0466965_0206333 3300044683 Bacteria 1044
174 Ga0466965_0219438 3300044683 Bacteria 1013
175 Ga0466965_0335017 3300044683 Bacteria 826
176 Ga0466965_0525686 3300044683 Bacteria 666
177 Ga0466966_0023963 3300044684 Bacteria 3994
178 Ga0466966_0038618 3300044684 Bacteria 3077
179 Ga0466966_0118836 3300044684 Bacteria 1625
180 Ga0466966_0138149 3300044684 Bacteria 1490
181 Ga0466966_0193718 3300044684 Bacteria 1231
182 Ga0466966_0762620 3300044684 Bacteria 583
183 Ga0466966_1011940 3300044684 Bacteria 501
184 Ga0466961_0078324 3300044693 Bacteria 2093
185 Ga0466961_0272228 3300044693 Bacteria 1037
186 Ga0466963_0049876 3300044694 Bacteria 2769
187 Ga0466963_0261894 3300044694 Bacteria 1214
188 Ga0466963_0305945 3300044694 Bacteria 1118
189 Ga0466963_0801626 3300044694 Bacteria 664
190 Ga0466964_0064280 3300044706 Bacteria 1535
191 Ga0466964_0108535 3300044706 Bacteria 1234
192 Ga0466971_0228389 3300044719 Bacteria 883
193 Ga0466971_0259140 3300044719 Bacteria 829
194 Ga0466971_0425511 3300044719 Bacteria 649
195 Ga0466968_0025580 3300044735 Bacteria 2418
196 Ga0466970_0038225 3300044765 Bacteria 2545
197 Ga0466970_0074337 3300044765 Bacteria 1829
198 Ga0466970_0098517 3300044765 Bacteria 1591
199 Ga0466970_0187763 3300044765 Bacteria 1148
200 Ga0466970_0867478 3300044765 Bacteria 530
201 Ga0466957_0035714 3300044842 Bacteria 2983
202 Ga0466957_0262822 3300044842 Bacteria 1150
203 Ga0466957_0610728 3300044842 Bacteria 764
204 Ga0466960_0006515 3300044901 Bacteria 4685
205 Ga0466960_0039612 3300044901 Bacteria 2224
206 Ga0466960_0061360 3300044901 Bacteria 1845
207 Ga0466960_0099998 3300044901 Bacteria 1492
208 Ga0466960_0133753 3300044901 Bacteria 1311
209 Ga0466960_0146257 3300044901 Bacteria 1259
210 Ga0466960_0162279 3300044901 Bacteria 1201
211 Ga0466960_0291989 3300044901 Bacteria 916
212 Ga0466960_0692444 3300044901 Bacteria 611
213 Ga0466959_0003835 3300045049 Bacteria 9971
214 Ga0466959_0067407 3300045049 Bacteria 2595
215 Ga0466959_0105944 3300045049 Bacteria 2010
216 Ga0466959_0126436 3300045049 Bacteria 1814
217 Ga0466959_0129316 3300045049 Bacteria 1790
218 Ga0466959_0958766 3300045049 Bacteria 570
219 Ga0466958_0001933 3300045836 Bacteria 10158
220 Ga0466958_0132851 3300045836 Bacteria 1564
221 Ga0466958_0304280 3300045836 Bacteria 1024
222 Ga0466958_0338848 3300045836 Bacteria 967
223 Ga0466958_0702064 3300045836 Bacteria 659
224 Ga0466967_0002605 3300045976 Bacteria 11341
225 Ga0466967_0041383 3300045976 Bacteria 3972
226 Ga0466967_0079406 3300045976 Bacteria 2958
227 Ga0466967_0085424 3300045976 Bacteria 2857
228 Ga0466967_0204258 3300045976 Bacteria 1872
229 Ga0466967_0316920 3300045976 Bacteria 1503
230 Ga0466967_0345968 3300045976 Bacteria 1438
231 Ga0466967_0580328 3300045976 Bacteria 1105
232 Ga0466967_1194942 3300045976 Bacteria 758
233 Ga0495629_0106673 3300046459 Bacteria 1954
234 Ga0495596_0144592 3300046500 Bacteria 924
235 Ga0495598_0378639 3300046537 Bacteria 550
236 Ga0495621_0079974 3300046539 Bacteria 1218
237 Ga0495656_0513571 3300046615 Bacteria 636
238 Ga0495658_0253045 3300046683 Bacteria 1108
239 Ga0495683_0000283 3300047323 Bacteria 43834
