F384952

General Info

Members Datasets Scaffolds Average Seq Length
282 180 277 339

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10117223|Ga0163161_101172232
Length 389
Sequence MHSGPRLRNGPFTGTILRQRGPTLAPTCRGCGAIAELQEQRNAPPMFFLWPDFLWLLPGLLLLPAAYVWLLRRRSRTALRYSGLGVARAAAGYAWRRHLPPALFLLACSGLLIAAARPVARVPLPWARSSIMLAIDVSLSMRVTDVKPSRIVAAQDAAKSFLRELPKNIEVGLVTFAGSSQVAQRATLDRDPLVASIDGFQMQMGTAVGNAIVLCLAELFPEQGIDLGDMTFGSMRLGRSLDEKAKAPPKQITPVAPGSYDSAAIILLSDGRRTTGVDTLEAAKMAADRGVRIYVVGLGTVDGEAATPDGMAIYMKLDEPTLREVARMTGGEYHHAGTAEMLRSVYQNLGSRLQVQTRETEVTGVLALISALIATAAAALSLLWFGRIA

Samples

Sample ID Description Type Environment
1 2842733646 Variovorax sp. R-72446 Isolate Unclassified
2 2842747753 Variovorax sp. R-72060 Isolate Unclassified
3 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
4 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
132 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
176 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
180 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.77
Nodule 0
Rhizoplane 4.26
Rhizosphere 78.37
Stem 0
Stem Tuber 0
Unclassified 4.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10091531 3300003322 Bacteria 2062
2 Ga0055534_1000598 3300003784 Bacteria 18722
3 Ga0055540_1000654 3300003792 Bacteria 24325
4 Ga0055531_10000353 3300003794 Bacteria 44922
5 Ga0070658_10387324 3300005327 Bacteria 1200
6 Ga0070676_10188182 3300005328 Bacteria 1346
7 Ga0070670_100000443 3300005331 Bacteria 33742
8 Ga0070670_100029312 3300005331 Bacteria 4737
9 Ga0070677_10037915 3300005333 Bacteria 1883
10 Ga0068869_100104800 3300005334 Bacteria 2144
11 Ga0070680_100014443 3300005336 Bacteria 6174
12 Ga0070660_100011925 3300005339 Bacteria 6200
13 Ga0070661_100112096 3300005344 Bacteria 2038
14 Ga0070661_100127085 3300005344 Bacteria 1913
15 Ga0070669_100008868 3300005353 Bacteria 7176
16 Ga0070669_100064458 3300005353 Bacteria 2698
17 Ga0070675_100007764 3300005354 Bacteria 8306
18 Ga0070675_100093173 3300005354 Bacteria 2526
19 Ga0070675_100179816 3300005354 Bacteria 1828
20 Ga0070671_100002073 3300005355 Bacteria 15450
21 Ga0070671_100007253 3300005355 Bacteria 8858
22 Ga0070671_100056272 3300005355 Bacteria 3272
23 Ga0070674_100005512 3300005356 Bacteria 7314
24 Ga0070674_100011536 3300005356 Bacteria 5385
25 Ga0070673_100009651 3300005364 Bacteria 6491
26 Ga0070673_100026155 3300005364 Bacteria 4307
27 Ga0070667_100103190 3300005367 Bacteria 2465
28 Ga0070667_100262758 3300005367 Bacteria 1546
29 Ga0070667_100291758 3300005367 Bacteria 1467
30 Ga0070663_100212584 3300005455 Bacteria 1515
31 Ga0070678_100027805 3300005456 Bacteria 3846
32 Ga0070678_100033990 3300005456 Bacteria 3546
33 Ga0070678_100044234 3300005456 Bacteria 3178
34 Ga0070678_100052624 3300005456 Bacteria 2958
35 Ga0070678_100176681 3300005456 Bacteria 1744
36 Ga0070662_100146576 3300005457 Bacteria 1834
37 Ga0068867_100003256 3300005459 Bacteria 11440
38 Ga0068867_100054638 3300005459 Bacteria 2950
39 Ga0068867_100133085 3300005459 Bacteria 1935
40 Ga0070679_100016576 3300005530 Bacteria 7113
41 Ga0068853_100238467 3300005539 Bacteria 1666
42 Ga0070672_100000488 3300005543 Bacteria 23080
43 Ga0070672_100033736 3300005543 Bacteria 3879
44 Ga0070672_100051475 3300005543 Bacteria 3212
45 Ga0070672_100092023 3300005543 Bacteria 2448
46 Ga0070672_100321783 3300005543 Unclassified 1315
47 Ga0070665_100118784 3300005548 Bacteria 2646
48 Ga0070665_100124222 3300005548 Bacteria 2583
49 Ga0070665_100407402 3300005548 Bacteria 1368
50 Ga0068855_100322091 3300005563 Bacteria 1708
51 Ga0070664_100054611 3300005564 Bacteria 3389
52 Ga0068854_100058959 3300005578 Bacteria 2773
53 Ga0068854_100260833 3300005578 Bacteria 1387
54 Ga0068854_100306007 3300005578 Bacteria 1287
55 Ga0068856_100209147 3300005614 Bacteria 1966
56 Ga0068864_100009444 3300005618 Bacteria 8049
57 Ga0068864_100022410 3300005618 Bacteria 5297
58 Ga0068861_100039081 3300005719 Bacteria 3539
59 Ga0068863_100027500 3300005841 Bacteria 5426
60 Ga0068863_100198420 3300005841 Bacteria 1929
61 Ga0068860_100001567 3300005843 Bacteria 24631
62 Ga0068860_100048665 3300005843 Bacteria 4040
