F384980
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 179 | 282 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_10093327|Ga0207660_100933272 |
| Length | 399 |
| Sequence | MRLLVAGGGTGGHLYPGIALAEEVTSRPNGAVLFVGTPRGLETKLVPAAGFDLELLDVSGLNRVGLGKIVKGLGRLPKAFFASRAILKRFRPDLVIGVGGYASGPLVLAAALLGYPTAIQEQNSQPGFTNRVLGAFARRVFVAFEDAKKFFPAKKTRLFGNPVRRKFVTAVRDVDRSVADVARGVLVLGGSQGAKAVNDLVVDAAAVLAKEDRLPPLVHQTGAADEARVREKYAAAGLADRVQLRPFIDDMPTALAAAALVVGRAGALTLAELAMMARPAILIPLPTAAADHQTRNAAEFARAGAAVMVGQRTATGQLLAERIAELMSAPGRRAEMSRHMAALGRPDATREIVDELEALVARRGRGSAAPSDTTTGEPEPATRVADPHGRRSALPSALK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 65 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 100 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 110 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 177 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 98.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10005059 | 3300005327 | Bacteria | 10732 |
| 2 | Ga0070658_10023193 | 3300005327 | Bacteria | 4982 |
| 3 | Ga0070658_10068057 | 3300005327 | Bacteria | 2910 |
| 4 | Ga0070658_10094969 | 3300005327 | Bacteria | 2461 |
| 5 | Ga0070683_100030900 | 3300005329 | Bacteria | 4866 |
| 6 | Ga0070683_100197776 | 3300005329 | Bacteria | 1909 |
| 7 | Ga0068869_100081823 | 3300005334 | Bacteria | 2412 |
| 8 | Ga0070660_100044293 | 3300005339 | Bacteria | 3403 |
| 9 | Ga0070689_100000013 | 3300005340 | Bacteria | 206982 |
| 10 | Ga0070689_100143658 | 3300005340 | Bacteria | 1920 |
| 11 | Ga0070687_100023909 | 3300005343 | Bacteria | 2909 |
| 12 | Ga0070668_100011038 | 3300005347 | Bacteria | 6724 |
| 13 | Ga0070669_100106606 | 3300005353 | Bacteria | 2122 |
| 14 | Ga0070669_100154906 | 3300005353 | Bacteria | 1776 |
| 15 | Ga0070675_100026745 | 3300005354 | Bacteria | 4630 |
| 16 | Ga0070688_100008029 | 3300005365 | Bacteria | 5711 |
| 17 | Ga0070659_100006603 | 3300005366 | Bacteria | 8379 |
| 18 | Ga0070667_100028919 | 3300005367 | Bacteria | 4615 |
| 19 | Ga0070714_100006639 | 3300005435 | Bacteria | 8953 |
| 20 | Ga0070701_10001673 | 3300005438 | Bacteria | 8311 |
| 21 | Ga0070711_100024247 | 3300005439 | Bacteria | 3954 |
| 22 | Ga0070705_100016097 | 3300005440 | Bacteria | 3879 |
| 23 | Ga0070694_100012742 | 3300005444 | Bacteria | 5236 |
| 24 | Ga0070694_100037574 | 3300005444 | Bacteria | 3212 |
| 25 | Ga0070694_100060989 | 3300005444 | Bacteria | 2574 |
| 26 | Ga0070708_100000146 | 3300005445 | Bacteria | 48913 |
| 27 | Ga0070708_100027206 | 3300005445 | Bacteria | 4904 |
| 28 | Ga0070708_100350652 | 3300005445 | Bacteria | 1391 |
| 29 | Ga0070681_10114885 | 3300005458 | Bacteria | 2630 |
| 30 | Ga0070681_10206739 | 3300005458 | Bacteria | 1880 |
| 31 | Ga0068867_100073667 | 3300005459 | Bacteria | 2557 |
| 32 | Ga0070706_100000977 | 3300005467 | Bacteria | 31128 |
| 33 | Ga0070706_100160657 | 3300005467 | Bacteria | 2098 |
| 34 | Ga0070707_100043094 | 3300005468 | Bacteria | 4320 |
| 35 | Ga0070707_100331245 | 3300005468 | Bacteria | 1479 |
| 36 | Ga0070699_100001601 | 3300005518 | Bacteria | 20674 |
| 37 | Ga0070699_100455183 | 3300005518 | Bacteria | 1161 |
| 38 | Ga0070679_100011799 | 3300005530 | Bacteria | 8333 |
| 39 | Ga0070679_100031979 | 3300005530 | Bacteria | 5204 |
| 40 | Ga0070679_100051831 | 3300005530 | Bacteria | 4088 |
| 41 | Ga0070697_100001820 | 3300005536 | Bacteria | 16289 |
| 42 | Ga0068853_100005377 | 3300005539 | Bacteria | 10025 |
| 43 | Ga0068853_100208889 | 3300005539 | Bacteria | 1779 |
| 44 | Ga0070686_100035412 | 3300005544 | Bacteria | 3083 |
| 45 | Ga0070695_100043301 | 3300005545 | Bacteria | 2862 |
| 46 | Ga0070695_100121028 | 3300005545 | Bacteria | 1790 |
| 47 | Ga0070696_100062725 | 3300005546 | Unclassified | 2602 |
| 48 | Ga0070696_100229384 | 3300005546 | Bacteria | 1396 |
| 49 | Ga0070696_100264071 | 3300005546 | Bacteria | 1306 |
| 50 | Ga0070704_100000075 | 3300005549 | Bacteria | 33854 |
| 51 | Ga0070704_100003725 | 3300005549 | Bacteria | 8785 |
| 52 | Ga0070704_100009740 | 3300005549 | Bacteria | 5824 |
| 53 | Ga0070704_100246314 | 3300005549 | Bacteria | 1465 |
| 54 | Ga0068855_100111539 | 3300005563 | Bacteria | 3140 |
| 55 | Ga0068855_100225031 | 3300005563 | Bacteria | 2102 |
| 56 | Ga0070664_100214419 | 3300005564 | Unclassified | 1721 |
| 57 | Ga0068854_100064497 | 3300005578 | Unclassified | 2661 |
| 58 | Ga0068856_100176158 | 3300005614 | Bacteria | 2151 |
| 59 | Ga0070702_100012591 | 3300005615 | Bacteria | 4243 |
| 60 | Ga0068852_100122000 | 3300005616 | Bacteria | 2388 |
| 61 | Ga0068852_100179587 | 3300005616 | Bacteria | 1989 |
| 62 | Ga0068859_100002560 | 3300005617 | Bacteria | 18459 |
| 63 | Ga0068859_100399504 | 3300005617 | Bacteria | 1470 |
| 64 | Ga0068863_100143809 | 3300005841 | Bacteria | 2281 |
| 65 | Ga0068860_100017924 | 3300005843 | Bacteria | 6895 |
| 66 | Ga0068862_100046700 | 3300005844 | Bacteria | 3694 |
| 67 | Ga0068862_100090918 | 3300005844 | Bacteria | 2658 |
| 68 | Ga0070717_10139265 | 3300006028 | Bacteria | 2092 |
| 69 | Ga0075428_100148770 | 3300006844 | Unclassified | 2544 |