240 Ga0496105_0316257 3300048908 Bacteria 1252
241 Ga0496110_0448634 3300048913 Bacteria 1176
242 Ga0496112_0884964 3300048915 Bacteria 815
243 Ga0496113_0383646 3300048916 Bacteria 1128
244 Ga0496114_0110021 3300048917 Bacteria 2360
245 Ga0496114_0212726 3300048917 Bacteria 1696
246 Ga0496115_0382295 3300048918 Bacteria 1145
247 Ga0501038_0728246 3300049574 Bacteria 741
248 Ga0501243_050511 3300049675 Bacteria 750
249 Ga0495619_0703620 3300053085 Bacteria 687
250 Ga0500587_032251 3300053739 Bacteria 724
251 Ga0466962_0092698 3300061719 Bacteria 1448
252 Ga0466962_0117260 3300061719 Bacteria 1283
253 Ga0466962_0157317 3300061719 Bacteria 1104
254 Ga0466962_0314614 3300061719 Bacteria 776
255 Ga0466962_0610772 3300061719 Bacteria 556
256 2552105171 2551306166 Bacteria 9731570
257 2559427670 2558860280 Bacteria 11429938
258 2566994939 2565956761 Bacteria 6601618
259 2586065225 2585427649 Bacteria 9053857
260 2623499373 2622736605 Bacteria 4992138
261 2644517171 2643221692 Bacteria 7282860
262 2738890893 2738541308 Bacteria 7020677
263 2739206968 2738543005 Bacteria 5278128
264 2791913754 2791354901 Bacteria 8322202
265 2795780463 2795385470 Bacteria 8317180
266 2795793906 2795385472 Bacteria 6627535
267 2809593620 2808606522 Bacteria 9488490
268 2816506084 2816332139 Bacteria 9138787
269 2861523550 2861520306 Bacteria 8348283
270 2866553309 2866552031 Bacteria 5824618
271 2891328372 2891326441 Bacteria 6439512
272 2899362341 2899359706 Bacteria 10940472
273 2904535912 2904535858 Bacteria 6308016
274 2915775998 2915768154 Bacteria 8424322
275 2917743843 2917736166 Bacteria 9690793
276 2922556052 2922554459 Bacteria 6683962
277 2928146650 2928142448 Bacteria 5288925
278 2928146667 2928142448 Bacteria 5288925
279 8003315278 8003314358 Bacteria 10575343
280 8047718851 8047710418 Bacteria 11023148
281 8056057220 8056054917 Bacteria 5736694
282 8057573675 8057568493 Bacteria 7221719
283 Ga0466960_0481817
284 Ga0070658_10030412
285 Ga0070658_11270242
286 Ga0070683_100055603
287 Ga0070680_101127049
288 Ga0070682_100878363
289 Ga0068868_100055041
290 Ga0070668_100014478
291 Ga0070675_100891370
292 Ga0070659_100299417
293 Ga0070714_101220896
294 Ga0070714_101396383
295 Ga0070714_101486186
296 Ga0070710_10000597
297 Ga0070663_100015651
298 Ga0070663_100171981
299 Ga0070663_100371067
300 Ga0070681_10532118
301 Ga0070679_100089686
302 Ga0070679_100136724
303 Ga0070679_100989963
304 Ga0070684_100199153
305 Ga0070684_100257423
306 Ga0070684_100433485
307 Ga0068853_100638443
308 Ga0068853_100931123
309 Ga0070686_100337771
310 Ga0070665_102484965
311 Ga0068855_100742102
312 Ga0068854_101393275
313 Ga0068856_101551323
314 Ga0068852_100481555
315 Ga0068852_100488358
316 Ga0068852_100960259
317 Ga0068851_10221087
318 Ga0068870_10151067
319 Ga0081539_10000027
320 Ga0097621_101169438
321 Ga0105245_10529894
322 Ga0105238_10183626
323 Ga0105249_12892947
324 Ga0157370_10382979
325 Ga0157369_10036824
326 Ga0157369_10486365
327 Ga0157374_10498110
328 Ga0157372_10282380
329 Ga0157372_11239931
330 Ga0206354_10099075
331 Ga0206353_10698831
332 Ga0206353_10717764
333 Ga0206353_11579721
334 Ga0207688_10238451
