F384980

General Info

Members Datasets Scaffolds Average Seq Length
282 179 282 361

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10093327|Ga0207660_100933272
Length 399
Sequence MRLLVAGGGTGGHLYPGIALAEEVTSRPNGAVLFVGTPRGLETKLVPAAGFDLELLDVSGLNRVGLGKIVKGLGRLPKAFFASRAILKRFRPDLVIGVGGYASGPLVLAAALLGYPTAIQEQNSQPGFTNRVLGAFARRVFVAFEDAKKFFPAKKTRLFGNPVRRKFVTAVRDVDRSVADVARGVLVLGGSQGAKAVNDLVVDAAAVLAKEDRLPPLVHQTGAADEARVREKYAAAGLADRVQLRPFIDDMPTALAAAALVVGRAGALTLAELAMMARPAILIPLPTAAADHQTRNAAEFARAGAAVMVGQRTATGQLLAERIAELMSAPGRRAEMSRHMAALGRPDATREIVDELEALVARRGRGSAAPSDTTTGEPEPATRVADPHGRRSALPSALK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 0.71
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10005059 3300005327 Bacteria 10732
2 Ga0070658_10023193 3300005327 Bacteria 4982
3 Ga0070658_10068057 3300005327 Bacteria 2910
4 Ga0070658_10094969 3300005327 Bacteria 2461
5 Ga0070683_100030900 3300005329 Bacteria 4866
6 Ga0070683_100197776 3300005329 Bacteria 1909
7 Ga0068869_100081823 3300005334 Bacteria 2412
8 Ga0070660_100044293 3300005339 Bacteria 3403
9 Ga0070689_100000013 3300005340 Bacteria 206982
10 Ga0070689_100143658 3300005340 Bacteria 1920
11 Ga0070687_100023909 3300005343 Bacteria 2909
12 Ga0070668_100011038 3300005347 Bacteria 6724
13 Ga0070669_100106606 3300005353 Bacteria 2122
14 Ga0070669_100154906 3300005353 Bacteria 1776
15 Ga0070675_100026745 3300005354 Bacteria 4630
16 Ga0070688_100008029 3300005365 Bacteria 5711
17 Ga0070659_100006603 3300005366 Bacteria 8379
18 Ga0070667_100028919 3300005367 Bacteria 4615
19 Ga0070714_100006639 3300005435 Bacteria 8953
20 Ga0070701_10001673 3300005438 Bacteria 8311
21 Ga0070711_100024247 3300005439 Bacteria 3954
22 Ga0070705_100016097 3300005440 Bacteria 3879
23 Ga0070694_100012742 3300005444 Bacteria 5236
24 Ga0070694_100037574 3300005444 Bacteria 3212
25 Ga0070694_100060989 3300005444 Bacteria 2574
26 Ga0070708_100000146 3300005445 Bacteria 48913
27 Ga0070708_100027206 3300005445 Bacteria 4904
28 Ga0070708_100350652 3300005445 Bacteria 1391
29 Ga0070681_10114885 3300005458 Bacteria 2630
30 Ga0070681_10206739 3300005458 Bacteria 1880
31 Ga0068867_100073667 3300005459 Bacteria 2557
32 Ga0070706_100000977 3300005467 Bacteria 31128
33 Ga0070706_100160657 3300005467 Bacteria 2098
34 Ga0070707_100043094 3300005468 Bacteria 4320
35 Ga0070707_100331245 3300005468 Bacteria 1479
36 Ga0070699_100001601 3300005518 Bacteria 20674
37 Ga0070699_100455183 3300005518 Bacteria 1161
38 Ga0070679_100011799 3300005530 Bacteria 8333
39 Ga0070679_100031979 3300005530 Bacteria 5204
40 Ga0070679_100051831 3300005530 Bacteria 4088
41 Ga0070697_100001820 3300005536 Bacteria 16289
42 Ga0068853_100005377 3300005539 Bacteria 10025
43 Ga0068853_100208889 3300005539 Bacteria 1779
44 Ga0070686_100035412 3300005544 Bacteria 3083
45 Ga0070695_100043301 3300005545 Bacteria 2862
46 Ga0070695_100121028 3300005545 Bacteria 1790
47 Ga0070696_100062725 3300005546 Unclassified 2602
48 Ga0070696_100229384 3300005546 Bacteria 1396
49 Ga0070696_100264071 3300005546 Bacteria 1306
50 Ga0070704_100000075 3300005549 Bacteria 33854
51 Ga0070704_100003725 3300005549 Bacteria 8785
52 Ga0070704_100009740 3300005549 Bacteria 5824
53 Ga0070704_100246314 3300005549 Bacteria 1465
54 Ga0068855_100111539 3300005563 Bacteria 3140
55 Ga0068855_100225031 3300005563 Bacteria 2102
56 Ga0070664_100214419 3300005564 Unclassified 1721
57 Ga0068854_100064497 3300005578 Unclassified 2661
58 Ga0068856_100176158 3300005614 Bacteria 2151
59 Ga0070702_100012591 3300005615 Bacteria 4243
60 Ga0068852_100122000 3300005616 Bacteria 2388
61 Ga0068852_100179587 3300005616 Bacteria 1989
62 Ga0068859_100002560 3300005617 Bacteria 18459
63 Ga0068859_100399504 3300005617 Bacteria 1470
64 Ga0068863_100143809 3300005841 Bacteria 2281
65 Ga0068860_100017924 3300005843 Bacteria 6895
66 Ga0068862_100046700 3300005844 Bacteria 3694
67 Ga0068862_100090918 3300005844 Bacteria 2658
68 Ga0070717_10139265 3300006028 Bacteria 2092
69 Ga0075428_100148770 3300006844 Unclassified 2544
70 Ga0075428_100191134 3300006844 Bacteria 2214
71 Ga0075430_100059986 3300006846 Bacteria 3197
72 Ga0075431_100001858 3300006847 Bacteria 20004