| 70 | Ga0075428_100191134 | 3300006844 | Bacteria | 2214 |
| 71 | Ga0075430_100059986 | 3300006846 | Bacteria | 3197 |
| 72 | Ga0075431_100001858 | 3300006847 | Bacteria | 20004 |
| 73 | Ga0075431_100044701 | 3300006847 | Bacteria | 4567 |
| 74 | Ga0075431_100195408 | 3300006847 | Bacteria | 2071 |
| 75 | Ga0075433_10042801 | 3300006852 | Bacteria | 3931 |
| 76 | Ga0075429_100000580 | 3300006880 | Bacteria | 28130 |
| 77 | Ga0068865_100257214 | 3300006881 | Bacteria | 1381 |
| 78 | Ga0097620_100002560 | 3300006931 | Bacteria | 18459 |
| 79 | Ga0097620_100399479 | 3300006931 | Bacteria | 1470 |
| 80 | Ga0075435_100247066 | 3300007076 | Unclassified | 1518 |
| 81 | Ga0099794_10000893 | 3300007265 | Bacteria | 10087 |
| 82 | Ga0105240_10001929 | 3300009093 | Bacteria | 34458 |
| 83 | Ga0114129_10053176 | 3300009147 | Bacteria | 5680 |
| 84 | Ga0114129_10146677 | 3300009147 | Bacteria | 3232 |
| 85 | Ga0105243_10162046 | 3300009148 | Unclassified | 1929 |
| 86 | Ga0105248_10047781 | 3300009177 | Bacteria | 4799 |
| 87 | Ga0105248_10103960 | 3300009177 | Bacteria | 3202 |
| 88 | Ga0105238_10021898 | 3300009551 | Bacteria | 6512 |
| 89 | Ga0105249_10000465 | 3300009553 | Bacteria | 37681 |
| 90 | Ga0105239_10131913 | 3300010375 | Bacteria | 2780 |
| 91 | Ga0157371_10026474 | 3300013102 | Bacteria | 4215 |
| 92 | Ga0157371_10093594 | 3300013102 | Bacteria | 2129 |
| 93 | Ga0157371_10187646 | 3300013102 | Bacteria | 1480 |
| 94 | Ga0157369_10018432 | 3300013105 | Bacteria | 7826 |
| 95 | Ga0157369_10092053 | 3300013105 | Bacteria | 3236 |
| 96 | Ga0157369_10270627 | 3300013105 | Bacteria | 1770 |
| 97 | Ga0163162_10078339 | 3300013306 | Bacteria | 3370 |
| 98 | Ga0157372_10013388 | 3300013307 | Bacteria | 8757 |
| 99 | Ga0157372_10031670 | 3300013307 | Bacteria | 5791 |
| 100 | Ga0157372_10411778 | 3300013307 | Bacteria | 1575 |
| 101 | Ga0157375_10436362 | 3300013308 | Unclassified | 1476 |
| 102 | Ga0157376_10153555 | 3300014969 | Bacteria | 2079 |
| 103 | Ga0213875_10024233 | 3300021388 | Bacteria | 2895 |
| 104 | Ga0207643_10059176 | 3300025908 | Bacteria | 2185 |
| 105 | Ga0207705_10007100 | 3300025909 | Bacteria | 8260 |
| 106 | Ga0207705_10021286 | 3300025909 | Bacteria | 4626 |
| 107 | Ga0207705_10065069 | 3300025909 | Bacteria | 2635 |
| 108 | Ga0207705_10096786 | 3300025909 | Bacteria | 2167 |
| 109 | Ga0207684_10000153 | 3300025910 | Bacteria | 120731 |
| 110 | Ga0207707_10035977 | 3300025912 | Bacteria | 4329 |
| 111 | Ga0207695_10011470 | 3300025913 | Bacteria | 10731 |
| 112 | Ga0207695_10082113 | 3300025913 | Bacteria | 3260 |
| 113 | Ga0207671_10000120 | 3300025914 | Bacteria | 120786 |
| 114 | Ga0207663_10032077 | 3300025916 | Bacteria | 3115 |
| 115 | Ga0207660_10093327 | 3300025917 | Bacteria | 2236 |
| 116 | Ga0207660_10157705 | 3300025917 | Bacteria | 1748 |
| 117 | Ga0207662_10002958 | 3300025918 | Bacteria | 8643 |
| 118 | Ga0207662_10044062 | 3300025918 | Bacteria | 2633 |
| 119 | Ga0207662_10122469 | 3300025918 | Bacteria | 1632 |
| 120 | Ga0207657_10002769 | 3300025919 | Bacteria | 18872 |
| 121 | Ga0207657_10025921 | 3300025919 | Bacteria | 5398 |
| 122 | Ga0207652_10044915 | 3300025921 | Bacteria | 3766 |
| 123 | Ga0207652_10058250 | 3300025921 | Bacteria | 3329 |
| 124 | Ga0207646_10034451 | 3300025922 | Bacteria | 4575 |
| 125 | Ga0207646_10037783 | 3300025922 | Bacteria | 4352 |
| 126 | Ga0207646_10287731 | 3300025922 | Bacteria | 1485 |
| 127 | Ga0207681_10248163 | 3300025923 | Unclassified | 1389 |
| 128 | Ga0207694_10012068 | 3300025924 | Bacteria | 6513 |
| 129 | Ga0207664_10121650 | 3300025929 | Bacteria | 2185 |
| 130 | Ga0207690_10068331 | 3300025932 | Bacteria | 2441 |
| 131 | Ga0207690_10183409 | 3300025932 | Bacteria | 1578 |
| 132 | Ga0207706_10066665 | 3300025933 | Unclassified | 3168 |
| 133 | Ga0207670_10000004 | 3300025936 | Bacteria | 707262 |
| 134 | Ga0207679_10108714 | 3300025945 | Unclassified | 2184 |
| 135 | Ga0207667_10128515 | 3300025949 | Bacteria | 2610 |
| 136 | Ga0207667_10205146 | 3300025949 | Bacteria | 2021 |
| 137 | Ga0207712_10000098 | 3300025961 | Bacteria | 99232 |
| 138 | Ga0207712_10061005 | 3300025961 | Unclassified | 2675 |
| 139 | Ga0207668_10014828 | 3300025972 | Bacteria | 4831 |
| 140 | Ga0207703_10227851 | 3300026035 | Bacteria | 1669 |
| 141 | Ga0207639_10068189 | 3300026041 | Bacteria | 2771 |
| 142 | Ga0207702_10237892 | 3300026078 | Unclassified | 1705 |
| 143 | Ga0207641_10248262 | 3300026088 | Bacteria | 1661 |
| 144 | Ga0207648_10053970 | 3300026089 | Bacteria | 3511 |
| 145 | Ga0209588_1000651 | 3300027671 | Bacteria | 8743 |
| 146 | Ga0209588_1000693 | 3300027671 | Bacteria | 8511 |
| 147 | Ga0268265_10025643 | 3300028380 | Bacteria | 4188 |
| 148 | Ga0268264_10036610 | 3300028381 | Bacteria | 4044 |
| 149 | Ga0265318_10000027 | 3300028577 | Bacteria | 153682 |
| 150 | Ga0265338_10031267 | 3300028800 | Bacteria | 5222 |
| 151 | Ga0265324_10000134 | 3300029957 | Bacteria | 58308 |
| 152 | Ga0265330_10000036 | 3300031235 | Bacteria | 121416 |