63 Ga0068862_100009123 3300005844 Bacteria 8211
64 Ga0068862_100019118 3300005844 Bacteria 5712
65 Ga0075365_10006299 3300006038 Bacteria 6514
66 Ga0075365_10068792 3300006038 Bacteria 2379
67 Ga0075362_10004731 3300006177 Bacteria 4916
68 Ga0075362_10074790 3300006177 Bacteria 1553
69 Ga0075366_10001377 3300006195 Bacteria 12170
70 Ga0075366_10008223 3300006195 Bacteria 5789
71 Ga0075366_10034943 3300006195 Bacteria 2963
72 Ga0075366_10063613 3300006195 Bacteria 2193
73 Ga0097621_100009597 3300006237 Bacteria 7033
74 Ga0075370_10000470 3300006353 Bacteria 15098
75 Ga0068871_100018754 3300006358 Bacteria 5269
76 Ga0068871_100054766 3300006358 Bacteria 3237
77 Ga0068871_100168796 3300006358 Bacteria 1874
78 Ga0068865_100020129 3300006881 Bacteria 4327
79 Ga0105240_10026103 3300009093 Bacteria 7669
80 Ga0105245_10453736 3300009098 Bacteria 1291
81 Ga0105243_10015625 3300009148 Bacteria 5739
82 Ga0105243_10074983 3300009148 Bacteria 2745
83 Ga0105242_10089971 3300009176 Bacteria 2581
84 Ga0105248_10026399 3300009177 Bacteria 6460
85 Ga0105248_10057378 3300009177 Bacteria 4370
86 Ga0105248_10094156 3300009177 Bacteria 3373
87 Ga0105237_10335759 3300009545 Bacteria 1515
88 Ga0105238_10027423 3300009551 Bacteria 5804
89 Ga0105249_10102724 3300009553 Bacteria 2691
90 Ga0105249_10338248 3300009553 Bacteria 1521
91 Ga0157370_10092062 3300013104 Bacteria 2846
92 Ga0157369_10493283 3300013105 Bacteria 1267
93 Ga0157378_10026364 3300013297 Bacteria 5123
94 Ga0163162_10004718 3300013306 Bacteria 13146
95 Ga0157372_10550516 3300013307 Bacteria 1345
96 Ga0157375_10007295 3300013308 Bacteria 9676
97 Ga0157375_10018678 3300013308 Bacteria 6292
98 Ga0157375_10094164 3300013308 Bacteria 3063
99 Ga0163163_10044153 3300014325 Bacteria 4372
100 Ga0157380_10064294 3300014326 Bacteria 2944
101 Ga0157380_10098544 3300014326 Bacteria 2429
102 Ga0182008_10024069 3300014497 Bacteria 3102
103 Ga0157379_10317985 3300014968 Bacteria 1421
104 Ga0157376_10030753 3300014969 Bacteria 4291
105 Ga0157376_10082005 3300014969 Bacteria 2770
106 Ga0182007_10002883 3300015262 Bacteria 8360
107 Ga0183362_10002 3300015683 Bacteria 1432711
108 Ga0163161_10021375 3300017792 Bacteria 4548
109 Ga0163161_10047999 3300017792 Bacteria 3083
110 Ga0163161_10117223 3300017792 Bacteria 1997
111 Ga0209673_1021919 3300025273 Bacteria 2220
112 Ga0209130_1004093 3300025284 Bacteria 5746
113 Ga0209675_1000522 3300025291 Bacteria 28174
114 Ga0209025_1030142 3300025294 Bacteria 2604
115 Ga0209051_1000552 3300025303 Bacteria 45581
116 Ga0209051_1033403 3300025303 Bacteria 1946
117 Ga0209257_1000022 3300025304 Bacteria 765258
118 Ga0207697_10007024 3300025315 Bacteria 5042
119 Ga0207656_10035129 3300025321 Bacteria 2097
120 Ga0207682_10002237 3300025893 Bacteria 8736
121 Ga0207645_10005459 3300025907 Bacteria 9203
122 Ga0207645_10091270 3300025907 Bacteria 1959
123 Ga0207695_10048524 3300025913 Bacteria 4483
124 Ga0207657_10056727 3300025919 Bacteria 3378
125 Ga0207652_10026281 3300025921 Bacteria 4846
126 Ga0207652_10187980 3300025921 Bacteria 1857
127 Ga0207652_10484271 3300025921 Bacteria 1114
128 Ga0207681_10004346 3300025923 Bacteria 8744
129 Ga0207681_10053170 3300025923 Bacteria 2749
130 Ga0207681_10174603 3300025923 Bacteria 1631
131 Ga0207694_10083352 3300025924 Bacteria 2514
132 Ga0207650_10000254 3300025925 Bacteria 58014
133 Ga0207650_10002563 3300025925 Bacteria 12589
134 Ga0207650_10041595 3300025925 Bacteria 3369
135 Ga0207659_10002771 3300025926 Bacteria 10453
136 Ga0207659_10057104 3300025926 Bacteria 2797
137 Ga0207687_10011317 3300025927 Bacteria 5832
138 Ga0207644_10012071 3300025931 Bacteria 5729
139 Ga0207690_10064038 3300025932 Bacteria 2509
140 Ga0207686_10007697 3300025934 Bacteria 5809
141 Ga0207709_10057829 3300025935 Bacteria 2407
142 Ga0207709_10179388 3300025935 Bacteria 1494
143 Ga0207669_10003856 3300025937 Bacteria 6536
144 Ga0207669_10066833 3300025937 Bacteria 2237
145 Ga0207669_10081207 3300025937 Bacteria 2076
146 Ga0207704_10018413 3300025938 Bacteria 3645
147 Ga0207704_10270480 3300025938 Bacteria 1286
148 Ga0207691_10000049 3300025940 Bacteria 94813
149 Ga0207691_10034337 3300025940 Bacteria 4717
