F384890

General Info

Members Datasets Scaffolds Average Seq Length
282 179 564 102

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10115215|Ga0111539_101152152
Length 122
Sequence LAHLPGLLPAVMVSFRGDLAVGTSYPILTYWYYHVPNFVLAALMYTLLGRALLALIVGPDSGNYIWRFFCRITDPVVVAVSVVTPKAAAPVIVWLFGVVWLFWLRVGFLILFTMYGLVPRAS

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.38
Nodule 0
Rhizoplane 1.06
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10115215 3300009094 Bacteria 3152
2 MBSR1b_contig_659378 2162886012 Bacteria 936
3 ARcpr5oldR_c000619 3300000041 Bacteria 4293
4 ARSoilOldRDRAFT_c000172 3300000044 Bacteria 10835
5 ARCol0yngRDRAFT_1003560 3300000652 Bacteria 1138
6 JGI24737J22298_10023031 3300001990 Bacteria 1977
7 JGI24751J29686_10079866 3300002459 Bacteria 678
8 JGI25406J46586_10000893 3300003203 Bacteria 14023
9 JGI26128J50194_1012817 3300003347 Bacteria 526
10 JGI25407J50210_10094148 3300003373 Bacteria 741
11 JGI25404J52841_10115558 3300003659 Bacteria 565
12 JGI25405J52794_10006764 3300003911 Bacteria 2099
13 Ga0065712_10123305 3300005290 Bacteria 1640
14 Ga0065715_10103587 3300005293 Bacteria 3012
15 Ga0065707_10311238 3300005295 Bacteria 967
16 Ga0065707_10437218 3300005295 Unclassified 812
17 Ga0065707_10713793 3300005295 Bacteria 634
18 Ga0070690_100075414 3300005330 Bacteria 2198
19 Ga0070690_101426526 3300005330 Bacteria 558
20 Ga0070670_101364282 3300005331 Bacteria 650
21 Ga0068869_100408615 3300005334 Bacteria 1118
22 Ga0070680_100304439 3300005336 Bacteria 1352
23 Ga0070689_100469301 3300005340 Bacteria 1074
24 Ga0070687_100500766 3300005343 Bacteria 818
25 Ga0070692_10033493 3300005345 Bacteria 2589
26 Ga0070668_100907729 3300005347 Bacteria 788
27 Ga0070669_100702654 3300005353 Bacteria 854
28 Ga0070675_100030260 3300005354 Bacteria 4370
29 Ga0070675_100827940 3300005354 Bacteria 847
30 Ga0070671_100703587 3300005355 Bacteria 877
31 Ga0070659_100414329 3300005366 Bacteria 1139
32 Ga0070667_100248471 3300005367 Bacteria 1590
33 Ga0070701_10282565 3300005438 Bacteria 1014
34 Ga0070701_10340523 3300005438 Bacteria 934
35 Ga0070700_100173075 3300005441 Bacteria 1496
36 Ga0070700_100855993 3300005441 Bacteria 737
37 Ga0070708_100414632 3300005445 Bacteria 1270
38 Ga0070663_100074552 3300005455 Bacteria 2478
39 Ga0070662_101389189 3300005457 Bacteria 605
40 Ga0068867_101155918 3300005459 Bacteria 709
41 Ga0068853_100075501 3300005539 Bacteria 2942
42 Ga0070686_100107005 3300005544 Bacteria 1899
43 Ga0070686_101774376 3300005544 Bacteria 525
44 Ga0070695_101138348 3300005545 Bacteria 640
45 Ga0070696_100183414 3300005546 Bacteria 1554
46 Ga0070665_100323295 3300005548 Bacteria 1547
47 Ga0070665_100444987 3300005548 Bacteria 1305
48 Ga0068859_100021723 3300005617 Bacteria 6439
49 Ga0068859_100269502 3300005617 Bacteria 1795
50 Ga0068859_100685551 3300005617 Bacteria 1116
51 Ga0068864_100215609 3300005618 Bacteria 1769
52 Ga0068864_100754280 3300005618 Bacteria 954
53 Ga0068861_100196016 3300005719 Bacteria 1692