| 153 | Ga0265328_10000909 | 3300031239 | Bacteria | 13671 |
| 154 | Ga0265320_10000018 | 3300031240 | Bacteria | 183411 |
| 155 | Ga0265329_10000004 | 3300031242 | Bacteria | 108465 |
| 156 | Ga0265339_10000010 | 3300031249 | Bacteria | 214721 |
| 157 | Ga0265331_10000046 | 3300031250 | Bacteria | 183360 |
| 158 | Ga0265316_10000046 | 3300031344 | Bacteria | 129393 |
| 159 | Ga0265316_10004739 | 3300031344 | Bacteria | 13457 |
| 160 | Ga0307408_100005344 | 3300031548 | Bacteria | 8605 |
| 161 | Ga0307408_100203228 | 3300031548 | Bacteria | 1605 |
| 162 | Ga0265313_10000075 | 3300031595 | Bacteria | 97534 |
| 163 | Ga0265313_10028585 | 3300031595 | Bacteria | 2895 |
| 164 | Ga0265314_10000137 | 3300031711 | Bacteria | 109629 |
| 165 | Ga0265314_10006666 | 3300031711 | Bacteria | 10147 |
| 166 | Ga0265342_10001561 | 3300031712 | Bacteria | 21197 |
| 167 | Ga0265342_10002055 | 3300031712 | Bacteria | 17872 |
| 168 | Ga0265342_10002987 | 3300031712 | Bacteria | 14188 |
| 169 | Ga0265342_10146525 | 3300031712 | Bacteria | 1314 |
| 170 | Ga0316576_10076355 | 3300031727 | Bacteria | 2479 |
| 171 | Ga0316578_10090551 | 3300031728 | Bacteria | 1826 |
| 172 | Ga0307405_10013324 | 3300031731 | Bacteria | 4384 |
| 173 | Ga0307413_10000979 | 3300031824 | Bacteria | 10251 |
| 174 | Ga0307413_10003218 | 3300031824 | Bacteria | 6831 |
| 175 | Ga0307413_10025587 | 3300031824 | Bacteria | 3237 |
| 176 | Ga0307410_10007149 | 3300031852 | Bacteria | 6088 |
| 177 | Ga0307410_10007514 | 3300031852 | Bacteria | 5972 |
| 178 | Ga0307406_10001775 | 3300031901 | Bacteria | 11789 |
| 179 | Ga0307407_10024636 | 3300031903 | Bacteria | 3158 |
| 180 | Ga0307412_10004828 | 3300031911 | Bacteria | 7523 |
| 181 | Ga0307412_10143720 | 3300031911 | Bacteria | 1751 |
| 182 | Ga0307409_100003453 | 3300031995 | Bacteria | 8582 |
| 183 | Ga0307409_100028228 | 3300031995 | Unclassified | 3993 |
| 184 | Ga0307416_100027982 | 3300032002 | Bacteria | 4184 |
| 185 | Ga0307416_100059955 | 3300032002 | Bacteria | 3096 |
| 186 | Ga0307416_100070002 | 3300032002 | Unclassified | 2906 |
| 187 | Ga0307414_10015042 | 3300032004 | Bacteria | 4661 |
| 188 | Ga0307414_10053615 | 3300032004 | Bacteria | 2813 |
| 189 | Ga0307414_10065472 | 3300032004 | Unclassified | 2593 |
| 190 | Ga0307411_10003243 | 3300032005 | Bacteria | 7500 |
| 191 | Ga0307411_10015232 | 3300032005 | Bacteria | 4312 |
| 192 | Ga0307415_100005510 | 3300032126 | Bacteria | 6728 |
| 193 | Ga0307415_100009037 | 3300032126 | Bacteria | 5560 |
| 194 | Ga0373950_0000020 | 3300034818 | Bacteria | 209621 |
| 195 | Ga0373950_0000089 | 3300034818 | Bacteria | 25034 |
| 196 | Ga0373941_0026913 | 3300035115 | Bacteria | 1674 |
| 197 | Ga0373933_0001302 | 3300035724 | Bacteria | 14689 |
| 198 | Ga0373937_0007303 | 3300036401 | Bacteria | 9565 |
| 199 | Ga0395905_0208404 | 3300037471 | Bacteria | 1832 |
| 200 | Ga0436364_1479970 | 3300037853 | Bacteria | 18078 |
| 201 | Ga0451577_0015623 | 3300042876 | Bacteria | 7055 |
| 202 | Ga0451577_0082574 | 3300042876 | Bacteria | 2867 |
| 203 | Ga0453683_0071415 | 3300044673 | Bacteria | 2172 |
| 204 | Ga0453684_0008034 | 3300044712 | Bacteria | 19091 |
| 205 | Ga0453684_0282296 | 3300044712 | Bacteria | 1893 |
| 206 | Ga0451576_0007805 | 3300045051 | Bacteria | 12691 |
| 207 | Ga0451576_0037323 | 3300045051 | Bacteria | 5147 |
| 208 | Ga0451576_0152093 | 3300045051 | Bacteria | 2413 |
| 209 | Ga0495662_0014349 | 3300046476 | Bacteria | 3855 |
| 210 | Ga0495594_0132335 | 3300046499 | Bacteria | 1413 |
| 211 | Ga0495608_0007318 | 3300046511 | Bacteria | 7801 |
| 212 | Ga0495628_0012138 | 3300046516 | Bacteria | 7262 |
| 213 | Ga0495630_0303371 | 3300046517 | Bacteria | 1220 |
| 214 | Ga0495652_0013704 | 3300046529 | Bacteria | 7294 |
| 215 | Ga0495652_0082458 | 3300046529 | Bacteria | 2650 |
| 216 | Ga0495587_0011872 | 3300046536 | Bacteria | 5506 |
| 217 | Ga0495609_0019271 | 3300046538 | Unclassified | 3160 |
| 218 | Ga0495667_0048724 | 3300046559 | Bacteria | 2797 |
| 219 | Ga0495657_0104373 | 3300046675 | Bacteria | 1802 |
| 220 | Ga0495599_0017560 | 3300046678 | Bacteria | 4447 |
| 221 | Ga0495623_0063419 | 3300046679 | Bacteria | 2314 |
| 222 | Ga0495613_0181044 | 3300046689 | Bacteria | 1492 |
| 223 | Ga0495604_0118819 | 3300047317 | Bacteria | 1916 |
| 224 | Ga0495674_0089876 | 3300047319 | Bacteria | 2625 |
| 225 | Ga0495680_0038903 | 3300047322 | Bacteria | 3798 |
| 226 | Ga0495684_0004842 | 3300047471 | Bacteria | 10508 |
| 227 | Ga0495615_0005479 | 3300048090 | Bacteria | 2285 |
| 228 | Ga0496108_0117806 | 3300048911 | Bacteria | 2276 |
| 229 | Ga0496114_0161401 | 3300048917 | Bacteria | 1949 |
| 230 | Ga0501032_0069193 | 3300049569 | Bacteria | 2356 |
| 231 | Ga0501034_0000026 | 3300049571 | Bacteria | 261125 |
| 232 | Ga0501041_0035105 | 3300049577 | Bacteria | 3038 |
| 233 | Ga0501043_0064360 | 3300049579 | Bacteria | 2879 |
| 234 | Ga0501046_0001137 | 3300049580 | Bacteria | 25940 |
| 235 | Ga0501047_0000017 | 3300049581 | Bacteria | 276932 |
| 236 | Ga0501047_0033899 | 3300049581 | Bacteria | 4928 |