335 Ga0207647_10062610
336 Ga0207647_10246237
337 Ga0207647_10344093
338 Ga0207705_10064145
339 Ga0207705_10724051
340 Ga0207663_10923778
341 Ga0207660_11126717
342 Ga0207657_10519834
343 Ga0207649_11049516
344 Ga0207652_10415447
345 Ga0207652_10999996
346 Ga0207659_10660465
347 Ga0207664_10289118
348 Ga0207664_11312592
349 Ga0207661_10396321
350 Ga0207667_10182663
351 Ga0207668_10048197
352 Ga0207677_10075286
353 Ga0207703_10674570
354 Ga0207639_10415657
355 Ga0207639_10894301
356 Ga0207678_10000054
357 Ga0207678_10142275
358 Ga0207678_10368412
359 Ga0207708_10197040
360 Ga0207702_10306847
361 Ga0207674_10088614
362 Ga0207674_10547729
363 Ga0207698_10475961
364 Ga0268266_10966968
365 Ga0307515_10046436
366 Ga0307512_10339161
367 Ga0316176_1130975
368 Ga0314311_1086713
369 Ga0316180_1084180
370 Ga0316180_1107919
371 Ga0316182_1438379
372 Ga0307509_10092976
373 Ga0307408_100161524
374 Ga0307408_100558789
375 Ga0307405_10047469
376 Ga0307405_10112358
377 Ga0307405_10863515
378 Ga0307413_10024920
379 Ga0307413_10046335
380 Ga0307413_10179125
381 Ga0307410_10025835
382 Ga0307410_10072580
383 Ga0307410_10295247
384 Ga0307410_10469404
385 Ga0307410_11011938
386 Ga0307410_11579383
387 Ga0307406_10016228
388 Ga0307406_10380814
389 Ga0307406_11175363
390 Ga0307407_10121158
391 Ga0307407_10128066
392 Ga0307407_10153037
393 Ga0307407_10189058
394 Ga0307407_10269789
395 Ga0307407_10612608
396 Ga0307407_10631714
397 Ga0307407_10780969
398 Ga0307412_10116067
399 Ga0307412_10151408
400 Ga0307409_100064569
401 Ga0307409_100073484
402 Ga0307409_100177501
403 Ga0307409_100211450
404 Ga0307409_100360519
405 Ga0307409_100656013
406 Ga0307409_100830688
407 Ga0307409_100956753
408 Ga0307409_101339903
409 Ga0307409_101717474
410 Ga0307416_100050265
411 Ga0307416_100107800
412 Ga0307416_100187715
413 Ga0307416_100437886
414 Ga0307416_100533262
415 Ga0307416_100614183
416 Ga0307416_101132629
417 Ga0307416_101344629
418 Ga0307416_102335784
419 Ga0307414_10137039
420 Ga0307414_10393829
421 Ga0307411_10112214
422 Ga0307411_10331551
423 Ga0307411_10794488
424 Ga0307415_100046619
425 Ga0307415_100082658
426 Ga0307415_100202754
427 Ga0307415_100361930
428 Ga0307415_100408914
429 Ga0307415_100568947
430 Ga0307415_101090619
431 Ga0307415_101810133
432 Ga0307415_101890534
433 Ga0395899_0125497
434 Ga0395900_0010305
435 Ga0395900_0025678
436 Ga0395898_0076966
437 Ga0395898_0133589
438 Ga0395898_0511444
439 Ga0395898_0564909
440 Ga0436364_0693135
441 Ga0395901_0034850
442 Ga0395901_0098344
443 Ga0451797_0666677
444 Ga0451802_1455311
445 Ga0451839_0580076
446 Ga0451847_0950629
447 Ga0450923_151790
448 Ga0466969_0027802
449 Ga0466969_0106063
450 Ga0466969_0192451
451 Ga0466972_0032764
452 Ga0466965_0000950
453 Ga0466965_0040277
454 Ga0466965_0068745
455 Ga0466965_0206333
456 Ga0466965_0219438
457 Ga0466965_0335017
458 Ga0466965_0525686
459 Ga0466966_0023963
460 Ga0466966_0038618
461 Ga0466966_0118836
462 Ga0466966_0138149
463 Ga0466966_0193718
464 Ga0466966_0762620
465 Ga0466966_1011940
466 Ga0466961_0078324
467 Ga0466961_0272228
468 Ga0466963_0049876
469 Ga0466963_0261894
470 Ga0466963_0305945
471 Ga0466963_0801626