150 Ga0207691_10081317 3300025940 Bacteria 2912
151 Ga0207691_10085435 3300025940 Bacteria 2832
152 Ga0207691_10109622 3300025940 Bacteria 2456
153 Ga0207711_10002899 3300025941 Bacteria 15024
154 Ga0207711_10030368 3300025941 Bacteria 4558
155 Ga0207689_10304957 3300025942 Unclassified 1320
156 Ga0207679_10173444 3300025945 Bacteria 1778
157 Ga0207651_10004550 3300025960 Bacteria 7012
158 Ga0207640_10035386 3300025981 Bacteria 3125
159 Ga0207658_10212721 3300025986 Bacteria 1621
160 Ga0207677_10161904 3300026023 Bacteria 1739
161 Ga0207678_10336109 3300026067 Bacteria 1301
162 Ga0207708_10020383 3300026075 Bacteria 5001
163 Ga0207708_10142594 3300026075 Bacteria 1881
164 Ga0207641_10019319 3300026088 Bacteria 5592
165 Ga0207648_10000701 3300026089 Bacteria 37529
166 Ga0207648_10005525 3300026089 Bacteria 12740
167 Ga0207648_10052922 3300026089 Bacteria 3549
168 Ga0207648_10058069 3300026089 Bacteria 3375
169 Ga0207648_10216920 3300026089 Bacteria 1700
170 Ga0207676_10050738 3300026095 Bacteria 3236
171 Ga0207676_10084900 3300026095 Bacteria 2582
172 Ga0207676_10088502 3300026095 Bacteria 2535
173 Ga0207675_100468779 3300026118 Bacteria 1250
174 Ga0207683_10000610 3300026121 Bacteria 32987
175 Ga0207683_10008347 3300026121 Bacteria 8860
176 Ga0207683_10010565 3300026121 Bacteria 7877
177 Ga0207683_10029188 3300026121 Bacteria 4774
178 Ga0207683_10079569 3300026121 Bacteria 2906
179 Ga0207698_10152881 3300026142 Bacteria 2006
180 Ga0207698_10288780 3300026142 Bacteria 1521
181 Ga0207698_10291185 3300026142 Bacteria 1515
182 Ga0268266_10018972 3300028379 Bacteria 5859
183 Ga0268266_10197573 3300028379 Bacteria 1839
184 Ga0268265_10027091 3300028380 Bacteria 4086
185 Ga0268265_10229225 3300028380 Bacteria 1631
186 Ga0268264_10007434 3300028381 Bacteria 9148
187 Ga0268264_10036590 3300028381 Bacteria 4045
188 Ga0307515_10000030 3300028794 Bacteria 364482
189 Ga0307515_10000618 3300028794 Bacteria 83065
190 Ga0307515_10043798 3300028794 Bacteria 6943
191 Ga0265327_10002023 3300031251 Bacteria 22864
192 Ga0307513_10000895 3300031456 Bacteria 43051
193 Ga0307408_100131071 3300031548 Bacteria 1956
194 Ga0307407_10052740 3300031903 Bacteria 2337
195 Ga0307412_10034372 3300031911 Bacteria 3231
196 Ga0307412_10044836 3300031911 Bacteria 2887
197 Ga0307416_100008016 3300032002 Bacteria 6767
198 Ga0307411_10132646 3300032005 Bacteria 1823
199 Ga0307415_100006219 3300032126 Bacteria 6416
200 Ga0307510_10000462 3300033180 Bacteria 39513
201 Ga0373947_0112412 3300035725 Bacteria 1723
202 Ga0395905_0221495 3300037471 Bacteria 1770
203 Ga0439436_0001162 3300041404 Bacteria 7476
204 Ga0439436_0012771 3300041404 Bacteria 2546
205 Ga0439447_032414 3300041407 Bacteria 1306
206 Ga0439466_0030705 3300041411 Bacteria 1841
207 Ga0439465_0000026 3300041413 Bacteria 29635
208 Ga0451793_1776262 3300041452 Bacteria 1475
209 Ga0439431_0000034 3300041997 Bacteria 20591
210 Ga0439433_0000067 3300041999 Bacteria 13181
211 Ga0439441_013665 3300042001 Bacteria 1413
212 Ga0439442_003859 3300042002 Bacteria 2970
213 Ga0439445_0000146 3300042004 Bacteria 12454
214 Ga0439432_000206 3300042006 Bacteria 20983
215 Ga0439432_015863 3300042006 Bacteria 2537
216 Ga0439449_0000276 3300042007 Bacteria 18583
217 Ga0439449_0026025 3300042007 Bacteria 2184
218 Ga0439449_0030443 3300042007 Bacteria 2011
219 Ga0439452_000641 3300042010 Bacteria 17592
220 Ga0439462_0011133 3300042015 Bacteria 2286
221 Ga0450906_008158 3300042145 Bacteria 2037
222 Ga0450909_002146 3300042185 Bacteria 2786
223 Ga0439434_0000300 3300042435 Bacteria 14185
224 Ga0451577_0138062 3300042876 Bacteria 2190
225 Ga0451577_0210149 3300042876 Bacteria 1758
226 Ga0453684_0295350 3300044712 Bacteria 1843
227 Ga0453684_0633744 3300044712 Bacteria 1168
228 Ga0451576_0001803 3300045051 Bacteria 35010
229 Ga0451576_0160392 3300045051 Bacteria 2347
230 Ga0495629_0302985 3300046459 Bacteria 1094
231 Ga0495639_0000388 3300046475 Bacteria 20901
232 Ga0495628_0112621 3300046516 Bacteria 2092
233 Ga0495643_0103388 3300046522 Bacteria 1457
234 Ga0495621_0021855 3300046539 Bacteria 2114
235 Ga0495645_0069349 3300046543 Bacteria 2545
236 Ga0495656_0000355 3300046615 Bacteria 15399