73 Ga0075431_100044701 3300006847 Bacteria 4567
74 Ga0075431_100195408 3300006847 Bacteria 2071
75 Ga0075433_10042801 3300006852 Bacteria 3931
76 Ga0075429_100000580 3300006880 Bacteria 28130
77 Ga0068865_100257214 3300006881 Bacteria 1381
78 Ga0097620_100002560 3300006931 Bacteria 18459
79 Ga0097620_100399479 3300006931 Bacteria 1470
80 Ga0075435_100247066 3300007076 Unclassified 1518
81 Ga0099794_10000893 3300007265 Bacteria 10087
82 Ga0105240_10001929 3300009093 Bacteria 34458
83 Ga0114129_10053176 3300009147 Bacteria 5680
84 Ga0114129_10146677 3300009147 Bacteria 3232
85 Ga0105243_10162046 3300009148 Unclassified 1929
86 Ga0105248_10047781 3300009177 Bacteria 4799
87 Ga0105248_10103960 3300009177 Bacteria 3202
88 Ga0105238_10021898 3300009551 Bacteria 6512
89 Ga0105249_10000465 3300009553 Bacteria 37681
90 Ga0105239_10131913 3300010375 Bacteria 2780
91 Ga0157371_10026474 3300013102 Bacteria 4215
92 Ga0157371_10093594 3300013102 Bacteria 2129
93 Ga0157371_10187646 3300013102 Bacteria 1480
94 Ga0157369_10018432 3300013105 Bacteria 7826
95 Ga0157369_10092053 3300013105 Bacteria 3236
96 Ga0157369_10270627 3300013105 Bacteria 1770
97 Ga0163162_10078339 3300013306 Bacteria 3370
98 Ga0157372_10013388 3300013307 Bacteria 8757
99 Ga0157372_10031670 3300013307 Bacteria 5791
100 Ga0157372_10411778 3300013307 Bacteria 1575
101 Ga0157375_10436362 3300013308 Unclassified 1476
102 Ga0157376_10153555 3300014969 Bacteria 2079
103 Ga0213875_10024233 3300021388 Bacteria 2895
104 Ga0207643_10059176 3300025908 Bacteria 2185
105 Ga0207705_10007100 3300025909 Bacteria 8260
106 Ga0207705_10021286 3300025909 Bacteria 4626
107 Ga0207705_10065069 3300025909 Bacteria 2635
108 Ga0207705_10096786 3300025909 Bacteria 2167
109 Ga0207684_10000153 3300025910 Bacteria 120731
110 Ga0207707_10035977 3300025912 Bacteria 4329
111 Ga0207695_10011470 3300025913 Bacteria 10731
112 Ga0207695_10082113 3300025913 Bacteria 3260
113 Ga0207671_10000120 3300025914 Bacteria 120786
114 Ga0207663_10032077 3300025916 Bacteria 3115
115 Ga0207660_10093327 3300025917 Bacteria 2236
116 Ga0207660_10157705 3300025917 Bacteria 1748
117 Ga0207662_10002958 3300025918 Bacteria 8643
118 Ga0207662_10044062 3300025918 Bacteria 2633
119 Ga0207662_10122469 3300025918 Bacteria 1632
120 Ga0207657_10002769 3300025919 Bacteria 18872
121 Ga0207657_10025921 3300025919 Bacteria 5398
122 Ga0207652_10044915 3300025921 Bacteria 3766
123 Ga0207652_10058250 3300025921 Bacteria 3329
124 Ga0207646_10034451 3300025922 Bacteria 4575
125 Ga0207646_10037783 3300025922 Bacteria 4352
126 Ga0207646_10287731 3300025922 Bacteria 1485
127 Ga0207681_10248163 3300025923 Unclassified 1389
128 Ga0207694_10012068 3300025924 Bacteria 6513
129 Ga0207664_10121650 3300025929 Bacteria 2185
130 Ga0207690_10068331 3300025932 Bacteria 2441
131 Ga0207690_10183409 3300025932 Bacteria 1578
132 Ga0207706_10066665 3300025933 Unclassified 3168
133 Ga0207670_10000004 3300025936 Bacteria 707262
134 Ga0207679_10108714 3300025945 Unclassified 2184
135 Ga0207667_10128515 3300025949 Bacteria 2610
136 Ga0207667_10205146 3300025949 Bacteria 2021
137 Ga0207712_10000098 3300025961 Bacteria 99232
138 Ga0207712_10061005 3300025961 Unclassified 2675
139 Ga0207668_10014828 3300025972 Bacteria 4831
140 Ga0207703_10227851 3300026035 Bacteria 1669
141 Ga0207639_10068189 3300026041 Bacteria 2771
142 Ga0207702_10237892 3300026078 Unclassified 1705
143 Ga0207641_10248262 3300026088 Bacteria 1661
144 Ga0207648_10053970 3300026089 Bacteria 3511
145 Ga0209588_1000651 3300027671 Bacteria 8743
146 Ga0209588_1000693 3300027671 Bacteria 8511
147 Ga0268265_10025643 3300028380 Bacteria 4188
148 Ga0268264_10036610 3300028381 Bacteria 4044
149 Ga0265318_10000027 3300028577 Bacteria 153682
150 Ga0265338_10031267 3300028800 Bacteria 5222
151 Ga0265324_10000134 3300029957 Bacteria 58308
152 Ga0265330_10000036 3300031235 Bacteria 121416
153 Ga0265328_10000909 3300031239 Bacteria 13671
154 Ga0265320_10000018 3300031240 Bacteria 183411
155 Ga0265329_10000004 3300031242 Bacteria 108465
156 Ga0265339_10000010 3300031249 Bacteria 214721
157 Ga0265331_10000046 3300031250 Bacteria 183360