54 Ga0068861_101935092 3300005719 Bacteria 587
55 Ga0068863_101403611 3300005841 Bacteria 706
56 Ga0068858_100390878 3300005842 Unclassified 1335
57 Ga0068860_100292743 3300005843 Bacteria 1593
58 Ga0068860_102743357 3300005843 Unclassified 511
59 Ga0068862_100104829 3300005844 Bacteria 2478
60 Ga0068862_100464963 3300005844 Bacteria 1195
61 Ga0081455_10006018 3300005937 Bacteria 13144
62 Ga0081455_10009625 3300005937 Bacteria 9925
63 Ga0081455_10085895 3300005937 Bacteria 2564
64 Ga0081455_10368241 3300005937 Bacteria 1008
65 Ga0081538_10137967 3300005981 Bacteria 1131
66 Ga0081539_10001685 3300005985 Bacteria 35707
67 Ga0081539_10058082 3300005985 Bacteria 2137
68 Ga0075365_10123027 3300006038 Bacteria 1791
69 Ga0075365_10155897 3300006038 Bacteria 1589
70 Ga0075368_10002015 3300006042 Bacteria 6568
71 Ga0075368_10219263 3300006042 Bacteria 808
72 Ga0075363_100004793 3300006048 Bacteria 5965
73 Ga0075363_100104566 3300006048 Bacteria 1570
74 Ga0075363_100899598 3300006048 Bacteria 542
75 Ga0075364_10098453 3300006051 Bacteria 1945
76 Ga0075362_10022827 3300006177 Bacteria 2640
77 Ga0075362_10118655 3300006177 Bacteria 1250
78 Ga0075362_10196422 3300006177 Bacteria 981
79 Ga0075362_10427774 3300006177 Bacteria 670
80 Ga0075362_10465539 3300006177 Bacteria 643
81 Ga0075367_10002342 3300006178 Bacteria 8624
82 Ga0075367_10130376 3300006178 Bacteria 1554
83 Ga0075367_10294537 3300006178 Bacteria 1021
84 Ga0075366_10000683 3300006195 Bacteria 16043
85 Ga0075366_10056837 3300006195 Bacteria 2325
86 Ga0075366_10138895 3300006195 Bacteria 1468
87 Ga0075366_10214220 3300006195 Bacteria 1173
88 Ga0075370_10013697 3300006353 Bacteria 4316
89 Ga0075428_100074420 3300006844 Bacteria 3710
90 Ga0075428_100180463 3300006844 Bacteria 2285
91 Ga0075428_100357238 3300006844 Bacteria 1568
92 Ga0075428_100436984 3300006844 Bacteria 1402
93 Ga0075428_101650357 3300006844 Bacteria 669
94 Ga0075430_101177580 3300006846 Bacteria 631
95 Ga0075431_100087740 3300006847 Bacteria 3210
96 Ga0075433_10038256 3300006852 Bacteria 4142
97 Ga0075433_10420548 3300006852 Bacteria 1178
98 Ga0075429_101305135 3300006880 Bacteria 633
99 Ga0097620_100021722 3300006931 Bacteria 6439
100 Ga0097620_100269488 3300006931 Bacteria 1795
101 Ga0097620_100685640 3300006931 Bacteria 1116
102 Ga0111539_10331316 3300009094 Bacteria 1772
103 Ga0111539_10992773 3300009094 Bacteria 976
104 Ga0111539_11424365 3300009094 Bacteria 804
105 Ga0111539_11431710 3300009094 Bacteria 802
106 Ga0114129_10267023 3300009147 Bacteria 2291
107 Ga0114129_10286302 3300009147 Bacteria 2200
108 Ga0114129_11936486 3300009147 Bacteria 714
109 Ga0114129_13451374 3300009147 Bacteria 507
110 Ga0105243_11303808 3300009148 Bacteria 743
111 Ga0105243_11595822 3300009148 Bacteria 679
112 Ga0105242_10706606 3300009176 Bacteria 987
113 Ga0105248_11953350 3300009177 Bacteria 666
114 Ga0105237_10125936 3300009545 Bacteria 2556
115 Ga0105238_10527039 3300009551 Bacteria 1184
116 Ga0105249_10255863 3300009553 Bacteria 1738