237 Ga0495656_0013456 3300046615 Bacteria 3046
238 Ga0495668_0014858 3300046616 Bacteria 4557
239 Ga0495658_0004387 3300046683 Bacteria 6946
240 Ga0495658_0167209 3300046683 Bacteria 1359
241 Ga0495600_0137572 3300046809 Bacteria 1586
242 Ga0495674_0132126 3300047319 Bacteria 2103
243 Ga0495684_0014465 3300047471 Bacteria 6072
244 Ga0495614_0078207 3300048089 Bacteria 1431
245 Ga0496100_0015853 3300048903 Bacteria 4411
246 Ga0496101_0012040 3300048904 Bacteria 5762
247 Ga0496102_0002273 3300048905 Bacteria 16433
248 Ga0496104_0001239 3300048907 Bacteria 21977
249 Ga0496105_0008954 3300048908 Bacteria 7808
250 Ga0496105_0257323 3300048908 Bacteria 1413
251 Ga0496108_0158487 3300048911 Bacteria 1955
252 Ga0496111_0039748 3300048914 Bacteria 3374
253 Ga0496111_0045740 3300048914 Bacteria 3150
254 Ga0496113_0018705 3300048916 Bacteria 4830
255 Ga0496114_0193177 3300048917 Bacteria 1781
256 Ga0496117_0086631 3300048920 Bacteria 2034
257 Ga0496122_0000383 3300048925 Bacteria 94797
258 Ga0496123_0000249 3300048926 Bacteria 108969
259 Ga0496126_0052400 3300048929 Bacteria 3709
260 nmdc:mga03683_24847_c1 3300050489 Bacteria 2347
261 nmdc:mga03683_26345_c1 3300050489 Bacteria 2293
262 nmdc:mga0yw44_88853_c1 3300050492 Bacteria 1949
263 nmdc:mga0k408_15972_c1 3300050493 Bacteria 4158
264 nmdc:mga0k408_22372_c1 3300050493 Bacteria 3559
265 nmdc:mga0k408_47370_c1 3300050493 Bacteria 2485
266 nmdc:mga0k408_58405_c1 3300050493 Bacteria 2240
267 nmdc:mga07m45_1244_c1 3300050496 Bacteria 11560
268 nmdc:mga07m45_27161_c1 3300050496 Bacteria 3151
269 nmdc:mga07m45_76007_c1 3300050496 Bacteria 1915
270 nmdc:mga09592_225322_c1 3300050508 Bacteria 1624
271 Ga0500608_086671 3300053122 Bacteria 1470
272 Ga0500655_016589 3300053133 Bacteria 1358
273 Ga0500559_0000069 3300053136 Bacteria 82288
274 Ga0500559_0001338 3300053136 Bacteria 14166
275 Ga0500559_0013980 3300053136 Bacteria 3392
276 Ga0500622_0001635 3300053156 Bacteria 17534
277 Ga0500587_000560 3300053739 Bacteria 4591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100468779 Ga0207675_1004687792 300
2 3300005564 Ga0070664_100054611 Ga0070664_1000546111 311
3 3300025932 Ga0207690_10064038 Ga0207690_100640381 311
4 3300025945 Ga0207679_10173444 Ga0207679_101734442 311
5 3300045051 Ga0451576_0160392 Ga0451576_0160392_364_1401 311
6 iso_pu_bacteria 2870721527 2870725455 314
7 iso_pu_bacteria 8047710418 8047718755 315
8 3300006038 Ga0075365_10006299 Ga0075365_100062993 316
9 3300006177 Ga0075362_10004731 Ga0075362_100047312 316
10 3300014497 Ga0182008_10024069 Ga0182008_100240692 316
11 3300050489 nmdc:mga03683_26345_c1 nmdc:mga03683_26345_c1_943_1983 316
12 3300005336 Ga0070680_100014443 Ga0070680_1000144436 317
13 3300005530 Ga0070679_100016576 Ga0070679_1000165764 317
14 3300044712 Ga0453684_0633744 Ga0453684_0633744_133_1152 321
15 3300003784 Ga0055534_1000598 Ga0055534_10005988 322
16 3300005333 Ga0070677_10037915 Ga0070677_100379153 322
17 3300025284 Ga0209130_1004093 Ga0209130_10040936 322
18 3300025291 Ga0209675_1000522 Ga0209675_100052230 322
19 3300025294 Ga0209025_1030142 Ga0209025_10301422 322
20 3300025303 Ga0209051_1033403 Ga0209051_10334032 322
21 3300025921 Ga0207652_10026281 Ga0207652_100262814 322
22 3300048920 Ga0496117_0086631 Ga0496117_0086631_260_1303 322
23 3300048925 Ga0496122_0000383 Ga0496122_0000383_54744_55787 322
24 3300048926 Ga0496123_0000249 Ga0496123_0000249_38925_39968 322
25 3300005331 Ga0070670_100029312 Ga0070670_1000293126 323
26 3300005354 Ga0070675_100093173 Ga0070675_1000931733 323
27 3300005367 Ga0070667_100291758 Ga0070667_1002917581 323
28 3300005543 Ga0070672_100092023 Ga0070672_1000920232 323
29 3300005841 Ga0068863_100198420 Ga0068863_1001984201 323
30 3300014325 Ga0163163_10044153 Ga0163163_100441532 323
31 3300025925 Ga0207650_10000254 Ga0207650_1000025424 323
32 3300025926 Ga0207659_10057104 Ga0207659_100571042 323
33 3300028794 Ga0307515_10000030 Ga0307515_10000030219 323
34 3300006195 Ga0075366_10008223 Ga0075366_100082233 324
35 3300050493 nmdc:mga0k408_15972_c1 nmdc:mga0k408_15972_c1_1712_2728 324
36 3300050496 nmdc:mga07m45_27161_c1 nmdc:mga07m45_27161_c1_81_1097 324