158 Ga0265316_10000046 3300031344 Bacteria 129393
159 Ga0265316_10004739 3300031344 Bacteria 13457
160 Ga0307408_100005344 3300031548 Bacteria 8605
161 Ga0307408_100203228 3300031548 Bacteria 1605
162 Ga0265313_10000075 3300031595 Bacteria 97534
163 Ga0265313_10028585 3300031595 Bacteria 2895
164 Ga0265314_10000137 3300031711 Bacteria 109629
165 Ga0265314_10006666 3300031711 Bacteria 10147
166 Ga0265342_10001561 3300031712 Bacteria 21197
167 Ga0265342_10002055 3300031712 Bacteria 17872
168 Ga0265342_10002987 3300031712 Bacteria 14188
169 Ga0265342_10146525 3300031712 Bacteria 1314
170 Ga0316576_10076355 3300031727 Bacteria 2479
171 Ga0316578_10090551 3300031728 Bacteria 1826
172 Ga0307405_10013324 3300031731 Bacteria 4384
173 Ga0307413_10000979 3300031824 Bacteria 10251
174 Ga0307413_10003218 3300031824 Bacteria 6831
175 Ga0307413_10025587 3300031824 Bacteria 3237
176 Ga0307410_10007149 3300031852 Bacteria 6088
177 Ga0307410_10007514 3300031852 Bacteria 5972
178 Ga0307406_10001775 3300031901 Bacteria 11789
179 Ga0307407_10024636 3300031903 Bacteria 3158
180 Ga0307412_10004828 3300031911 Bacteria 7523
181 Ga0307412_10143720 3300031911 Bacteria 1751
182 Ga0307409_100003453 3300031995 Bacteria 8582
183 Ga0307409_100028228 3300031995 Unclassified 3993
184 Ga0307416_100027982 3300032002 Bacteria 4184
185 Ga0307416_100059955 3300032002 Bacteria 3096
186 Ga0307416_100070002 3300032002 Unclassified 2906
187 Ga0307414_10015042 3300032004 Bacteria 4661
188 Ga0307414_10053615 3300032004 Bacteria 2813
189 Ga0307414_10065472 3300032004 Unclassified 2593
190 Ga0307411_10003243 3300032005 Bacteria 7500
191 Ga0307411_10015232 3300032005 Bacteria 4312
192 Ga0307415_100005510 3300032126 Bacteria 6728
193 Ga0307415_100009037 3300032126 Bacteria 5560
194 Ga0373950_0000020 3300034818 Bacteria 209621
195 Ga0373950_0000089 3300034818 Bacteria 25034
196 Ga0373941_0026913 3300035115 Bacteria 1674
197 Ga0373933_0001302 3300035724 Bacteria 14689
198 Ga0373937_0007303 3300036401 Bacteria 9565
199 Ga0395905_0208404 3300037471 Bacteria 1832
200 Ga0436364_1479970 3300037853 Bacteria 18078
201 Ga0451577_0015623 3300042876 Bacteria 7055
202 Ga0451577_0082574 3300042876 Bacteria 2867
203 Ga0453683_0071415 3300044673 Bacteria 2172
204 Ga0453684_0008034 3300044712 Bacteria 19091
205 Ga0453684_0282296 3300044712 Bacteria 1893
206 Ga0451576_0007805 3300045051 Bacteria 12691
207 Ga0451576_0037323 3300045051 Bacteria 5147
208 Ga0451576_0152093 3300045051 Bacteria 2413
209 Ga0495662_0014349 3300046476 Bacteria 3855
210 Ga0495594_0132335 3300046499 Bacteria 1413
211 Ga0495608_0007318 3300046511 Bacteria 7801
212 Ga0495628_0012138 3300046516 Bacteria 7262
213 Ga0495630_0303371 3300046517 Bacteria 1220
214 Ga0495652_0013704 3300046529 Bacteria 7294
215 Ga0495652_0082458 3300046529 Bacteria 2650
216 Ga0495587_0011872 3300046536 Bacteria 5506
217 Ga0495609_0019271 3300046538 Unclassified 3160
218 Ga0495667_0048724 3300046559 Bacteria 2797
219 Ga0495657_0104373 3300046675 Bacteria 1802
220 Ga0495599_0017560 3300046678 Bacteria 4447
221 Ga0495623_0063419 3300046679 Bacteria 2314
222 Ga0495613_0181044 3300046689 Bacteria 1492
223 Ga0495604_0118819 3300047317 Bacteria 1916
224 Ga0495674_0089876 3300047319 Bacteria 2625
225 Ga0495680_0038903 3300047322 Bacteria 3798
226 Ga0495684_0004842 3300047471 Bacteria 10508
227 Ga0495615_0005479 3300048090 Bacteria 2285
228 Ga0496108_0117806 3300048911 Bacteria 2276
229 Ga0496114_0161401 3300048917 Bacteria 1949
230 Ga0501032_0069193 3300049569 Bacteria 2356
231 Ga0501034_0000026 3300049571 Bacteria 261125
232 Ga0501041_0035105 3300049577 Bacteria 3038
233 Ga0501043_0064360 3300049579 Bacteria 2879
234 Ga0501046_0001137 3300049580 Bacteria 25940
235 Ga0501047_0000017 3300049581 Bacteria 276932
236 Ga0501047_0033899 3300049581 Bacteria 4928
237 Ga0501047_0149507 3300049581 Bacteria 2212
238 Ga0501048_0001028 3300049582 Bacteria 20869
239 Ga0501048_0056713 3300049582 Unclassified 2779
240 Ga0501067_0000032 3300049583 Bacteria 86474
241 Ga0501067_0048464 3300049583 Bacteria 2356
242 Ga0501067_0167108 3300049583 Unclassified 1225
243 Ga0501068_0018539 3300049584 Bacteria 4029