117 Ga0105249_10458151 3300009553 Bacteria 1315
118 Ga0105249_10937684 3300009553 Bacteria 933
119 Ga0105249_11085936 3300009553 Bacteria 870
120 Ga0105239_10067078 3300010375 Bacteria 3941
121 Ga0105239_10963817 3300010375 Bacteria 980
122 Ga0105246_10634770 3300011119 Bacteria 928
123 Ga0157346_1025021 3300012480 Bacteria 547
124 Ga0157378_10230288 3300013297 Bacteria 1765
125 Ga0163162_10115818 3300013306 Bacteria 2781
126 Ga0163162_10411604 3300013306 Bacteria 1485
127 Ga0157375_11581405 3300013308 Bacteria 775
128 Ga0157380_10204868 3300014326 Unclassified 1753
129 Ga0157380_11308998 3300014326 Bacteria 772
130 Ga0157380_12966557 3300014326 Bacteria 540
131 Ga0157377_10292751 3300014745 Bacteria 1071
132 Ga0157379_11898110 3300014968 Bacteria 587
133 Ga0207697_10021745 3300025315 Bacteria 2628
134 Ga0207642_11124299 3300025899 Bacteria 508
135 Ga0207710_10098592 3300025900 Bacteria 1376
136 Ga0207647_10064360 3300025904 Bacteria 2229
137 Ga0207647_10792520 3300025904 Unclassified 510
138 Ga0207643_10038893 3300025908 Bacteria 2674
139 Ga0207643_10231935 3300025908 Bacteria 1132
140 Ga0207660_10298024 3300025917 Bacteria 1283
141 Ga0207660_10928097 3300025917 Bacteria 710
142 Ga0207662_10048986 3300025918 Bacteria 2505
143 Ga0207662_10121649 3300025918 Bacteria 1638
144 Ga0207662_10869665 3300025918 Bacteria 637
145 Ga0207657_11398537 3300025919 Bacteria 525
146 Ga0207681_10573701 3300025923 Bacteria 930
147 Ga0207681_11773414 3300025923 Bacteria 515
148 Ga0207694_10121736 3300025924 Bacteria 2084
149 Ga0207650_10285613 3300025925 Bacteria 1344
150 Ga0207650_11007049 3300025925 Bacteria 709
151 Ga0207650_11026834 3300025925 Bacteria 701
152 Ga0207659_10185277 3300025926 Bacteria 1652
153 Ga0207690_10929205 3300025932 Bacteria 722
154 Ga0207706_11728962 3300025933 Bacteria 503
155 Ga0207709_10646712 3300025935 Bacteria 841
156 Ga0207709_11683596 3300025935 Bacteria 527
157 Ga0207711_10437939 3300025941 Bacteria 1216
158 Ga0207689_10095995 3300025942 Bacteria 2435
159 Ga0207679_10679413 3300025945 Bacteria 933
160 Ga0207712_10501281 3300025961 Bacteria 1038
161 Ga0207712_10525564 3300025961 Bacteria 1015
162 Ga0207712_11668776 3300025961 Unclassified 571
163 Ga0207668_10313811 3300025972 Bacteria 1299
164 Ga0207668_11503375 3300025972 Bacteria 608
165 Ga0207658_11002061 3300025986 Bacteria 762
166 Ga0207703_11258303 3300026035 Bacteria 711
167 Ga0207639_10131074 3300026041 Bacteria 2075
168 Ga0207708_10102991 3300026075 Bacteria 2211
169 Ga0207708_10501225 3300026075 Bacteria 1018
170 Ga0207641_10381435 3300026088 Bacteria 1350
171 Ga0207676_10265417 3300026095 Bacteria 1552
172 Ga0207676_10528999 3300026095 Bacteria 1123
173 Ga0207674_10010852 3300026116 Bacteria 10268
174 Ga0207675_100185345 3300026118 Bacteria 1994
175 Ga0207675_100290533 3300026118 Bacteria 1590
176 Ga0207675_100446373 3300026118 Bacteria 1281
177 Ga0207675_100467540 3300026118 Bacteria 1252
178 Ga0209966_1047528 3300027695 Bacteria 907