| 237 | Ga0501047_0149507 | 3300049581 | Bacteria | 2212 |
| 238 | Ga0501048_0001028 | 3300049582 | Bacteria | 20869 |
| 239 | Ga0501048_0056713 | 3300049582 | Unclassified | 2779 |
| 240 | Ga0501067_0000032 | 3300049583 | Bacteria | 86474 |
| 241 | Ga0501067_0048464 | 3300049583 | Bacteria | 2356 |
| 242 | Ga0501067_0167108 | 3300049583 | Unclassified | 1225 |
| 243 | Ga0501068_0018539 | 3300049584 | Bacteria | 4029 |
| 244 | Ga0501068_0079602 | 3300049584 | Bacteria | 2009 |
| 245 | Ga0501069_0011190 | 3300049585 | Bacteria | 4759 |
| 246 | Ga0501069_0031973 | 3300049585 | Unclassified | 2897 |
| 247 | Ga0501070_0000028 | 3300049586 | Bacteria | 140133 |
| 248 | Ga0501070_0003690 | 3300049586 | Bacteria | 13236 |
| 249 | Ga0501070_0034893 | 3300049586 | Bacteria | 4204 |
| 250 | Ga0501070_0133917 | 3300049586 | Bacteria | 2046 |
| 251 | Ga0501072_0000033 | 3300049588 | Bacteria | 125387 |
| 252 | Ga0501072_0281093 | 3300049588 | Bacteria | 1324 |
| 253 | Ga0501072_0290131 | 3300049588 | Unclassified | 1301 |
| 254 | Ga0501073_0000494 | 3300049589 | Bacteria | 27500 |
| 255 | Ga0501073_0000682 | 3300049589 | Bacteria | 23895 |
| 256 | Ga0501073_0002534 | 3300049589 | Bacteria | 13654 |
| 257 | Ga0501073_0045418 | 3300049589 | Bacteria | 3093 |
| 258 | Ga0501074_0000360 | 3300049590 | Bacteria | 26745 |
| 259 | Ga0501074_0062489 | 3300049590 | Bacteria | 2682 |
| 260 | Ga0501076_0288424 | 3300049592 | Bacteria | 1345 |
| 261 | Ga0501079_0000744 | 3300049741 | Bacteria | 22127 |
| 262 | Ga0501079_0059383 | 3300049741 | Bacteria | 2950 |
| 263 | Ga0501080_0003185 | 3300049742 | Bacteria | 14470 |
| 264 | Ga0501080_0016976 | 3300049742 | Bacteria | 6722 |
| 265 | Ga0501080_0067078 | 3300049742 | Bacteria | 3337 |
| 266 | Ga0501080_0290540 | 3300049742 | Bacteria | 1484 |
| 267 | Ga0501083_0011866 | 3300049744 | Bacteria | 6106 |
| 268 | Ga0501083_0013358 | 3300049744 | Bacteria | 5741 |
| 269 | Ga0501083_0020248 | 3300049744 | Bacteria | 4629 |
| 270 | Ga0501035_0000176 | 3300049822 | Bacteria | 78707 |
| 271 | Ga0501045_0058504 | 3300049824 | Bacteria | 2823 |
| 272 | nmdc:mga05p37_118619_c1 | 3300050507 | Bacteria | 3251 |
| 273 | nmdc:mga09592_5281_c1 | 3300050508 | Bacteria | 10497 |
| 274 | nmdc:mga06r32_86849_c1 | 3300050510 | Bacteria | 3051 |
| 275 | nmdc:mga08y16_175002_c1 | 3300050511 | Bacteria | 2228 |
| 276 | Ga0500628_000349 | 3300053129 | Bacteria | 8798 |
| 277 | Ga0501084_0000003 | 3300054114 | Bacteria | 267909 |
| 278 | Ga0501082_0000042 | 3300060353 | Bacteria | 89973 |
| 279 | Ga0501082_0009139 | 3300060353 | Bacteria | 8544 |
| 280 | Ga0501082_0040556 | 3300060353 | Bacteria | 4015 |
| 281 | Ga0501082_0050093 | 3300060353 | Bacteria | 3602 |
| 282 | Ga0530510_0093476 | 3300061734 | Bacteria | 2196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050510 | nmdc:mga06r32_86849_c1 | nmdc:mga06r32_86849_c1_763_1677 | 302 |
| 2 | 3300007265 | Ga0099794_10000893 | Ga0099794_100008936 | 303 |
| 3 | 3300025917 | Ga0207660_10157705 | Ga0207660_101577051 | 304 |
| 4 | 3300025908 | Ga0207643_10059176 | Ga0207643_100591762 | 310 |
| 5 | 3300028577 | Ga0265318_10000027 | Ga0265318_1000002732 | 318 |
| 6 | 3300031235 | Ga0265330_10000036 | Ga0265330_1000003674 | 318 |
| 7 | 3300031239 | Ga0265328_10000909 | Ga0265328_100009094 | 318 |
| 8 | 3300031240 | Ga0265320_10000018 | Ga0265320_10000018131 | 318 |
| 9 | 3300031250 | Ga0265331_10000046 | Ga0265331_10000046130 | 318 |
| 10 | 3300031344 | Ga0265316_10004739 | Ga0265316_100047394 | 318 |
| 11 | 3300031595 | Ga0265313_10000075 | Ga0265313_1000007532 | 318 |
| 12 | 3300031711 | Ga0265314_10000137 | Ga0265314_1000013732 | 318 |
| 13 | 3300031712 | Ga0265342_10002987 | Ga0265342_100029876 | 318 |
| 14 | 3300005444 | Ga0070694_100037574 | Ga0070694_1000375742 | 324 |
| 15 | 3300031727 | Ga0316576_10076355 | Ga0316576_100763552 | 324 |
| 16 | 3300031728 | Ga0316578_10090551 | Ga0316578_100905512 | 324 |
| 17 | 3300025916 | Ga0207663_10032077 | Ga0207663_100320771 | 325 |
| 18 | 3300025913 | Ga0207695_10011470 | Ga0207695_100114707 | 327 |
| 19 | 3300005518 | Ga0070699_100455183 | Ga0070699_1004551831 | 328 |
| 20 | 3300009093 | Ga0105240_10001929 | Ga0105240_100019297 | 328 |
| 21 | 3300005439 | Ga0070711_100024247 | Ga0070711_1000242473 | 329 |
| 22 | 3300006881 | Ga0068865_100257214 | Ga0068865_1002572141 | 330 |
| 23 | 3300028800 | Ga0265338_10031267 | Ga0265338_100312674 | 331 |
| 24 | 3300029957 | Ga0265324_10000134 | Ga0265324_1000013450 | 331 |
| 25 | 3300031242 | Ga0265329_10000004 | Ga0265329_1000000410 | 331 |
| 26 | 3300031249 | Ga0265339_10000010 | Ga0265339_100000105 | 331 |
| 27 | 3300031344 | Ga0265316_10000046 | Ga0265316_1000004637 | 331 |
| 28 | 3300031711 | Ga0265314_10006666 | Ga0265314_100066664 | 331 |
| 29 | 3300031712 | Ga0265342_10001561 | Ga0265342_100015617 | 331 |
| 30 | 3300005467 | Ga0070706_100000977 | Ga0070706_10000097723 | 335 |
| 31 | 3300005536 | Ga0070697_100001820 | Ga0070697_10000182011 | 335 |
| 32 | 3300025910 | Ga0207684_10000153 | Ga0207684_1000015363 | 335 |