244 Ga0501068_0079602 3300049584 Bacteria 2009
245 Ga0501069_0011190 3300049585 Bacteria 4759
246 Ga0501069_0031973 3300049585 Unclassified 2897
247 Ga0501070_0000028 3300049586 Bacteria 140133
248 Ga0501070_0003690 3300049586 Bacteria 13236
249 Ga0501070_0034893 3300049586 Bacteria 4204
250 Ga0501070_0133917 3300049586 Bacteria 2046
251 Ga0501072_0000033 3300049588 Bacteria 125387
252 Ga0501072_0281093 3300049588 Bacteria 1324
253 Ga0501072_0290131 3300049588 Unclassified 1301
254 Ga0501073_0000494 3300049589 Bacteria 27500
255 Ga0501073_0000682 3300049589 Bacteria 23895
256 Ga0501073_0002534 3300049589 Bacteria 13654
257 Ga0501073_0045418 3300049589 Bacteria 3093
258 Ga0501074_0000360 3300049590 Bacteria 26745
259 Ga0501074_0062489 3300049590 Bacteria 2682
260 Ga0501076_0288424 3300049592 Bacteria 1345
261 Ga0501079_0000744 3300049741 Bacteria 22127
262 Ga0501079_0059383 3300049741 Bacteria 2950
263 Ga0501080_0003185 3300049742 Bacteria 14470
264 Ga0501080_0016976 3300049742 Bacteria 6722
265 Ga0501080_0067078 3300049742 Bacteria 3337
266 Ga0501080_0290540 3300049742 Bacteria 1484
267 Ga0501083_0011866 3300049744 Bacteria 6106
268 Ga0501083_0013358 3300049744 Bacteria 5741
269 Ga0501083_0020248 3300049744 Bacteria 4629
270 Ga0501035_0000176 3300049822 Bacteria 78707
271 Ga0501045_0058504 3300049824 Bacteria 2823
272 nmdc:mga05p37_118619_c1 3300050507 Bacteria 3251
273 nmdc:mga09592_5281_c1 3300050508 Bacteria 10497
274 nmdc:mga06r32_86849_c1 3300050510 Bacteria 3051
275 nmdc:mga08y16_175002_c1 3300050511 Bacteria 2228
276 Ga0500628_000349 3300053129 Bacteria 8798
277 Ga0501084_0000003 3300054114 Bacteria 267909
278 Ga0501082_0000042 3300060353 Bacteria 89973
279 Ga0501082_0009139 3300060353 Bacteria 8544
280 Ga0501082_0040556 3300060353 Bacteria 4015
281 Ga0501082_0050093 3300060353 Bacteria 3602
282 Ga0530510_0093476 3300061734 Bacteria 2196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_86849_c1 nmdc:mga06r32_86849_c1_763_1677 302
2 3300007265 Ga0099794_10000893 Ga0099794_100008936 303
3 3300025917 Ga0207660_10157705 Ga0207660_101577051 304
4 3300025908 Ga0207643_10059176 Ga0207643_100591762 310
5 3300028577 Ga0265318_10000027 Ga0265318_1000002732 318
6 3300031235 Ga0265330_10000036 Ga0265330_1000003674 318
7 3300031239 Ga0265328_10000909 Ga0265328_100009094 318
8 3300031240 Ga0265320_10000018 Ga0265320_10000018131 318
9 3300031250 Ga0265331_10000046 Ga0265331_10000046130 318
10 3300031344 Ga0265316_10004739 Ga0265316_100047394 318
11 3300031595 Ga0265313_10000075 Ga0265313_1000007532 318
12 3300031711 Ga0265314_10000137 Ga0265314_1000013732 318
13 3300031712 Ga0265342_10002987 Ga0265342_100029876 318
14 3300005444 Ga0070694_100037574 Ga0070694_1000375742 324
15 3300031727 Ga0316576_10076355 Ga0316576_100763552 324
16 3300031728 Ga0316578_10090551 Ga0316578_100905512 324
17 3300025916 Ga0207663_10032077 Ga0207663_100320771 325
18 3300025913 Ga0207695_10011470 Ga0207695_100114707 327
19 3300005518 Ga0070699_100455183 Ga0070699_1004551831 328
20 3300009093 Ga0105240_10001929 Ga0105240_100019297 328
21 3300005439 Ga0070711_100024247 Ga0070711_1000242473 329
22 3300006881 Ga0068865_100257214 Ga0068865_1002572141 330
23 3300028800 Ga0265338_10031267 Ga0265338_100312674 331
24 3300029957 Ga0265324_10000134 Ga0265324_1000013450 331
25 3300031242 Ga0265329_10000004 Ga0265329_1000000410 331
26 3300031249 Ga0265339_10000010 Ga0265339_100000105 331
27 3300031344 Ga0265316_10000046 Ga0265316_1000004637 331
28 3300031711 Ga0265314_10006666 Ga0265314_100066664 331
29 3300031712 Ga0265342_10001561 Ga0265342_100015617 331
30 3300005467 Ga0070706_100000977 Ga0070706_10000097723 335
31 3300005536 Ga0070697_100001820 Ga0070697_10000182011 335
32 3300025910 Ga0207684_10000153 Ga0207684_1000015363 335
33 3300025922 Ga0207646_10034451 Ga0207646_100344513 335
34 3300049822 Ga0501035_0000176 Ga0501035_0000176_3355_4500 335
35 3300005445 Ga0070708_100000146 Ga0070708_1000001465 337
36 3300006028 Ga0070717_10139265 Ga0070717_101392652 337
37 3300027671 Ga0209588_1000693 Ga0209588_10006933 337
38 3300005843 Ga0068860_100017924 Ga0068860_1000179242 341