37 3300005578 Ga0068854_100306007 Ga0068854_1003060071 325
38 3300005614 Ga0068856_100209147 Ga0068856_1002091472 325
39 3300048089 Ga0495614_0078207 Ga0495614_0078207_342_1382 325
40 3300031548 Ga0307408_100131071 Ga0307408_1001310712 326
41 3300046459 Ga0495629_0302985 Ga0495629_0302985_69_1070 326
42 3300046683 Ga0495658_0167209 Ga0495658_0167209_19_1020 326
43 3300031456 Ga0307513_10000895 Ga0307513_1000089528 327
44 3300031911 Ga0307412_10044836 Ga0307412_100448362 327
45 3300050493 nmdc:mga0k408_22372_c1 nmdc:mga0k408_22372_c1_2167_3285 327
46 3300013307 Ga0157372_10550516 Ga0157372_105505161 328
47 3300035725 Ga0373947_0112412 Ga0373947_0112412_50_1090 328
48 3300005844 Ga0068862_100019118 Ga0068862_1000191184 329
49 3300006195 Ga0075366_10001377 Ga0075366_1000137711 329
50 3300006353 Ga0075370_10000470 Ga0075370_100004704 329
51 3300013104 Ga0157370_10092062 Ga0157370_100920623 329
52 3300025923 Ga0207681_10174603 Ga0207681_101746031 329
53 3300028380 Ga0268265_10229225 Ga0268265_102292252 329
54 3300028794 Ga0307515_10043798 Ga0307515_100437988 329
55 3300005327 Ga0070658_10387324 Ga0070658_103873241 330
56 3300028379 Ga0268266_10018972 Ga0268266_100189722 330
57 3300031911 Ga0307412_10034372 Ga0307412_100343722 330
58 3300037471 Ga0395905_0221495 Ga0395905_0221495_472_1506 330
59 3300050496 nmdc:mga07m45_1244_c1 nmdc:mga07m45_1244_c1_5557_6591 330
60 3300005334 Ga0068869_100104800 Ga0068869_1001048001 331
61 3300005355 Ga0070671_100056272 Ga0070671_1000562722 331
62 3300005456 Ga0070678_100044234 Ga0070678_1000442342 331
63 3300005543 Ga0070672_100051475 Ga0070672_1000514752 331
64 3300009177 Ga0105248_10094156 Ga0105248_100941562 331
65 3300014326 Ga0157380_10098544 Ga0157380_100985442 331
66 3300014968 Ga0157379_10317985 Ga0157379_103179852 331
67 3300015262 Ga0182007_10002883 Ga0182007_100028838 331
68 3300017792 Ga0163161_10047999 Ga0163161_100479994 331
69 3300025921 Ga0207652_10484271 Ga0207652_104842711 331
70 3300025938 Ga0207704_10270480 Ga0207704_102704801 331
71 3300025940 Ga0207691_10081317 Ga0207691_100813172 331
72 3300025986 Ga0207658_10212721 Ga0207658_102127212 331
73 3300026142 Ga0207698_10152881 Ga0207698_101528813 331
74 3300031903 Ga0307407_10052740 Ga0307407_100527402 331
75 3300032005 Ga0307411_10132646 Ga0307411_101326462 331
76 3300046475 Ga0495639_0000388 Ga0495639_0000388_3067_4107 331
77 3300046543 Ga0495645_0069349 Ga0495645_0069349_754_1788 331
78 3300046683 Ga0495658_0004387 Ga0495658_0004387_643_1677 331
79 3300047471 Ga0495684_0014465 Ga0495684_0014465_689_1723 331
80 3300048903 Ga0496100_0015853 Ga0496100_0015853_2624_3664 331
81 3300048904 Ga0496101_0012040 Ga0496101_0012040_1252_2292 331
82 3300048905 Ga0496102_0002273 Ga0496102_0002273_14494_15534 331
83 3300048907 Ga0496104_0001239 Ga0496104_0001239_14397_15437 331
84 3300048908 Ga0496105_0008954 Ga0496105_0008954_6505_7545 331
85 3300048911 Ga0496108_0158487 Ga0496108_0158487_663_1703 331
86 3300048914 Ga0496111_0039748 Ga0496111_0039748_1905_2945 331
87 3300048916 Ga0496113_0018705 Ga0496113_0018705_543_1583 331
88 3300048917 Ga0496114_0193177 Ga0496114_0193177_469_1509 331
89 3300013105 Ga0157369_10493283 Ga0157369_104932832 332
90 3300053122 Ga0500608_086671 Ga0500608_086671_307_1410 332
91 3300053133 Ga0500655_016589 Ga0500655_016589_223_1221 332
92 3300053136 Ga0500559_0000069 Ga0500559_0000069_3087_4085 332
93 3300053136 Ga0500559_0013980 Ga0500559_0013980_1231_2334 332
94 3300053156 Ga0500622_0001635 Ga0500622_0001635_3226_4224 332
95 3300053739 Ga0500587_000560 Ga0500587_000560_2869_3867 332
96 3300005456 Ga0070678_100033990 Ga0070678_1000339902 333
97 3300005548 Ga0070665_100124222 Ga0070665_1001242223 333
98 3300025893 Ga0207682_10002237 Ga0207682_100022374 333
99 3300025940 Ga0207691_10085435 Ga0207691_100854353 333
100 3300026089 Ga0207648_10216920 Ga0207648_102169202 333
101 3300026121 Ga0207683_10010565 Ga0207683_100105654 333
102 3300042001 Ga0439441_013665 Ga0439441_013665_165_1178 333
103 3300046615 Ga0495656_0013456 Ga0495656_0013456_818_1858 333
104 3300005353 Ga0070669_100008868 Ga0070669_1000088685 334
105 3300025923 Ga0207681_10004346 Ga0207681_100043469 334