| 33 | 3300025922 | Ga0207646_10034451 | Ga0207646_100344513 | 335 |
| 34 | 3300049822 | Ga0501035_0000176 | Ga0501035_0000176_3355_4500 | 335 |
| 35 | 3300005445 | Ga0070708_100000146 | Ga0070708_1000001465 | 337 |
| 36 | 3300006028 | Ga0070717_10139265 | Ga0070717_101392652 | 337 |
| 37 | 3300027671 | Ga0209588_1000693 | Ga0209588_10006933 | 337 |
| 38 | 3300005843 | Ga0068860_100017924 | Ga0068860_1000179242 | 341 |
| 39 | 3300006846 | Ga0075430_100059986 | Ga0075430_1000599863 | 341 |
| 40 | 3300028381 | Ga0268264_10036610 | Ga0268264_100366102 | 341 |
| 41 | 3300005440 | Ga0070705_100016097 | Ga0070705_1000160972 | 343 |
| 42 | 3300005546 | Ga0070696_100229384 | Ga0070696_1002293841 | 343 |
| 43 | 3300005549 | Ga0070704_100003725 | Ga0070704_1000037257 | 343 |
| 44 | 3300005518 | Ga0070699_100001601 | Ga0070699_1000016017 | 344 |
| 45 | 3300005545 | Ga0070695_100043301 | Ga0070695_1000433012 | 344 |
| 46 | 3300005546 | Ga0070696_100062725 | Ga0070696_1000627252 | 344 |
| 47 | 3300005546 | Ga0070696_100264071 | Ga0070696_1002640711 | 344 |
| 48 | 3300005549 | Ga0070704_100009740 | Ga0070704_1000097405 | 344 |
| 49 | 3300006844 | Ga0075428_100191134 | Ga0075428_1001911342 | 344 |
| 50 | 3300031548 | Ga0307408_100005344 | Ga0307408_1000053444 | 344 |
| 51 | 3300031824 | Ga0307413_10003218 | Ga0307413_100032183 | 344 |
| 52 | 3300031824 | Ga0307413_10025587 | Ga0307413_100255873 | 344 |
| 53 | 3300031852 | Ga0307410_10007149 | Ga0307410_100071493 | 344 |
| 54 | 3300031852 | Ga0307410_10007514 | Ga0307410_100075143 | 344 |
| 55 | 3300031901 | Ga0307406_10001775 | Ga0307406_100017757 | 344 |
| 56 | 3300031903 | Ga0307407_10024636 | Ga0307407_100246362 | 344 |
| 57 | 3300031911 | Ga0307412_10004828 | Ga0307412_100048282 | 344 |
| 58 | 3300031911 | Ga0307412_10143720 | Ga0307412_101437202 | 344 |
| 59 | 3300031995 | Ga0307409_100003453 | Ga0307409_1000034537 | 344 |
| 60 | 3300032002 | Ga0307416_100027982 | Ga0307416_1000279822 | 344 |
| 61 | 3300032002 | Ga0307416_100070002 | Ga0307416_1000700021 | 344 |
| 62 | 3300032004 | Ga0307414_10015042 | Ga0307414_100150423 | 344 |
| 63 | 3300032005 | Ga0307411_10003243 | Ga0307411_100032434 | 344 |
| 64 | 3300032005 | Ga0307411_10015232 | Ga0307411_100152322 | 344 |
| 65 | 3300032126 | Ga0307415_100009037 | Ga0307415_1000090373 | 344 |
| 66 | 3300005353 | Ga0070669_100154906 | Ga0070669_1001549062 | 345 |
| 67 | 3300005444 | Ga0070694_100060989 | Ga0070694_1000609892 | 345 |
| 68 | 3300005467 | Ga0070706_100160657 | Ga0070706_1001606572 | 345 |
| 69 | 3300005468 | Ga0070707_100331245 | Ga0070707_1003312451 | 345 |
| 70 | 3300005549 | Ga0070704_100000075 | Ga0070704_1000000752 | 345 |
| 71 | 3300005617 | Ga0068859_100399504 | Ga0068859_1003995041 | 345 |
| 72 | 3300005844 | Ga0068862_100046700 | Ga0068862_1000467002 | 345 |
| 73 | 3300006931 | Ga0097620_100399479 | Ga0097620_1003994791 | 345 |
| 74 | 3300025922 | Ga0207646_10287731 | Ga0207646_102877312 | 345 |
| 75 | 3300025923 | Ga0207681_10248163 | Ga0207681_102481631 | 345 |
| 76 | 3300025961 | Ga0207712_10061005 | Ga0207712_100610052 | 345 |
| 77 | 3300031712 | Ga0265342_10002055 | Ga0265342_1000205512 | 345 |
| 78 | 3300034818 | Ga0373950_0000089 | Ga0373950_0000089_21984_23153 | 345 |
| 79 | 3300049583 | Ga0501067_0000032 | Ga0501067_0000032_82827_83996 | 345 |
| 80 | 3300049589 | Ga0501073_0000682 | Ga0501073_0000682_10477_11646 | 345 |
| 81 | 3300050511 | nmdc:mga08y16_175002_c1 | nmdc:mga08y16_175002_c1_337_1383 | 345 |
| 82 | 3300048911 | Ga0496108_0117806 | Ga0496108_0117806_272_1393 | 346 |
| 83 | 3300025914 | Ga0207671_10000120 | Ga0207671_100001202 | 347 |
| 84 | 3300049577 | Ga0501041_0035105 | Ga0501041_0035105_140_1231 | 347 |
| 85 | 3300049588 | Ga0501072_0281093 | Ga0501072_0281093_163_1254 | 347 |
| 86 | 3300049592 | Ga0501076_0288424 | Ga0501076_0288424_229_1320 | 347 |
| 87 | 3300049741 | Ga0501079_0059383 | Ga0501079_0059383_617_1708 | 347 |
| 88 | 3300049824 | Ga0501045_0058504 | Ga0501045_0058504_424_1515 | 347 |
| 89 | 3300060353 | Ga0501082_0050093 | Ga0501082_0050093_1926_3017 | 347 |
| 90 | 3300042876 | Ga0451577_0015623 | Ga0451577_0015623_2958_4040 | 348 |
| 91 | 3300044712 | Ga0453684_0008034 | Ga0453684_0008034_1335_2417 | 348 |
| 92 | 3300044712 | Ga0453684_0282296 | Ga0453684_0282296_46_1128 | 348 |
| 93 | 3300045051 | Ga0451576_0007805 | Ga0451576_0007805_8739_9821 | 348 |
| 94 | 3300046499 | Ga0495594_0132335 | Ga0495594_0132335_70_1206 | 348 |
| 95 | 3300049585 | Ga0501069_0031973 | Ga0501069_0031973_1384_2469 | 348 |
| 96 | 3300049586 | Ga0501070_0034893 | Ga0501070_0034893_1804_2889 | 348 |
| 97 | 3300025909 | Ga0207705_10096786 | Ga0207705_100967862 | 349 |
| 98 | 3300025917 | Ga0207660_10093327 | Ga0207660_100933272 | 349 |
| 99 | 3300025932 | Ga0207690_10183409 | Ga0207690_101834092 | 349 |
| 100 | 3300005340 | Ga0070689_100000013 | Ga0070689_10000001361 | 350 |
| 101 | 3300005614 | Ga0068856_100176158 | Ga0068856_1001761582 | 350 |
| 102 | 3300010375 | Ga0105239_10131913 | Ga0105239_101319132 | 350 |