39 3300006846 Ga0075430_100059986 Ga0075430_1000599863 341
40 3300028381 Ga0268264_10036610 Ga0268264_100366102 341
41 3300005440 Ga0070705_100016097 Ga0070705_1000160972 343
42 3300005546 Ga0070696_100229384 Ga0070696_1002293841 343
43 3300005549 Ga0070704_100003725 Ga0070704_1000037257 343
44 3300005518 Ga0070699_100001601 Ga0070699_1000016017 344
45 3300005545 Ga0070695_100043301 Ga0070695_1000433012 344
46 3300005546 Ga0070696_100062725 Ga0070696_1000627252 344
47 3300005546 Ga0070696_100264071 Ga0070696_1002640711 344
48 3300005549 Ga0070704_100009740 Ga0070704_1000097405 344
49 3300006844 Ga0075428_100191134 Ga0075428_1001911342 344
50 3300031548 Ga0307408_100005344 Ga0307408_1000053444 344
51 3300031824 Ga0307413_10003218 Ga0307413_100032183 344
52 3300031824 Ga0307413_10025587 Ga0307413_100255873 344
53 3300031852 Ga0307410_10007149 Ga0307410_100071493 344
54 3300031852 Ga0307410_10007514 Ga0307410_100075143 344
55 3300031901 Ga0307406_10001775 Ga0307406_100017757 344
56 3300031903 Ga0307407_10024636 Ga0307407_100246362 344
57 3300031911 Ga0307412_10004828 Ga0307412_100048282 344
58 3300031911 Ga0307412_10143720 Ga0307412_101437202 344
59 3300031995 Ga0307409_100003453 Ga0307409_1000034537 344
60 3300032002 Ga0307416_100027982 Ga0307416_1000279822 344
61 3300032002 Ga0307416_100070002 Ga0307416_1000700021 344
62 3300032004 Ga0307414_10015042 Ga0307414_100150423 344
63 3300032005 Ga0307411_10003243 Ga0307411_100032434 344
64 3300032005 Ga0307411_10015232 Ga0307411_100152322 344
65 3300032126 Ga0307415_100009037 Ga0307415_1000090373 344
66 3300005353 Ga0070669_100154906 Ga0070669_1001549062 345
67 3300005444 Ga0070694_100060989 Ga0070694_1000609892 345
68 3300005467 Ga0070706_100160657 Ga0070706_1001606572 345
69 3300005468 Ga0070707_100331245 Ga0070707_1003312451 345
70 3300005549 Ga0070704_100000075 Ga0070704_1000000752 345
71 3300005617 Ga0068859_100399504 Ga0068859_1003995041 345
72 3300005844 Ga0068862_100046700 Ga0068862_1000467002 345
73 3300006931 Ga0097620_100399479 Ga0097620_1003994791 345
74 3300025922 Ga0207646_10287731 Ga0207646_102877312 345
75 3300025923 Ga0207681_10248163 Ga0207681_102481631 345
76 3300025961 Ga0207712_10061005 Ga0207712_100610052 345
77 3300031712 Ga0265342_10002055 Ga0265342_1000205512 345
78 3300034818 Ga0373950_0000089 Ga0373950_0000089_21984_23153 345
79 3300049583 Ga0501067_0000032 Ga0501067_0000032_82827_83996 345
80 3300049589 Ga0501073_0000682 Ga0501073_0000682_10477_11646 345
81 3300050511 nmdc:mga08y16_175002_c1 nmdc:mga08y16_175002_c1_337_1383 345
82 3300048911 Ga0496108_0117806 Ga0496108_0117806_272_1393 346
83 3300025914 Ga0207671_10000120 Ga0207671_100001202 347
84 3300049577 Ga0501041_0035105 Ga0501041_0035105_140_1231 347
85 3300049588 Ga0501072_0281093 Ga0501072_0281093_163_1254 347
86 3300049592 Ga0501076_0288424 Ga0501076_0288424_229_1320 347
87 3300049741 Ga0501079_0059383 Ga0501079_0059383_617_1708 347
88 3300049824 Ga0501045_0058504 Ga0501045_0058504_424_1515 347
89 3300060353 Ga0501082_0050093 Ga0501082_0050093_1926_3017 347
90 3300042876 Ga0451577_0015623 Ga0451577_0015623_2958_4040 348
91 3300044712 Ga0453684_0008034 Ga0453684_0008034_1335_2417 348
92 3300044712 Ga0453684_0282296 Ga0453684_0282296_46_1128 348
93 3300045051 Ga0451576_0007805 Ga0451576_0007805_8739_9821 348
94 3300046499 Ga0495594_0132335 Ga0495594_0132335_70_1206 348
95 3300049585 Ga0501069_0031973 Ga0501069_0031973_1384_2469 348
96 3300049586 Ga0501070_0034893 Ga0501070_0034893_1804_2889 348
97 3300025909 Ga0207705_10096786 Ga0207705_100967862 349
98 3300025917 Ga0207660_10093327 Ga0207660_100933272 349
99 3300025932 Ga0207690_10183409 Ga0207690_101834092 349
100 3300005340 Ga0070689_100000013 Ga0070689_10000001361 350
101 3300005614 Ga0068856_100176158 Ga0068856_1001761582 350
102 3300010375 Ga0105239_10131913 Ga0105239_101319132 350
103 3300025921 Ga0207652_10058250 Ga0207652_100582502 350
104 3300025936 Ga0207670_10000004 Ga0207670_10000004591 350
105 3300031595 Ga0265313_10028585 Ga0265313_100285852 351
106 3300031712 Ga0265342_10146525 Ga0265342_101465251 351
107 3300034818 Ga0373950_0000020 Ga0373950_0000020_154123_155232 351