179 Ga0209998_10008057 3300027717 Bacteria 2186
180 Ga0209813_10006815 3300027866 Bacteria 2831
181 Ga0207428_10050582 3300027907 Bacteria 3324
182 Ga0207428_10398443 3300027907 Bacteria 1008
183 Ga0207428_10666394 3300027907 Bacteria 746
184 Ga0268266_10095758 3300028379 Bacteria 2608
185 Ga0268266_10336613 3300028379 Bacteria 1416
186 Ga0268265_10090291 3300028380 Bacteria 2447
187 Ga0268265_10157821 3300028380 Bacteria 1922
188 Ga0268264_10287745 3300028381 Bacteria 1542
189 Ga0307513_10624003 3300031456 Bacteria 786
190 Ga0307408_102372641 3300031548 Bacteria 515
191 Ga0307409_101591999 3300031995 Bacteria 681
192 Ga0307409_101785842 3300031995 Unclassified 644
193 Ga0307416_101664636 3300032002 Bacteria 743
194 Ga0307411_11164299 3300032005 Bacteria 698
195 Ga0373948_0006740 3300034817 Bacteria 1910
196 Ga0373949_0001315 3300035090 Bacteria 7172
197 Ga0373932_0000066 3300035112 Bacteria 26000
198 Ga0373939_0046017 3300035114 Bacteria 1334
199 Ga0373960_0007253 3300035121 Bacteria 2623
200 Ga0373962_0002949 3300035242 Bacteria 4081
201 Ga0316574_0001729 3300035398 Bacteria 10572
202 Ga0373927_0010040 3300035695 Bacteria 6340
203 Ga0373947_0123905 3300035725 Bacteria 1644
204 Ga0439441_028068 3300042001 Bacteria 1077
205 Ga0439446_0316801 3300042156 Bacteria 550
206 Ga0439435_0200790 3300042436 Bacteria 657
207 Ga0451577_1015043 3300042876 Bacteria 745
208 Ga0439440_0046435 3300042993 Bacteria 1073
209 Ga0495629_0505205 3300046459 Bacteria 815
210 Ga0495638_0004258 3300046460 Bacteria 10890
211 Ga0495665_0263943 3300046531 Unclassified 885
212 Ga0495656_0242479 3300046615 Bacteria 908
213 Ga0495625_0498797 3300046660 Bacteria 745
214 Ga0495658_0034048 3300046683 Bacteria 2793
215 Ga0495669_0514782 3300046684 Bacteria 582
216 Ga0495671_0297186 3300046692 Bacteria 777
217 Ga0495685_005983 3300047447 Bacteria 3974
218 Ga0496106_0812590 3300048909 Bacteria 741
219 Ga0496107_1152867 3300048910 Bacteria 558
220 Ga0496110_0099893 3300048913 Bacteria 2601
221 Ga0501068_0891930 3300049584 Bacteria 585
222 Ga0501072_0492239 3300049588 Bacteria 970
223 Ga0501072_0976137 3300049588 Bacteria 661
224 Ga0501074_0423111 3300049590 Bacteria 945
225 Ga0501076_0112529 3300049592 Bacteria 2202
226 Ga0501079_0751226 3300049741 Bacteria 768
227 Ga0501081_1373921 3300049743 Bacteria 536
228 Ga0501083_0396591 3300049744 Bacteria 898
229 nmdc:mga03683_376017_c1 3300050489 Bacteria 676
230 nmdc:mga03683_46671_c1 3300050489 Bacteria 1796
231 nmdc:mga03n38_449239_c1 3300050490 Bacteria 717
232 nmdc:mga03n38_6044_c1 3300050490 Bacteria 4176
233 nmdc:mga03n38_98948_c1 3300050490 Bacteria 1404
234 nmdc:mga00v17_165224_c1 3300050491 Bacteria 1426
235 nmdc:mga0yw44_11190_c1 3300050492 Bacteria 4618
236 nmdc:mga0yw44_453786_c1 3300050492 Bacteria 869
237 nmdc:mga0k408_18370_c1 3300050493 Bacteria 3903
238 nmdc:mga0k408_185233_c1 3300050493 Bacteria 1242
239 nmdc:mga0k408_760351_c1 3300050493 Bacteria 566
240 nmdc:mga06z11_24085_c1 3300050494 Bacteria 2868