106 3300048929 Ga0496126_0052400 Ga0496126_0052400_424_1470 334
107 3300005339 Ga0070660_100011925 Ga0070660_1000119258 335
108 3300005563 Ga0068855_100322091 Ga0068855_1003220912 335
109 3300009093 Ga0105240_10026103 Ga0105240_100261032 335
110 3300009551 Ga0105238_10027423 Ga0105238_100274236 335
111 3300025913 Ga0207695_10048524 Ga0207695_100485242 335
112 3300025919 Ga0207657_10056727 Ga0207657_100567273 335
113 3300025924 Ga0207694_10083352 Ga0207694_100833522 335
114 3300046516 Ga0495628_0112621 Ga0495628_0112621_239_1273 335
115 3300047319 Ga0495674_0132126 Ga0495674_0132126_821_1855 335
116 3300005355 Ga0070671_100007253 Ga0070671_1000072539 336
117 3300005456 Ga0070678_100027805 Ga0070678_1000278054 336
118 3300005618 Ga0068864_100009444 Ga0068864_1000094447 336
119 3300006038 Ga0075365_10068792 Ga0075365_100687923 336
120 3300006237 Ga0097621_100009597 Ga0097621_1000095975 336
121 3300009177 Ga0105248_10026399 Ga0105248_100263997 336
122 3300015683 Ga0183362_10002 Ga0183362_10002352 336
123 3300025925 Ga0207650_10041595 Ga0207650_100415952 336
124 3300025941 Ga0207711_10002899 Ga0207711_100028995 336
125 3300026088 Ga0207641_10019319 Ga0207641_100193194 336
126 3300026095 Ga0207676_10084900 Ga0207676_100849003 336
127 3300026121 Ga0207683_10029188 Ga0207683_100291884 336
128 3300031251 Ga0265327_10002023 Ga0265327_1000202320 336
129 3300046809 Ga0495600_0137572 Ga0495600_0137572_113_1150 336
130 3300050489 nmdc:mga03683_24847_c1 nmdc:mga03683_24847_c1_434_1471 336
131 3300050492 nmdc:mga0yw44_88853_c1 nmdc:mga0yw44_88853_c1_406_1440 336
132 3300005457 Ga0070662_100146576 Ga0070662_1001465762 337
133 3300005578 Ga0068854_100260833 Ga0068854_1002608331 337
134 3300009148 Ga0105243_10015625 Ga0105243_100156253 337
135 3300025935 Ga0207709_10179388 Ga0207709_101793881 337
136 3300050493 nmdc:mga0k408_47370_c1 nmdc:mga0k408_47370_c1_47_1087 337
137 3300050496 nmdc:mga07m45_76007_c1 nmdc:mga07m45_76007_c1_518_1558 337
138 3300033180 Ga0307510_10000462 Ga0307510_100004622 338
139 3300005456 Ga0070678_100176681 Ga0070678_1001766811 339
140 3300025273 Ga0209673_1021919 Ga0209673_10219191 339
141 iso_pu_bacteria 2842733646 2842733720 339
142 iso_pu_bacteria 2842747753 2842749746 339
143 iso_pu_bacteria 2885192300 2885195671 339
144 3300003792 Ga0055540_1000654 Ga0055540_10006549 340
145 3300003794 Ga0055531_10000353 Ga0055531_1000035340 340
146 3300025303 Ga0209051_1000552 Ga0209051_10005528 340
147 3300025304 Ga0209257_1000022 Ga0209257_100002238 340
148 3300042876 Ga0451577_0210149 Ga0451577_0210149_408_1439 340
149 3300005356 Ga0070674_100011536 Ga0070674_1000115364 341
150 3300025937 Ga0207669_10066833 Ga0207669_100668332 341
151 3300005328 Ga0070676_10188182 Ga0070676_101881821 342
152 3300005331 Ga0070670_100000443 Ga0070670_10000044326 342
153 3300005344 Ga0070661_100112096 Ga0070661_1001120962 342
154 3300005344 Ga0070661_100127085 Ga0070661_1001270852 342
155 3300005353 Ga0070669_100064458 Ga0070669_1000644584 342
156 3300005354 Ga0070675_100007764 Ga0070675_1000077644 342
157 3300005354 Ga0070675_100179816 Ga0070675_1001798162 342
158 3300005355 Ga0070671_100002073 Ga0070671_1000020736 342
159 3300005356 Ga0070674_100005512 Ga0070674_1000055127 342
160 3300005364 Ga0070673_100009651 Ga0070673_1000096517 342
161 3300005364 Ga0070673_100026155 Ga0070673_1000261553 342
162 3300005367 Ga0070667_100103190 Ga0070667_1001031902 342
163 3300005367 Ga0070667_100262758 Ga0070667_1002627581 342
164 3300005455 Ga0070663_100212584 Ga0070663_1002125841 342
165 3300005456 Ga0070678_100052624 Ga0070678_1000526242 342
166 3300005459 Ga0068867_100003256 Ga0068867_1000032567 342
167 3300005459 Ga0068867_100054638 Ga0068867_1000546382 342
168 3300005459 Ga0068867_100133085 Ga0068867_1001330852 342
169 3300005543 Ga0070672_100000488 Ga0070672_1000004888 342
170 3300005543 Ga0070672_100321783 Ga0070672_1003217831 342
171 3300005548 Ga0070665_100407402 Ga0070665_1004074021 342
172 3300005578 Ga0068854_100058959 Ga0068854_1000589591 342
173 3300005618 Ga0068864_100022410 Ga0068864_1000224106 342
174 3300005719 Ga0068861_100039081 Ga0068861_1000390813 342