108 3300035115 Ga0373941_0026913 Ga0373941_0026913_490_1599 351
109 3300049569 Ga0501032_0069193 Ga0501032_0069193_80_1189 351
110 3300049571 Ga0501034_0000026 Ga0501034_0000026_254773_255882 351
111 3300049579 Ga0501043_0064360 Ga0501043_0064360_1381_2490 351
112 3300049580 Ga0501046_0001137 Ga0501046_0001137_19745_20854 351
113 3300049581 Ga0501047_0000017 Ga0501047_0000017_270614_271723 351
114 3300049582 Ga0501048_0001028 Ga0501048_0001028_17520_18629 351
115 3300049583 Ga0501067_0048464 Ga0501067_0048464_1027_2136 351
116 3300049584 Ga0501068_0018539 Ga0501068_0018539_1698_2807 351
117 3300049584 Ga0501068_0079602 Ga0501068_0079602_103_1215 351
118 3300049586 Ga0501070_0003690 Ga0501070_0003690_6521_7630 351
119 3300049586 Ga0501070_0133917 Ga0501070_0133917_579_1691 351
120 3300049588 Ga0501072_0000033 Ga0501072_0000033_71534_72643 351
121 3300049589 Ga0501073_0000494 Ga0501073_0000494_3854_4963 351
122 3300049589 Ga0501073_0002534 Ga0501073_0002534_1690_2802 351
123 3300049590 Ga0501074_0000360 Ga0501074_0000360_21455_22564 351
124 3300049590 Ga0501074_0062489 Ga0501074_0062489_96_1208 351
125 3300049741 Ga0501079_0000744 Ga0501079_0000744_19899_21008 351
126 3300049742 Ga0501080_0003185 Ga0501080_0003185_2871_3983 351
127 3300049742 Ga0501080_0016976 Ga0501080_0016976_5096_6205 351
128 3300049742 Ga0501080_0290540 Ga0501080_0290540_129_1238 351
129 3300049744 Ga0501083_0011866 Ga0501083_0011866_4409_5521 351
130 3300049744 Ga0501083_0020248 Ga0501083_0020248_1399_2508 351
131 3300054114 Ga0501084_0000003 Ga0501084_0000003_4949_6058 351
132 3300060353 Ga0501082_0000042 Ga0501082_0000042_39870_40979 351
133 3300060353 Ga0501082_0040556 Ga0501082_0040556_1878_2990 351
134 3300005539 Ga0068853_100005377 Ga0068853_1000053778 352
135 3300048090 Ga0495615_0005479 Ga0495615_0005479_256_1476 352
136 3300048917 Ga0496114_0161401 Ga0496114_0161401_351_1478 352
137 3300005563 Ga0068855_100225031 Ga0068855_1002250312 353
138 3300005617 Ga0068859_100002560 Ga0068859_10000256013 353
139 3300006931 Ga0097620_100002560 Ga0097620_10000256013 353
140 3300009551 Ga0105238_10021898 Ga0105238_100218983 353
141 3300025924 Ga0207694_10012068 Ga0207694_100120683 353
142 3300025949 Ga0207667_10205146 Ga0207667_102051462 353
143 3300035724 Ga0373933_0001302 Ga0373933_0001302_5987_7141 353
144 3300036401 Ga0373937_0007303 Ga0373937_0007303_3620_4774 353
145 3300046511 Ga0495608_0007318 Ga0495608_0007318_4252_5361 353
146 3300046516 Ga0495628_0012138 Ga0495628_0012138_3486_4595 353
147 3300046529 Ga0495652_0013704 Ga0495652_0013704_2698_3807 353
148 3300046536 Ga0495587_0011872 Ga0495587_0011872_3320_4429 353
149 3300046559 Ga0495667_0048724 Ga0495667_0048724_635_1744 353
150 3300046678 Ga0495599_0017560 Ga0495599_0017560_70_1179 353
151 3300047319 Ga0495674_0089876 Ga0495674_0089876_444_1553 353
152 3300047471 Ga0495684_0004842 Ga0495684_0004842_3637_4746 353
153 3300049585 Ga0501069_0011190 Ga0501069_0011190_1609_2733 353
154 3300049586 Ga0501070_0000028 Ga0501070_0000028_64462_65586 353
155 3300049588 Ga0501072_0290131 Ga0501072_0290131_17_1141 353
156 3300049589 Ga0501073_0045418 Ga0501073_0045418_1158_2282 353
157 3300049742 Ga0501080_0067078 Ga0501080_0067078_624_1748 353
158 3300049744 Ga0501083_0013358 Ga0501083_0013358_1454_2578 353
159 3300060353 Ga0501082_0009139 Ga0501082_0009139_1955_3079 353
160 3300061734 Ga0530510_0093476 Ga0530510_0093476_302_1426 353
161 3300032002 Ga0307416_100059955 Ga0307416_1000599552 354
162 3300049583 Ga0501067_0167108 Ga0501067_0167108_50_1201 354
163 3300005458 Ga0070681_10114885 Ga0070681_101148852 355
164 3300005530 Ga0070679_100011799 Ga0070679_1000117995 355
165 3300006844 Ga0075428_100148770 Ga0075428_1001487702 355
166 3300025912 Ga0207707_10035977 Ga0207707_100359771 355
167 3300005353 Ga0070669_100106606 Ga0070669_1001066062 356
168 3300005616 Ga0068852_100179587 Ga0068852_1001795872 356
169 3300005844 Ga0068862_100090918 Ga0068862_1000909182 356
170 3300028380 Ga0268265_10025643 Ga0268265_100256432 356
171 3300005334 Ga0068869_100081823 Ga0068869_1000818232 357
172 3300005340 Ga0070689_100143658 Ga0070689_1001436582 357