241 nmdc:mga06z11_28880_c1 3300050494 Bacteria 2666
242 nmdc:mga06z11_311161_c1 3300050494 Bacteria 938
243 nmdc:mga06z11_804444_c1 3300050494 Bacteria 573
244 nmdc:mga04h51_146788_c1 3300050495 Bacteria 899
245 nmdc:mga04h51_6006_c1 3300050495 Bacteria 3125
246 nmdc:mga07m45_138800_c1 3300050496 Bacteria 1407
247 nmdc:mga07m45_146181_c1 3300050496 Bacteria 1370
248 nmdc:mga07m45_55236_c1 3300050496 Bacteria 2245
249 nmdc:mga05p37_1114467_c1 3300050507 Bacteria 825
250 nmdc:mga05p37_135163_c1 3300050507 Bacteria 3025
251 nmdc:mga05p37_2215958_c1 3300050507 Bacteria 510
252 nmdc:mga05p37_303349_c1 3300050507 Bacteria 1896
253 nmdc:mga05p37_504250_c1 3300050507 Unclassified 1388
254 nmdc:mga05p37_701836_c1 3300050507 Bacteria 1124
255 nmdc:mga05p37_78564_c1 3300050507 Bacteria 4064
256 nmdc:mga09592_47980_c1 3300050508 Bacteria 3600
257 nmdc:mga09592_531871_c1 3300050508 Bacteria 1010
258 nmdc:mga0qj67_703534_c1 3300050509 Unclassified 804
259 nmdc:mga06r32_530908_c1 3300050510 Bacteria 1152
260 nmdc:mga06r32_63656_c1 3300050510 Bacteria 3556
261 nmdc:mga06r32_905507_c1 3300050510 Bacteria 838
262 nmdc:mga06r32_998869_c1 3300050510 Bacteria 789
263 nmdc:mga08y16_1025957_c1 3300050511 Bacteria 804
264 nmdc:mga08y16_511834_c1 3300050511 Bacteria 1218
265 nmdc:mga08y16_79586_c1 3300050511 Bacteria 3416
266 nmdc:mga08y16_8913_c1 3300050511 Bacteria 10534
267 nmdc:mga0n895_579818_c1 3300050512 Bacteria 1126
268 nmdc:mga0rr50_79264_c1 3300050513 Bacteria 2529
269 nmdc:mga0a205_141096_c1 3300050515 Bacteria 2310
270 nmdc:mga0a205_183827_c1 3300050515 Bacteria 1984
271 Ga0500646_0040749 3300053090 Bacteria 1307
272 Ga0500641_0021113 3300053096 Bacteria 2477
273 Ga0500650_0511133 3300053098 Bacteria 510
274 Ga0500658_0127463 3300053134 Bacteria 1133
275 Ga0500604_0210963 3300053151 Bacteria 669
276 Ga0500616_0245348 3300053153 Bacteria 768
277 Ga0500645_062241 3300053730 Bacteria 1078
278 Ga0501084_1202434 3300054114 Bacteria 636
279 Ga0501082_0100859 3300060353 Bacteria 2497
280 Ga0501082_0286112 3300060353 Bacteria 1435
281 Ga0530510_0073271 3300061734 Bacteria 2486
282 2836162767 2836160341 Unclassified 5867367
283 Ga0111539_10115215
284 MBSR1b_contig_659378
285 ARcpr5oldR_c000619
286 ARSoilOldRDRAFT_c000172
287 ARCol0yngRDRAFT_1003560
288 JGI24737J22298_10023031
289 JGI24751J29686_10079866
290 JGI25406J46586_10000893
291 JGI26128J50194_1012817
292 JGI25407J50210_10094148
293 JGI25404J52841_10115558
294 JGI25405J52794_10006764
295 Ga0065712_10123305
296 Ga0065715_10103587
297 Ga0065707_10311238
298 Ga0065707_10437218
299 Ga0065707_10713793
300 Ga0070690_100075414
301 Ga0070690_101426526
302 Ga0070670_101364282
303 Ga0068869_100408615
304 Ga0070680_100304439
305 Ga0070689_100469301
306 Ga0070687_100500766
307 Ga0070692_10033493
308 Ga0070668_100907729
309 Ga0070669_100702654
310 Ga0070675_100030260
311 Ga0070675_100827940
312 Ga0070671_100703587
313 Ga0070659_100414329
314 Ga0070667_100248471
315 Ga0070701_10282565
316 Ga0070701_10340523