472 Ga0466964_0064280
473 Ga0466964_0108535
474 Ga0466971_0228389
475 Ga0466971_0259140
476 Ga0466971_0425511
477 Ga0466968_0025580
478 Ga0466970_0038225
479 Ga0466970_0074337
480 Ga0466970_0098517
481 Ga0466970_0187763
482 Ga0466970_0867478
483 Ga0466957_0035714
484 Ga0466957_0262822
485 Ga0466957_0610728
486 Ga0466960_0006515
487 Ga0466960_0039612
488 Ga0466960_0061360
489 Ga0466960_0099998
490 Ga0466960_0133753
491 Ga0466960_0146257
492 Ga0466960_0162279
493 Ga0466960_0291989
494 Ga0466960_0692444
495 Ga0466959_0003835
496 Ga0466959_0067407
497 Ga0466959_0105944
498 Ga0466959_0126436
499 Ga0466959_0129316
500 Ga0466959_0958766
501 Ga0466958_0001933
502 Ga0466958_0132851
503 Ga0466958_0304280
504 Ga0466958_0338848
505 Ga0466958_0702064
506 Ga0466967_0002605
507 Ga0466967_0041383
508 Ga0466967_0079406
509 Ga0466967_0085424
510 Ga0466967_0204258
511 Ga0466967_0316920
512 Ga0466967_0345968
513 Ga0466967_0580328
514 Ga0466967_1194942
515 Ga0495629_0106673
516 Ga0495596_0144592
517 Ga0495598_0378639
518 Ga0495621_0079974
519 Ga0495656_0513571
520 Ga0495658_0253045
521 Ga0495683_0000283
522 Ga0496105_0316257
523 Ga0496110_0448634
524 Ga0496112_0884964
525 Ga0496113_0383646
526 Ga0496114_0110021
527 Ga0496114_0212726
528 Ga0496115_0382295
529 Ga0501038_0728246
530 Ga0501243_050511
531 Ga0495619_0703620
532 Ga0500587_032251
533 Ga0466962_0092698
534 Ga0466962_0117260
535 Ga0466962_0157317
536 Ga0466962_0314614
537 Ga0466962_0610772
538 2552105171
539 2559427670
540 2566994939
541 2586065225
542 2623499373
543 2644517171
544 2738890893
545 2739206968
546 2791913754
547 2795780463
548 2795793906
549 2809593620
550 2816506084
551 2861523550
552 2866553309
553 2891328372
554 2899362341
555 2904535912
556 2915775998
557 2917743843
558 2922556052
559 2928146650
560 2928146667
561 8003315278
562 8047718851
563 8056057220
564 8057573675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

20

140

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otm-assembly1.cif.gz_C crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution 0.9597 4 151
3d01-assembly1.cif.gz_I error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9384 4 152
3d01-assembly1.cif.gz_K error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9383 4 152
3d01-assembly2.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9383 4 152
3d01-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9355 4 152
ID Description Score Start End Superfamily
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9899 4 151 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9703 4 151 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.951 4 151 3.30.1330.40
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9452 4 152 3.30.1330.40
3d01E00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9371 4 152 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A6M0KVC8-F1-model_v4 deleted 0.9995 70 152
AF-A0A655CFI7-F1-model_v4 deleted 0.9986 29 152
AF-Q9CB89-F1-model_v4 Uncharacterized protein 0.9935 4 152
AF-A0A7K1EFT5-F1-model_v4 deleted 0.9933 61 152
AF-A0A1B6AJH2-F1-model_v4 Putative RidA/YjgF family protein 0.9931 29 152

Map