173 3300005343 Ga0070687_100023909 Ga0070687_1000239092 357
174 3300005354 Ga0070675_100026745 Ga0070675_1000267453 357
175 3300005365 Ga0070688_100008029 Ga0070688_1000080292 357
176 3300005367 Ga0070667_100028919 Ga0070667_1000289193 357
177 3300005544 Ga0070686_100035412 Ga0070686_1000354122 357
178 3300005564 Ga0070664_100214419 Ga0070664_1002144191 357
179 3300005841 Ga0068863_100143809 Ga0068863_1001438092 357
180 3300009148 Ga0105243_10162046 Ga0105243_101620462 357
181 3300009177 Ga0105248_10047781 Ga0105248_100477814 357
182 3300013308 Ga0157375_10436362 Ga0157375_104363622 357
183 3300025918 Ga0207662_10002958 Ga0207662_100029582 357
184 3300025945 Ga0207679_10108714 Ga0207679_101087143 357
185 3300025949 Ga0207667_10128515 Ga0207667_101285151 357
186 3300026035 Ga0207703_10227851 Ga0207703_102278512 357
187 3300026088 Ga0207641_10248262 Ga0207641_102482622 357
188 3300026089 Ga0207648_10053970 Ga0207648_100539703 357
189 3300006847 Ga0075431_100044701 Ga0075431_1000447012 358
190 3300006852 Ga0075433_10042801 Ga0075433_100428013 359
191 3300007076 Ga0075435_100247066 Ga0075435_1002470662 359
192 3300025933 Ga0207706_10066665 Ga0207706_100666653 359
193 3300027671 Ga0209588_1000651 Ga0209588_10006514 359
194 3300031731 Ga0307405_10013324 Ga0307405_100133243 359
195 3300031995 Ga0307409_100028228 Ga0307409_1000282282 359
196 3300032004 Ga0307414_10065472 Ga0307414_100654722 359
197 3300032126 Ga0307415_100005510 Ga0307415_1000055103 359
198 3300046538 Ga0495609_0019271 Ga0495609_0019271_20_1108 359
199 3300005438 Ga0070701_10001673 Ga0070701_100016733 360
200 3300005444 Ga0070694_100012742 Ga0070694_1000127423 360
201 3300005445 Ga0070708_100350652 Ga0070708_1003506521 360
202 3300005459 Ga0068867_100073667 Ga0068867_1000736671 360
203 3300005545 Ga0070695_100121028 Ga0070695_1001210282 360
204 3300005549 Ga0070704_100246314 Ga0070704_1002463142 360
205 3300005615 Ga0070702_100012591 Ga0070702_1000125913 360
206 3300025918 Ga0207662_10122469 Ga0207662_101224692 360
207 3300045051 Ga0451576_0037323 Ga0451576_0037323_1493_2581 360
208 3300053129 Ga0500628_000349 Ga0500628_000349_6980_8104 360
209 3300009147 Ga0114129_10053176 Ga0114129_100531764 361
210 3300006847 Ga0075431_100195408 Ga0075431_1001954082 362
211 3300006880 Ga0075429_100000580 Ga0075429_10000058019 362
212 3300009147 Ga0114129_10146677 Ga0114129_101466772 362
213 3300042876 Ga0451577_0082574 Ga0451577_0082574_1346_2443 362
214 3300044673 Ga0453683_0071415 Ga0453683_0071415_687_1850 362
215 3300045051 Ga0451576_0152093 Ga0451576_0152093_1027_2124 362
216 3300050507 nmdc:mga05p37_118619_c1 nmdc:mga05p37_118619_c1_1319_2443 362
217 3300050508 nmdc:mga09592_5281_c1 nmdc:mga09592_5281_c1_6902_8026 362
218 3300005327 Ga0070658_10068057 Ga0070658_100680572 363
219 3300005329 Ga0070683_100030900 Ga0070683_1000309002 363
220 3300005329 Ga0070683_100197776 Ga0070683_1001977762 363
221 3300005578 Ga0068854_100064497 Ga0068854_1000644972 363
222 3300013102 Ga0157371_10187646 Ga0157371_101876462 363
223 3300013105 Ga0157369_10270627 Ga0157369_102706272 363
224 3300013307 Ga0157372_10411778 Ga0157372_104117782 363
225 3300025909 Ga0207705_10021286 Ga0207705_100212862 363
226 3300025909 Ga0207705_10065069 Ga0207705_100650692 363
227 3300025913 Ga0207695_10082113 Ga0207695_100821133 363
228 3300025919 Ga0207657_10002769 Ga0207657_1000276919 363
229 3300025961 Ga0207712_10000098 Ga0207712_100000989 363
230 3300025972 Ga0207668_10014828 Ga0207668_100148283 363
231 3300026078 Ga0207702_10237892 Ga0207702_102378922 363
232 3300049582 Ga0501048_0056713 Ga0501048_0056713_767_1873 363
233 3300005445 Ga0070708_100027206 Ga0070708_1000272062 364
234 3300005458 Ga0070681_10206739 Ga0070681_102067392 364
235 3300005468 Ga0070707_100043094 Ga0070707_1000430942 364
236 3300005530 Ga0070679_100031979 Ga0070679_1000319792 364
237 3300009177 Ga0105248_10103960 Ga0105248_101039603 364
238 3300013306 Ga0163162_10078339 Ga0163162_100783394 364
239 3300021388 Ga0213875_10024233 Ga0213875_100242332 364
240 3300025918 Ga0207662_10044062 Ga0207662_100440622 364
241 3300025921 Ga0207652_10044915 Ga0207652_100449153 364
242 3300025922 Ga0207646_10037783 Ga0207646_100377832 364