317 Ga0070700_100173075
318 Ga0070700_100855993
319 Ga0070708_100414632
320 Ga0070663_100074552
321 Ga0070662_101389189
322 Ga0068867_101155918
323 Ga0068853_100075501
324 Ga0070686_100107005
325 Ga0070686_101774376
326 Ga0070695_101138348
327 Ga0070696_100183414
328 Ga0070665_100323295
329 Ga0070665_100444987
330 Ga0068859_100021723
331 Ga0068859_100269502
332 Ga0068859_100685551
333 Ga0068864_100215609
334 Ga0068864_100754280
335 Ga0068861_100196016
336 Ga0068861_101935092
337 Ga0068863_101403611
338 Ga0068858_100390878
339 Ga0068860_100292743
340 Ga0068860_102743357
341 Ga0068862_100104829
342 Ga0068862_100464963
343 Ga0081455_10006018
344 Ga0081455_10009625
345 Ga0081455_10085895
346 Ga0081455_10368241
347 Ga0081538_10137967
348 Ga0081539_10001685
349 Ga0081539_10058082
350 Ga0075365_10123027
351 Ga0075365_10155897
352 Ga0075368_10002015
353 Ga0075368_10219263
354 Ga0075363_100004793
355 Ga0075363_100104566
356 Ga0075363_100899598
357 Ga0075364_10098453
358 Ga0075362_10022827
359 Ga0075362_10118655
360 Ga0075362_10196422
361 Ga0075362_10427774
362 Ga0075362_10465539
363 Ga0075367_10002342
364 Ga0075367_10130376
365 Ga0075367_10294537
366 Ga0075366_10000683
367 Ga0075366_10056837
368 Ga0075366_10138895
369 Ga0075366_10214220
370 Ga0075370_10013697
371 Ga0075428_100074420
372 Ga0075428_100180463
373 Ga0075428_100357238
374 Ga0075428_100436984
375 Ga0075428_101650357
376 Ga0075430_101177580
377 Ga0075431_100087740
378 Ga0075433_10038256
379 Ga0075433_10420548
380 Ga0075429_101305135
381 Ga0097620_100021722
382 Ga0097620_100269488
383 Ga0097620_100685640
384 Ga0111539_10331316
385 Ga0111539_10992773
386 Ga0111539_11424365
387 Ga0111539_11431710
388 Ga0114129_10267023
389 Ga0114129_10286302
390 Ga0114129_11936486
391 Ga0114129_13451374
392 Ga0105243_11303808
393 Ga0105243_11595822
394 Ga0105242_10706606
395 Ga0105248_11953350
396 Ga0105237_10125936
397 Ga0105238_10527039
398 Ga0105249_10255863
399 Ga0105249_10458151
400 Ga0105249_10937684
401 Ga0105249_11085936
402 Ga0105239_10067078
403 Ga0105239_10963817
404 Ga0105246_10634770
405 Ga0157346_1025021
406 Ga0157378_10230288
407 Ga0163162_10115818
408 Ga0163162_10411604
409 Ga0157375_11581405
410 Ga0157380_10204868
411 Ga0157380_11308998
412 Ga0157380_12966557
413 Ga0157377_10292751
414 Ga0157379_11898110
415 Ga0207697_10021745
416 Ga0207642_11124299
417 Ga0207710_10098592
418 Ga0207647_10064360
419 Ga0207647_10792520
420 Ga0207643_10038893
421 Ga0207643_10231935
422 Ga0207660_10298024
423 Ga0207660_10928097
424 Ga0207662_10048986
425 Ga0207662_10121649
426 Ga0207662_10869665
427 Ga0207657_11398537
428 Ga0207681_10573701
429 Ga0207681_11773414
430 Ga0207694_10121736
431 Ga0207650_10285613
432 Ga0207650_11007049
433 Ga0207650_11026834
434 Ga0207659_10185277
435 Ga0207690_10929205
436 Ga0207706_11728962
437 Ga0207709_10646712
438 Ga0207709_11683596
439 Ga0207711_10437939
440 Ga0207689_10095995
441 Ga0207679_10679413
442 Ga0207712_10501281
443 Ga0207712_10525564