175 3300005841 Ga0068863_100027500 Ga0068863_1000275007 342
176 3300005843 Ga0068860_100001567 Ga0068860_10000156714 342
177 3300005843 Ga0068860_100048665 Ga0068860_1000486655 342
178 3300005844 Ga0068862_100009123 Ga0068862_1000091239 342
179 3300006177 Ga0075362_10074790 Ga0075362_100747903 342
180 3300006195 Ga0075366_10034943 Ga0075366_100349432 342
181 3300006195 Ga0075366_10063613 Ga0075366_100636133 342
182 3300006358 Ga0068871_100018754 Ga0068871_1000187543 342
183 3300006881 Ga0068865_100020129 Ga0068865_1000201293 342
184 3300009098 Ga0105245_10453736 Ga0105245_104537361 342
185 3300009148 Ga0105243_10074983 Ga0105243_100749834 342
186 3300009553 Ga0105249_10102724 Ga0105249_101027243 342
187 3300009553 Ga0105249_10338248 Ga0105249_103382482 342
188 3300013297 Ga0157378_10026364 Ga0157378_100263641 342
189 3300013306 Ga0163162_10004718 Ga0163162_1000471815 342
190 3300013308 Ga0157375_10007295 Ga0157375_100072958 342
191 3300013308 Ga0157375_10094164 Ga0157375_100941642 342
192 3300014326 Ga0157380_10064294 Ga0157380_100642942 342
193 3300014969 Ga0157376_10030753 Ga0157376_100307534 342
194 3300014969 Ga0157376_10082005 Ga0157376_100820053 342
195 3300017792 Ga0163161_10021375 Ga0163161_100213754 342
196 3300025315 Ga0207697_10007024 Ga0207697_100070246 342
197 3300025321 Ga0207656_10035129 Ga0207656_100351293 342
198 3300025907 Ga0207645_10005459 Ga0207645_100054596 342
199 3300025907 Ga0207645_10091270 Ga0207645_100912701 342
200 3300025923 Ga0207681_10053170 Ga0207681_100531701 342
201 3300025925 Ga0207650_10002563 Ga0207650_100025639 342
202 3300025926 Ga0207659_10002771 Ga0207659_100027718 342
203 3300025927 Ga0207687_10011317 Ga0207687_100113176 342
204 3300025931 Ga0207644_10012071 Ga0207644_100120712 342
205 3300025935 Ga0207709_10057829 Ga0207709_100578295 342
206 3300025937 Ga0207669_10003856 Ga0207669_100038566 342
207 3300025937 Ga0207669_10081207 Ga0207669_100812072 342
208 3300025938 Ga0207704_10018413 Ga0207704_100184133 342
209 3300025940 Ga0207691_10000049 Ga0207691_1000004958 342
210 3300025940 Ga0207691_10034337 Ga0207691_100343374 342
211 3300025940 Ga0207691_10109622 Ga0207691_101096221 342
212 3300025942 Ga0207689_10304957 Ga0207689_103049571 342
213 3300025960 Ga0207651_10004550 Ga0207651_100045507 342
214 3300025981 Ga0207640_10035386 Ga0207640_100353861 342
215 3300026023 Ga0207677_10161904 Ga0207677_101619042 342
216 3300026067 Ga0207678_10336109 Ga0207678_103361092 342
217 3300026075 Ga0207708_10020383 Ga0207708_100203834 342
218 3300026075 Ga0207708_10142594 Ga0207708_101425943 342
219 3300026089 Ga0207648_10000701 Ga0207648_1000070128 342
220 3300026089 Ga0207648_10005525 Ga0207648_1000552512 342
221 3300026089 Ga0207648_10052922 Ga0207648_100529223 342
222 3300026089 Ga0207648_10058069 Ga0207648_100580692 342
223 3300026095 Ga0207676_10050738 Ga0207676_100507383 342
224 3300026121 Ga0207683_10000610 Ga0207683_1000061010 342
225 3300026121 Ga0207683_10008347 Ga0207683_100083474 342
226 3300028380 Ga0268265_10027091 Ga0268265_100270912 342
227 3300028381 Ga0268264_10007434 Ga0268264_1000743410 342
228 3300028381 Ga0268264_10036590 Ga0268264_100365901 342
229 3300042876 Ga0451577_0138062 Ga0451577_0138062_213_1256 342
230 3300044712 Ga0453684_0295350 Ga0453684_0295350_618_1661 342
231 3300045051 Ga0451576_0001803 Ga0451576_0001803_11991_13034 342
232 3300046539 Ga0495621_0021855 Ga0495621_0021855_662_1696 342
233 3300046615 Ga0495656_0000355 Ga0495656_0000355_1706_2740 342
234 3300050493 nmdc:mga0k408_58405_c1 nmdc:mga0k408_58405_c1_1134_2171 342
235 3300005539 Ga0068853_100238467 Ga0068853_1002384671 343
236 3300005543 Ga0070672_100033736 Ga0070672_1000337362 343
237 3300005548 Ga0070665_100118784 Ga0070665_1001187842 343
238 3300006358 Ga0068871_100054766 Ga0068871_1000547661 343
239 3300006358 Ga0068871_100168796 Ga0068871_1001687962 343
240 3300009176 Ga0105242_10089971 Ga0105242_100899712 343
241 3300009177 Ga0105248_10057378 Ga0105248_100573783 343
242 3300009545 Ga0105237_10335759 Ga0105237_103357592 343
243 3300013308 Ga0157375_10018678 Ga0157375_100186786 343
244 3300017792 Ga0163161_10117223 Ga0163161_101172232 343