| 103 | 3300025921 | Ga0207652_10058250 | Ga0207652_100582502 | 350 |
| 104 | 3300025936 | Ga0207670_10000004 | Ga0207670_10000004591 | 350 |
| 105 | 3300031595 | Ga0265313_10028585 | Ga0265313_100285852 | 351 |
| 106 | 3300031712 | Ga0265342_10146525 | Ga0265342_101465251 | 351 |
| 107 | 3300034818 | Ga0373950_0000020 | Ga0373950_0000020_154123_155232 | 351 |
| 108 | 3300035115 | Ga0373941_0026913 | Ga0373941_0026913_490_1599 | 351 |
| 109 | 3300049569 | Ga0501032_0069193 | Ga0501032_0069193_80_1189 | 351 |
| 110 | 3300049571 | Ga0501034_0000026 | Ga0501034_0000026_254773_255882 | 351 |
| 111 | 3300049579 | Ga0501043_0064360 | Ga0501043_0064360_1381_2490 | 351 |
| 112 | 3300049580 | Ga0501046_0001137 | Ga0501046_0001137_19745_20854 | 351 |
| 113 | 3300049581 | Ga0501047_0000017 | Ga0501047_0000017_270614_271723 | 351 |
| 114 | 3300049582 | Ga0501048_0001028 | Ga0501048_0001028_17520_18629 | 351 |
| 115 | 3300049583 | Ga0501067_0048464 | Ga0501067_0048464_1027_2136 | 351 |
| 116 | 3300049584 | Ga0501068_0018539 | Ga0501068_0018539_1698_2807 | 351 |
| 117 | 3300049584 | Ga0501068_0079602 | Ga0501068_0079602_103_1215 | 351 |
| 118 | 3300049586 | Ga0501070_0003690 | Ga0501070_0003690_6521_7630 | 351 |
| 119 | 3300049586 | Ga0501070_0133917 | Ga0501070_0133917_579_1691 | 351 |
| 120 | 3300049588 | Ga0501072_0000033 | Ga0501072_0000033_71534_72643 | 351 |
| 121 | 3300049589 | Ga0501073_0000494 | Ga0501073_0000494_3854_4963 | 351 |
| 122 | 3300049589 | Ga0501073_0002534 | Ga0501073_0002534_1690_2802 | 351 |
| 123 | 3300049590 | Ga0501074_0000360 | Ga0501074_0000360_21455_22564 | 351 |
| 124 | 3300049590 | Ga0501074_0062489 | Ga0501074_0062489_96_1208 | 351 |
| 125 | 3300049741 | Ga0501079_0000744 | Ga0501079_0000744_19899_21008 | 351 |
| 126 | 3300049742 | Ga0501080_0003185 | Ga0501080_0003185_2871_3983 | 351 |
| 127 | 3300049742 | Ga0501080_0016976 | Ga0501080_0016976_5096_6205 | 351 |
| 128 | 3300049742 | Ga0501080_0290540 | Ga0501080_0290540_129_1238 | 351 |
| 129 | 3300049744 | Ga0501083_0011866 | Ga0501083_0011866_4409_5521 | 351 |
| 130 | 3300049744 | Ga0501083_0020248 | Ga0501083_0020248_1399_2508 | 351 |
| 131 | 3300054114 | Ga0501084_0000003 | Ga0501084_0000003_4949_6058 | 351 |
| 132 | 3300060353 | Ga0501082_0000042 | Ga0501082_0000042_39870_40979 | 351 |
| 133 | 3300060353 | Ga0501082_0040556 | Ga0501082_0040556_1878_2990 | 351 |
| 134 | 3300005539 | Ga0068853_100005377 | Ga0068853_1000053778 | 352 |
| 135 | 3300048090 | Ga0495615_0005479 | Ga0495615_0005479_256_1476 | 352 |
| 136 | 3300048917 | Ga0496114_0161401 | Ga0496114_0161401_351_1478 | 352 |
| 137 | 3300005563 | Ga0068855_100225031 | Ga0068855_1002250312 | 353 |
| 138 | 3300005617 | Ga0068859_100002560 | Ga0068859_10000256013 | 353 |
| 139 | 3300006931 | Ga0097620_100002560 | Ga0097620_10000256013 | 353 |
| 140 | 3300009551 | Ga0105238_10021898 | Ga0105238_100218983 | 353 |
| 141 | 3300025924 | Ga0207694_10012068 | Ga0207694_100120683 | 353 |
| 142 | 3300025949 | Ga0207667_10205146 | Ga0207667_102051462 | 353 |
| 143 | 3300035724 | Ga0373933_0001302 | Ga0373933_0001302_5987_7141 | 353 |
| 144 | 3300036401 | Ga0373937_0007303 | Ga0373937_0007303_3620_4774 | 353 |
| 145 | 3300046511 | Ga0495608_0007318 | Ga0495608_0007318_4252_5361 | 353 |
| 146 | 3300046516 | Ga0495628_0012138 | Ga0495628_0012138_3486_4595 | 353 |
| 147 | 3300046529 | Ga0495652_0013704 | Ga0495652_0013704_2698_3807 | 353 |
| 148 | 3300046536 | Ga0495587_0011872 | Ga0495587_0011872_3320_4429 | 353 |
| 149 | 3300046559 | Ga0495667_0048724 | Ga0495667_0048724_635_1744 | 353 |
| 150 | 3300046678 | Ga0495599_0017560 | Ga0495599_0017560_70_1179 | 353 |
| 151 | 3300047319 | Ga0495674_0089876 | Ga0495674_0089876_444_1553 | 353 |
| 152 | 3300047471 | Ga0495684_0004842 | Ga0495684_0004842_3637_4746 | 353 |
| 153 | 3300049585 | Ga0501069_0011190 | Ga0501069_0011190_1609_2733 | 353 |
| 154 | 3300049586 | Ga0501070_0000028 | Ga0501070_0000028_64462_65586 | 353 |
| 155 | 3300049588 | Ga0501072_0290131 | Ga0501072_0290131_17_1141 | 353 |
| 156 | 3300049589 | Ga0501073_0045418 | Ga0501073_0045418_1158_2282 | 353 |
| 157 | 3300049742 | Ga0501080_0067078 | Ga0501080_0067078_624_1748 | 353 |
| 158 | 3300049744 | Ga0501083_0013358 | Ga0501083_0013358_1454_2578 | 353 |
| 159 | 3300060353 | Ga0501082_0009139 | Ga0501082_0009139_1955_3079 | 353 |
| 160 | 3300061734 | Ga0530510_0093476 | Ga0530510_0093476_302_1426 | 353 |
| 161 | 3300032002 | Ga0307416_100059955 | Ga0307416_1000599552 | 354 |
| 162 | 3300049583 | Ga0501067_0167108 | Ga0501067_0167108_50_1201 | 354 |
| 163 | 3300005458 | Ga0070681_10114885 | Ga0070681_101148852 | 355 |
| 164 | 3300005530 | Ga0070679_100011799 | Ga0070679_1000117995 | 355 |
| 165 | 3300006844 | Ga0075428_100148770 | Ga0075428_1001487702 | 355 |
| 166 | 3300025912 | Ga0207707_10035977 | Ga0207707_100359771 | 355 |
| 167 | 3300005353 | Ga0070669_100106606 | Ga0070669_1001066062 | 356 |
| 168 | 3300005616 | Ga0068852_100179587 | Ga0068852_1001795872 | 356 |