444 Ga0207712_11668776
445 Ga0207668_10313811
446 Ga0207668_11503375
447 Ga0207658_11002061
448 Ga0207703_11258303
449 Ga0207639_10131074
450 Ga0207708_10102991
451 Ga0207708_10501225
452 Ga0207641_10381435
453 Ga0207676_10265417
454 Ga0207676_10528999
455 Ga0207674_10010852
456 Ga0207675_100185345
457 Ga0207675_100290533
458 Ga0207675_100446373
459 Ga0207675_100467540
460 Ga0209966_1047528
461 Ga0209998_10008057
462 Ga0209813_10006815
463 Ga0207428_10050582
464 Ga0207428_10398443
465 Ga0207428_10666394
466 Ga0268266_10095758
467 Ga0268266_10336613
468 Ga0268265_10090291
469 Ga0268265_10157821
470 Ga0268264_10287745
471 Ga0307513_10624003
472 Ga0307408_102372641
473 Ga0307409_101591999
474 Ga0307409_101785842
475 Ga0307416_101664636
476 Ga0307411_11164299
477 Ga0373948_0006740
478 Ga0373949_0001315
479 Ga0373932_0000066
480 Ga0373939_0046017
481 Ga0373960_0007253
482 Ga0373962_0002949
483 Ga0316574_0001729
484 Ga0373927_0010040
485 Ga0373947_0123905
486 Ga0439441_028068
487 Ga0439446_0316801
488 Ga0439435_0200790
489 Ga0451577_1015043
490 Ga0439440_0046435
491 Ga0495629_0505205
492 Ga0495638_0004258
493 Ga0495665_0263943
494 Ga0495656_0242479
495 Ga0495625_0498797
496 Ga0495658_0034048
497 Ga0495669_0514782
498 Ga0495671_0297186
499 Ga0495685_005983
500 Ga0496106_0812590
501 Ga0496107_1152867
502 Ga0496110_0099893
503 Ga0501068_0891930
504 Ga0501072_0492239
505 Ga0501072_0976137
506 Ga0501074_0423111
507 Ga0501076_0112529
508 Ga0501079_0751226
509 Ga0501081_1373921
510 Ga0501083_0396591
511 nmdc:mga03683_376017_c1
512 nmdc:mga03683_46671_c1
513 nmdc:mga03n38_449239_c1
514 nmdc:mga03n38_6044_c1
515 nmdc:mga03n38_98948_c1
516 nmdc:mga00v17_165224_c1
517 nmdc:mga0yw44_11190_c1
518 nmdc:mga0yw44_453786_c1
519 nmdc:mga0k408_18370_c1
520 nmdc:mga0k408_185233_c1
521 nmdc:mga0k408_760351_c1
522 nmdc:mga06z11_24085_c1
523 nmdc:mga06z11_28880_c1
524 nmdc:mga06z11_311161_c1
525 nmdc:mga06z11_804444_c1
526 nmdc:mga04h51_146788_c1
527 nmdc:mga04h51_6006_c1
528 nmdc:mga07m45_138800_c1
529 nmdc:mga07m45_146181_c1
530 nmdc:mga07m45_55236_c1
531 nmdc:mga05p37_1114467_c1
532 nmdc:mga05p37_135163_c1
533 nmdc:mga05p37_2215958_c1
534 nmdc:mga05p37_303349_c1
535 nmdc:mga05p37_504250_c1
536 nmdc:mga05p37_701836_c1
537 nmdc:mga05p37_78564_c1
538 nmdc:mga09592_47980_c1
539 nmdc:mga09592_531871_c1
540 nmdc:mga0qj67_703534_c1
541 nmdc:mga06r32_530908_c1
542 nmdc:mga06r32_63656_c1
543 nmdc:mga06r32_905507_c1
544 nmdc:mga06r32_998869_c1
545 nmdc:mga08y16_1025957_c1
546 nmdc:mga08y16_511834_c1
547 nmdc:mga08y16_79586_c1
548 nmdc:mga08y16_8913_c1
549 nmdc:mga0n895_579818_c1
550 nmdc:mga0rr50_79264_c1
551 nmdc:mga0a205_141096_c1
552 nmdc:mga0a205_183827_c1
553 Ga0500646_0040749
554 Ga0500641_0021113
555 Ga0500650_0511133
556 Ga0500658_0127463
557 Ga0500604_0210963
558 Ga0500616_0245348
559 Ga0500645_062241
560 Ga0501084_1202434
561 Ga0501082_0100859
562 Ga0501082_0286112
563 Ga0530510_0073271
564 2836162767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map