243 3300037853 Ga0436364_1479970 Ga0436364_1479970_7111_8268 364
244 3300005327 Ga0070658_10094969 Ga0070658_100949692 365
245 3300006847 Ga0075431_100001858 Ga0075431_10000185821 365
246 3300013307 Ga0157372_10013388 Ga0157372_100133886 365
247 3300037471 Ga0395905_0208404 Ga0395905_0208404_80_1216 365
248 3300005530 Ga0070679_100051831 Ga0070679_1000518313 366
249 3300031548 Ga0307408_100203228 Ga0307408_1002032281 366
250 3300031824 Ga0307413_10000979 Ga0307413_100009793 366
251 3300032004 Ga0307414_10053615 Ga0307414_100536152 366
252 3300046476 Ga0495662_0014349 Ga0495662_0014349_2398_3507 366
253 3300046517 Ga0495630_0303371 Ga0495630_0303371_14_1123 366
254 3300046529 Ga0495652_0082458 Ga0495652_0082458_1150_2259 366
255 3300046675 Ga0495657_0104373 Ga0495657_0104373_654_1763 366
256 3300046679 Ga0495623_0063419 Ga0495623_0063419_475_1584 366
257 3300046689 Ga0495613_0181044 Ga0495613_0181044_223_1332 366
258 3300047317 Ga0495604_0118819 Ga0495604_0118819_364_1473 366
259 3300047322 Ga0495680_0038903 Ga0495680_0038903_420_1529 366
260 3300049581 Ga0501047_0033899 Ga0501047_0033899_670_1770 366
261 3300049581 Ga0501047_0149507 Ga0501047_0149507_305_1414 366
262 3300005327 Ga0070658_10023193 Ga0070658_100231932 367
263 3300005616 Ga0068852_100122000 Ga0068852_1001220002 367
264 3300013102 Ga0157371_10093594 Ga0157371_100935942 367
265 3300013105 Ga0157369_10018432 Ga0157369_100184325 367
266 3300005347 Ga0070668_100011038 Ga0070668_1000110384 368
267 3300009553 Ga0105249_10000465 Ga0105249_100004659 368
268 3300014969 Ga0157376_10153555 Ga0157376_101535552 368
269 3300005327 Ga0070658_10005059 Ga0070658_100050595 369
270 3300005339 Ga0070660_100044293 Ga0070660_1000442931 369
271 3300005366 Ga0070659_100006603 Ga0070659_1000066034 369
272 3300005435 Ga0070714_100006639 Ga0070714_1000066396 369
273 3300005539 Ga0068853_100208889 Ga0068853_1002088891 369
274 3300005563 Ga0068855_100111539 Ga0068855_1001115393 369
275 3300013102 Ga0157371_10026474 Ga0157371_100264743 369
276 3300013105 Ga0157369_10092053 Ga0157369_100920532 369
277 3300013307 Ga0157372_10031670 Ga0157372_100316702 369
278 3300025909 Ga0207705_10007100 Ga0207705_100071004 369
279 3300025919 Ga0207657_10025921 Ga0207657_100259214 369
280 3300025929 Ga0207664_10121650 Ga0207664_101216502 369
281 3300025932 Ga0207690_10068331 Ga0207690_100683312 369
282 3300026041 Ga0207639_10068189 Ga0207639_100681891 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

3

142

0.98

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

184

352

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8483 4 361
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8388 4 361
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8363 4 361
7d1i-assembly1.cif.gz_C-2 crystal structure of acinetobacter baumannii murg 0.8294 4 361
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.8289 4 364
ID Description Score Start End Superfamily
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9229 225 344 3.40.50.2000
af_Q2FYL5_179_337_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8958 193 344 3.40.50.2000
af_A0A0N7KD23_75_238_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8864 4 169 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8803 225 344 3.40.50.2000
af_K7KRG7_210_378_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8719 192 347 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7W1BM71-F1-model_v4 Glycosyltransferase 0.9766 93 369 GO:0005975
GO:0016758
GO:0030259
GO:1901137
AF-A0A7Y5R156-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9744 4 329 GO:0005886
GO:0005975
GO:0008360
GO:0009252
GO:0030259
GO:0050511
GO:0051301
GO:0071555
AF-X1T1U9-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9704 247 366 GO:0016758
AF-A0A7Y5R156-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9685 4 329 GO:0005886
GO:0005975
GO:0008360
GO:0009252
GO:0030259
GO:0050511
GO:0051301
GO:0071555
AF-A0A7W1PFU6-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9678 196 368 GO:0016758

Feature Viewer

pLDDT pTM Quality
89.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map