| 169 | 3300005844 | Ga0068862_100090918 | Ga0068862_1000909182 | 356 |
| 170 | 3300028380 | Ga0268265_10025643 | Ga0268265_100256432 | 356 |
| 171 | 3300005334 | Ga0068869_100081823 | Ga0068869_1000818232 | 357 |
| 172 | 3300005340 | Ga0070689_100143658 | Ga0070689_1001436582 | 357 |
| 173 | 3300005343 | Ga0070687_100023909 | Ga0070687_1000239092 | 357 |
| 174 | 3300005354 | Ga0070675_100026745 | Ga0070675_1000267453 | 357 |
| 175 | 3300005365 | Ga0070688_100008029 | Ga0070688_1000080292 | 357 |
| 176 | 3300005367 | Ga0070667_100028919 | Ga0070667_1000289193 | 357 |
| 177 | 3300005544 | Ga0070686_100035412 | Ga0070686_1000354122 | 357 |
| 178 | 3300005564 | Ga0070664_100214419 | Ga0070664_1002144191 | 357 |
| 179 | 3300005841 | Ga0068863_100143809 | Ga0068863_1001438092 | 357 |
| 180 | 3300009148 | Ga0105243_10162046 | Ga0105243_101620462 | 357 |
| 181 | 3300009177 | Ga0105248_10047781 | Ga0105248_100477814 | 357 |
| 182 | 3300013308 | Ga0157375_10436362 | Ga0157375_104363622 | 357 |
| 183 | 3300025918 | Ga0207662_10002958 | Ga0207662_100029582 | 357 |
| 184 | 3300025945 | Ga0207679_10108714 | Ga0207679_101087143 | 357 |
| 185 | 3300025949 | Ga0207667_10128515 | Ga0207667_101285151 | 357 |
| 186 | 3300026035 | Ga0207703_10227851 | Ga0207703_102278512 | 357 |
| 187 | 3300026088 | Ga0207641_10248262 | Ga0207641_102482622 | 357 |
| 188 | 3300026089 | Ga0207648_10053970 | Ga0207648_100539703 | 357 |
| 189 | 3300006847 | Ga0075431_100044701 | Ga0075431_1000447012 | 358 |
| 190 | 3300006852 | Ga0075433_10042801 | Ga0075433_100428013 | 359 |
| 191 | 3300007076 | Ga0075435_100247066 | Ga0075435_1002470662 | 359 |
| 192 | 3300025933 | Ga0207706_10066665 | Ga0207706_100666653 | 359 |
| 193 | 3300027671 | Ga0209588_1000651 | Ga0209588_10006514 | 359 |
| 194 | 3300031731 | Ga0307405_10013324 | Ga0307405_100133243 | 359 |
| 195 | 3300031995 | Ga0307409_100028228 | Ga0307409_1000282282 | 359 |
| 196 | 3300032004 | Ga0307414_10065472 | Ga0307414_100654722 | 359 |
| 197 | 3300032126 | Ga0307415_100005510 | Ga0307415_1000055103 | 359 |
| 198 | 3300046538 | Ga0495609_0019271 | Ga0495609_0019271_20_1108 | 359 |
| 199 | 3300005438 | Ga0070701_10001673 | Ga0070701_100016733 | 360 |
| 200 | 3300005444 | Ga0070694_100012742 | Ga0070694_1000127423 | 360 |
| 201 | 3300005445 | Ga0070708_100350652 | Ga0070708_1003506521 | 360 |
| 202 | 3300005459 | Ga0068867_100073667 | Ga0068867_1000736671 | 360 |
| 203 | 3300005545 | Ga0070695_100121028 | Ga0070695_1001210282 | 360 |
| 204 | 3300005549 | Ga0070704_100246314 | Ga0070704_1002463142 | 360 |
| 205 | 3300005615 | Ga0070702_100012591 | Ga0070702_1000125913 | 360 |
| 206 | 3300025918 | Ga0207662_10122469 | Ga0207662_101224692 | 360 |
| 207 | 3300045051 | Ga0451576_0037323 | Ga0451576_0037323_1493_2581 | 360 |
| 208 | 3300053129 | Ga0500628_000349 | Ga0500628_000349_6980_8104 | 360 |
| 209 | 3300009147 | Ga0114129_10053176 | Ga0114129_100531764 | 361 |
| 210 | 3300006847 | Ga0075431_100195408 | Ga0075431_1001954082 | 362 |
| 211 | 3300006880 | Ga0075429_100000580 | Ga0075429_10000058019 | 362 |
| 212 | 3300009147 | Ga0114129_10146677 | Ga0114129_101466772 | 362 |
| 213 | 3300042876 | Ga0451577_0082574 | Ga0451577_0082574_1346_2443 | 362 |
| 214 | 3300044673 | Ga0453683_0071415 | Ga0453683_0071415_687_1850 | 362 |
| 215 | 3300045051 | Ga0451576_0152093 | Ga0451576_0152093_1027_2124 | 362 |
| 216 | 3300050507 | nmdc:mga05p37_118619_c1 | nmdc:mga05p37_118619_c1_1319_2443 | 362 |
| 217 | 3300050508 | nmdc:mga09592_5281_c1 | nmdc:mga09592_5281_c1_6902_8026 | 362 |
| 218 | 3300005327 | Ga0070658_10068057 | Ga0070658_100680572 | 363 |
| 219 | 3300005329 | Ga0070683_100030900 | Ga0070683_1000309002 | 363 |
| 220 | 3300005329 | Ga0070683_100197776 | Ga0070683_1001977762 | 363 |
| 221 | 3300005578 | Ga0068854_100064497 | Ga0068854_1000644972 | 363 |
| 222 | 3300013102 | Ga0157371_10187646 | Ga0157371_101876462 | 363 |
| 223 | 3300013105 | Ga0157369_10270627 | Ga0157369_102706272 | 363 |
| 224 | 3300013307 | Ga0157372_10411778 | Ga0157372_104117782 | 363 |
| 225 | 3300025909 | Ga0207705_10021286 | Ga0207705_100212862 | 363 |
| 226 | 3300025909 | Ga0207705_10065069 | Ga0207705_100650692 | 363 |
| 227 | 3300025913 | Ga0207695_10082113 | Ga0207695_100821133 | 363 |
| 228 | 3300025919 | Ga0207657_10002769 | Ga0207657_1000276919 | 363 |
| 229 | 3300025961 | Ga0207712_10000098 | Ga0207712_100000989 | 363 |
| 230 | 3300025972 | Ga0207668_10014828 | Ga0207668_100148283 | 363 |
| 231 | 3300026078 | Ga0207702_10237892 | Ga0207702_102378922 | 363 |
| 232 | 3300049582 | Ga0501048_0056713 | Ga0501048_0056713_767_1873 | 363 |
| 233 | 3300005445 | Ga0070708_100027206 | Ga0070708_1000272062 | 364 |
| 234 | 3300005458 | Ga0070681_10206739 | Ga0070681_102067392 | 364 |
| 235 | 3300005468 | Ga0070707_100043094 | Ga0070707_1000430942 | 364 |
| 236 | 3300005530 | Ga0070679_100031979 | Ga0070679_1000319792 | 364 |
| 237 | 3300009177 | Ga0105248_10103960 | Ga0105248_101039603 | 364 |
| 238 | 3300013306 | Ga0163162_10078339 | Ga0163162_100783394 | 364 |
| 239 | 3300021388 | Ga0213875_10024233 | Ga0213875_100242332 | 364 |