245 3300025934 Ga0207686_10007697 Ga0207686_100076976 343
246 3300025941 Ga0207711_10030368 Ga0207711_100303685 343
247 3300026095 Ga0207676_10088502 Ga0207676_100885021 343
248 3300026121 Ga0207683_10079569 Ga0207683_100795692 343
249 3300026142 Ga0207698_10288780 Ga0207698_102887801 343
250 3300026142 Ga0207698_10291185 Ga0207698_102911851 343
251 3300028379 Ga0268266_10197573 Ga0268266_101975732 343
252 3300028794 Ga0307515_10000618 Ga0307515_1000061870 343
253 3300032002 Ga0307416_100008016 Ga0307416_1000080163 343
254 3300032126 Ga0307415_100006219 Ga0307415_1000062193 343
255 3300041404 Ga0439436_0001162 Ga0439436_0001162_3131_4168 343
256 3300041404 Ga0439436_0012771 Ga0439436_0012771_539_1576 343
257 3300041407 Ga0439447_032414 Ga0439447_032414_183_1220 343
258 3300041411 Ga0439466_0030705 Ga0439466_0030705_757_1794 343
259 3300041413 Ga0439465_0000026 Ga0439465_0000026_11004_12041 343
260 3300041452 Ga0451793_1776262 Ga0451793_1776262_362_1399 343
261 3300041997 Ga0439431_0000034 Ga0439431_0000034_6723_7760 343
262 3300041999 Ga0439433_0000067 Ga0439433_0000067_7224_8261 343
263 3300042002 Ga0439442_003859 Ga0439442_003859_185_1222 343
264 3300042004 Ga0439445_0000146 Ga0439445_0000146_9422_10459 343
265 3300042006 Ga0439432_000206 Ga0439432_000206_8521_9558 343
266 3300042006 Ga0439432_015863 Ga0439432_015863_1037_2074 343
267 3300042007 Ga0439449_0000276 Ga0439449_0000276_9184_10221 343
268 3300042007 Ga0439449_0026025 Ga0439449_0026025_791_1828 343
269 3300042007 Ga0439449_0030443 Ga0439449_0030443_101_1138 343
270 3300042010 Ga0439452_000641 Ga0439452_000641_9284_10321 343
271 3300042015 Ga0439462_0011133 Ga0439462_0011133_718_1755 343
272 3300042145 Ga0450906_008158 Ga0450906_008158_442_1479 343
273 3300042185 Ga0450909_002146 Ga0450909_002146_1310_2347 343
274 3300042435 Ga0439434_0000300 Ga0439434_0000300_4493_5530 343
275 3300046522 Ga0495643_0103388 Ga0495643_0103388_288_1325 343
276 3300046616 Ga0495668_0014858 Ga0495668_0014858_630_1712 343
277 3300048908 Ga0496105_0257323 Ga0496105_0257323_38_1078 343
278 3300048914 Ga0496111_0045740 Ga0496111_0045740_665_1705 343
279 3300050508 nmdc:mga09592_225322_c1 nmdc:mga09592_225322_c1_98_1135 343
280 3300053136 Ga0500559_0001338 Ga0500559_0001338_9007_10044 343
281 3300025921 Ga0207652_10187980 Ga0207652_101879802 344
282 3300003322 rootL2_10091531 rootL2_100915313 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13519

VWA_2

von Willebrand factor type A domain

131

230

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fx5-assembly1.cif.gz_A von willebrand factor type a from catenulispora acidiphila 0.8113 85 312
5m32-assembly1.cif.gz_p human 26s proteasome in complex with oprozomib 0.811 109 181
3rag-assembly2.cif.gz_B crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 0.8087 88 179
5a8j-assembly1.cif.gz_A-2 crystal structure of the arnb paralog vwa2 from sulfolobus acidocaldarius 0.8072 84 305
3rag-assembly1.cif.gz_A crystal structure of uncharacterized protein aaci_0196 from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 0.8059 222 295
ID Description Score Start End Superfamily
af_Q66H58_3_138_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.9145 90 182 3.40.50.410
af_I1LHY4_78_263_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8461 87 308 3.40.50.410
af_Q8BG22_309_484_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8333 87 307 3.40.50.410
af_A0A0G2K7L7_66_197_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8296 78 172 3.40.50.410
af_A0A0P0XV48_261_417_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8239 89 236 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A257VFV4-F1-model_v4 Aerotolerance regulator N-terminal domain-containing protein 0.9197 82 176 GO:0016020
AF-A0A7W1NW65-F1-model_v4 VWA domain-containing protein 0.9176 88 312 GO:0016020
AF-A0A412HU76-F1-model_v4 deleted 0.917 88 184
AF-A0A538ABJ9-F1-model_v4 VWA domain-containing protein 0.9162 88 313 GO:0005886
AF-R9JRM9-F1-model_v4 VWFA domain-containing protein 0.916 87 309 GO:0016020

Feature Viewer

pLDDT pTM Quality
75.39 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map