| 240 | 3300025918 | Ga0207662_10044062 | Ga0207662_100440622 | 364 |
| 241 | 3300025921 | Ga0207652_10044915 | Ga0207652_100449153 | 364 |
| 242 | 3300025922 | Ga0207646_10037783 | Ga0207646_100377832 | 364 |
| 243 | 3300037853 | Ga0436364_1479970 | Ga0436364_1479970_7111_8268 | 364 |
| 244 | 3300005327 | Ga0070658_10094969 | Ga0070658_100949692 | 365 |
| 245 | 3300006847 | Ga0075431_100001858 | Ga0075431_10000185821 | 365 |
| 246 | 3300013307 | Ga0157372_10013388 | Ga0157372_100133886 | 365 |
| 247 | 3300037471 | Ga0395905_0208404 | Ga0395905_0208404_80_1216 | 365 |
| 248 | 3300005530 | Ga0070679_100051831 | Ga0070679_1000518313 | 366 |
| 249 | 3300031548 | Ga0307408_100203228 | Ga0307408_1002032281 | 366 |
| 250 | 3300031824 | Ga0307413_10000979 | Ga0307413_100009793 | 366 |
| 251 | 3300032004 | Ga0307414_10053615 | Ga0307414_100536152 | 366 |
| 252 | 3300046476 | Ga0495662_0014349 | Ga0495662_0014349_2398_3507 | 366 |
| 253 | 3300046517 | Ga0495630_0303371 | Ga0495630_0303371_14_1123 | 366 |
| 254 | 3300046529 | Ga0495652_0082458 | Ga0495652_0082458_1150_2259 | 366 |
| 255 | 3300046675 | Ga0495657_0104373 | Ga0495657_0104373_654_1763 | 366 |
| 256 | 3300046679 | Ga0495623_0063419 | Ga0495623_0063419_475_1584 | 366 |
| 257 | 3300046689 | Ga0495613_0181044 | Ga0495613_0181044_223_1332 | 366 |
| 258 | 3300047317 | Ga0495604_0118819 | Ga0495604_0118819_364_1473 | 366 |
| 259 | 3300047322 | Ga0495680_0038903 | Ga0495680_0038903_420_1529 | 366 |
| 260 | 3300049581 | Ga0501047_0033899 | Ga0501047_0033899_670_1770 | 366 |
| 261 | 3300049581 | Ga0501047_0149507 | Ga0501047_0149507_305_1414 | 366 |
| 262 | 3300005327 | Ga0070658_10023193 | Ga0070658_100231932 | 367 |
| 263 | 3300005616 | Ga0068852_100122000 | Ga0068852_1001220002 | 367 |
| 264 | 3300013102 | Ga0157371_10093594 | Ga0157371_100935942 | 367 |
| 265 | 3300013105 | Ga0157369_10018432 | Ga0157369_100184325 | 367 |
| 266 | 3300005347 | Ga0070668_100011038 | Ga0070668_1000110384 | 368 |
| 267 | 3300009553 | Ga0105249_10000465 | Ga0105249_100004659 | 368 |
| 268 | 3300014969 | Ga0157376_10153555 | Ga0157376_101535552 | 368 |
| 269 | 3300005327 | Ga0070658_10005059 | Ga0070658_100050595 | 369 |
| 270 | 3300005339 | Ga0070660_100044293 | Ga0070660_1000442931 | 369 |
| 271 | 3300005366 | Ga0070659_100006603 | Ga0070659_1000066034 | 369 |
| 272 | 3300005435 | Ga0070714_100006639 | Ga0070714_1000066396 | 369 |
| 273 | 3300005539 | Ga0068853_100208889 | Ga0068853_1002088891 | 369 |
| 274 | 3300005563 | Ga0068855_100111539 | Ga0068855_1001115393 | 369 |
| 275 | 3300013102 | Ga0157371_10026474 | Ga0157371_100264743 | 369 |
| 276 | 3300013105 | Ga0157369_10092053 | Ga0157369_100920532 | 369 |
| 277 | 3300013307 | Ga0157372_10031670 | Ga0157372_100316702 | 369 |
| 278 | 3300025909 | Ga0207705_10007100 | Ga0207705_100071004 | 369 |
| 279 | 3300025919 | Ga0207657_10025921 | Ga0207657_100259214 | 369 |
| 280 | 3300025929 | Ga0207664_10121650 | Ga0207664_101216502 | 369 |
| 281 | 3300025932 | Ga0207690_10068331 | Ga0207690_100683312 | 369 |
| 282 | 3300026041 | Ga0207639_10068189 | Ga0207639_100681891 | 369 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d1i-assembly1.cif.gz_B-2 | crystal structure of acinetobacter baumannii murg | 0.8483 | 4 | 361 |
| 7d1i-assembly1.cif.gz_B-2 | crystal structure of acinetobacter baumannii murg | 0.8388 | 4 | 361 |
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.8363 | 4 | 361 |
| 7d1i-assembly1.cif.gz_C-2 | crystal structure of acinetobacter baumannii murg | 0.8294 | 4 | 361 |
| 1nlm-assembly1.cif.gz_B | crystal structure of murg:glcnac complex | 0.8289 | 4 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L509_198_322_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9229 | 225 | 344 | 3.40.50.2000 |
| af_Q2FYL5_179_337_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8958 | 193 | 344 | 3.40.50.2000 |
| af_A0A0N7KD23_75_238_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8864 | 4 | 169 | 3.40.50.2000 |
| af_K7L509_198_322_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8803 | 225 | 344 | 3.40.50.2000 |
| af_K7KRG7_210_378_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8719 | 192 | 347 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1BM71-F1-model_v4 | Glycosyltransferase | 0.9766 | 93 | 369 |
GO:0005975
GO:0016758 GO:0030259 GO:1901137 |
| AF-A0A7Y5R156-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9744 | 4 | 329 |
GO:0005886
GO:0005975 GO:0008360 GO:0009252 GO:0030259 GO:0050511 GO:0051301 GO:0071555 |
| AF-X1T1U9-F1-model_v4 | Glycosyl transferase family 28 C-terminal domain-containing protein | 0.9704 | 247 | 366 |
GO:0016758
|
| AF-A0A7Y5R156-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9685 | 4 | 329 |
GO:0005886
GO:0005975 GO:0008360 GO:0009252 GO:0030259 GO:0050511 GO:0051301 GO:0071555 |
| AF-A0A7W1PFU6-F1-model_v4 | Glycosyl transferase family 28 C-terminal domain-containing protein | 0.9678 | 196 | 368 |
GO:0016758
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar