F384849

General Info

Members Datasets Scaffolds Average Seq Length
282 154 564 102

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101319385|Ga0070716_1013193852
Length 117
Sequence LQKRVSPCYYVNTMASATAEPRHWPTKQHRDLFGAIASLRDQGEVERFLRDLCTRSELDAMAHRWEVAKLLEEGLPYLEVARRAHASTTTVTRVAQWLRNGEGGYELALRRRRRTNR

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
84 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.57
Rhizosphere 89.36
Stem 0
Stem Tuber 0
Unclassified 27.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101319385 3300006173 Unclassified 584
2 Ga0070680_101017537 3300005336 Unclassified 716
3 Ga0070661_100142646 3300005344 Bacteria 1806
4 Ga0070671_100126663 3300005355 Unclassified 2150
5 Ga0070659_101690742 3300005366 Bacteria 566
6 Ga0070709_11599215 3300005434 Unclassified 531
7 Ga0070714_100605389 3300005435 Bacteria 1052
8 Ga0070714_100805356 3300005435 Bacteria 910
9 Ga0070714_100894174 3300005435 Bacteria 862
10 Ga0070714_101741491 3300005435 Unclassified 608
11 Ga0070701_11092468 3300005438 Bacteria 561
12 Ga0070705_101562294 3300005440 Bacteria 554
13 Ga0070708_100691131 3300005445 Bacteria 960
14 Ga0070708_101422164 3300005445 Unclassified 647
15 Ga0070681_10396767 3300005458 Unclassified 1291
16 Ga0070706_100052803 3300005467 Bacteria 3751
17 Ga0070706_100405108 3300005467 Bacteria 1270
18 Ga0070706_101781791 3300005467 Unclassified 560
19 Ga0070707_100134349 3300005468 Bacteria 2407
20 Ga0070707_100220222 3300005468 Bacteria 1848
21 Ga0070707_100460949 3300005468 Bacteria 1232
22 Ga0070707_100990321 3300005468 Bacteria 806
23 Ga0070707_101749745 3300005468 Unclassified 589
24 Ga0070698_100192194 3300005471 Bacteria 1978
25 Ga0070698_100547391 3300005471 Unclassified 1096
26 Ga0070698_101470392 3300005471 Bacteria 632
27 Ga0070699_100073286 3300005518 Bacteria 2979
28 Ga0070699_101451350 3300005518 Bacteria 629
29 Ga0070684_101811626 3300005535 Bacteria 576
30 Ga0070696_101850967 3300005546 Bacteria 522
31 Ga0070704_101132028 3300005549 Bacteria 712
32 Ga0068855_101058755 3300005563 Unclassified 850
33 Ga0070717_10454570 3300006028 Bacteria 1154
34 Ga0070717_11189684 3300006028 Bacteria 694
35 Ga0070712_100148537 3300006175 Bacteria 1797
36 Ga0075434_101677664 3300006871 Unclassified 643
37 Ga0075435_100718852 3300007076 Bacteria 868
38 Ga0099795_10183875 3300007788 Bacteria 874
39 Ga0105245_10723368 3300009098 Unclassified 1030
40 Ga0105245_13285982 3300009098 Unclassified 500
41 Ga0114129_10253371 3300009147 Bacteria 2362
42 Ga0105243_12040873 3300009148 Bacteria 608
43 Ga0105242_11477889 3300009176 Unclassified 709
44 Ga0105242_11748472 3300009176 Unclassified 659
45 Ga0105248_11771943 3300009177 Bacteria 700
46 Ga0105237_10836303 3300009545 Unclassified 927
47 Ga0105249_13305528 3300009553 Unclassified 519
48 Ga0099796_10189280 3300010159 Bacteria 830
49 Ga0105239_12395842 3300010375 Unclassified 615
50 Ga0105246_11511623 3300011119 Unclassified 631
51 Ga0163162_11081935 3300013306 Unclassified 908
52 Ga0157372_11077157 3300013307 Bacteria 930
53 Ga0182008_10018598 3300014497 Bacteria 3597
54 Ga0157379_11450558 3300014968 Unclassified 666
55 Ga0182005_1244655 3300015265 Bacteria 553
56 Ga0213873_10215185 3300021358 Bacteria 600
57 Ga0213871_10116146 3300021441 Bacteria 794
58 Ga0207699_10201104 3300025906 Unclassified 1350
59 Ga0207705_10321329 3300025909 Bacteria 1189
60 Ga0207684_10323870 3300025910 Bacteria 1328
61 Ga0207707_10377864 3300025912 Unclassified 1218
62 Ga0207707_11139467 3300025912 Bacteria 634
63 Ga0207693_10088105 3300025915 Bacteria 2433
64 Ga0207693_11276784 3300025915 Unclassified 550
65 Ga0207663_10655530 3300025916 Bacteria 829
66 Ga0207660_11318037 3300025917 Archaea 586
67 Ga0207657_10747438 3300025919 Bacteria 758
68 Ga0207649_10277163 3300025920 Unclassified 1218
69 Ga0207652_10862678 3300025921 Unclassified 801
70 Ga0207646_10118071 3300025922 Bacteria 2382
71 Ga0207646_10167205 3300025922 Bacteria 1986
72 Ga0207646_10426132 3300025922 Bacteria 1198
73 Ga0207646_10771019 3300025922 Bacteria 858
74 Ga0207646_11090053 3300025922 Unclassified 703
75 Ga0207687_10989662 3300025927 Unclassified 721
76 Ga0207700_10825788 3300025928 Bacteria 829
77 Ga0207664_10061482 3300025929 Bacteria 2996
78 Ga0207664_10070283 3300025929 Bacteria 2817
79 Ga0207664_10083229 3300025929 Bacteria 2608
80 Ga0207664_10663860 3300025929 Bacteria 937
81 Ga0207644_10068570 3300025931 Bacteria 2588
82 Ga0207686_10800606 3300025934 Unclassified 755
83 Ga0207669_11851880 3300025937 Unclassified 516
84 Ga0207704_11640095 3300025938 Unclassified 553
85 Ga0207665_10108130 3300025939 Bacteria 1951
86 Ga0207661_10800631 3300025944 Bacteria 868
87 Ga0207661_11065934 3300025944 Bacteria 744
88 Ga0265337_1024836 3300028556 Bacteria 1828
89 Ga0265337_1082483 3300028556 Bacteria 879
90 Ga0265319_1011187 3300028563 Bacteria 3692
91 Ga0265319_1043077 3300028563 Bacteria 1517
92 Ga0265334_10223678 3300028573 Unclassified 651
93 Ga0265334_10277284 3300028573 Bacteria 575
94 Ga0265318_10009857 3300028577 Bacteria 4185
95 Ga0265322_10035806 3300028654 Bacteria 1414
96 Ga0265322_10078916 3300028654 Bacteria 934
97 Ga0265336_10030499 3300028666 Bacteria 1679
98 Ga0265336_10040187 3300028666 Bacteria 1433
99 Ga0265336_10079771 3300028666 Bacteria 977
100 Ga0265336_10149438 3300028666 Bacteria 695
101 Ga0265336_10178638 3300028666 Unclassified 631
102 Ga0265338_10011511 3300028800 Bacteria 10207
103 Ga0265338_10017913 3300028800 Bacteria 7606
104 Ga0265338_10048182 3300028800 Bacteria 3880
105 Ga0265338_10197473 3300028800 Bacteria 1520
106 Ga0265338_10318389 3300028800 Bacteria 1126
107 Ga0265324_10013354 3300029957 Bacteria 3067
108 Ga0265330_10010167 3300031235 Bacteria 4444
109 Ga0265330_10026766 3300031235 Bacteria 2607
110 Ga0265332_10213629 3300031238 Unclassified 800
111 Ga0265332_10224716 3300031238 Unclassified 778
112 Ga0265328_10230586 3300031239 Unclassified 706
113 Ga0265320_10050019 3300031240 Bacteria 2033
114 Ga0265320_10069755 3300031240 Bacteria 1658
115 Ga0265320_10237630 3300031240 Bacteria 809
116 Ga0265325_10004306 3300031241 Bacteria 9017
117 Ga0265325_10067207 3300031241 Bacteria 1806
118 Ga0265329_10008795 3300031242 Bacteria 3806
119 Ga0265339_10131805 3300031249 Bacteria 1277
120 Ga0265339_10392265 3300031249 Bacteria 649
121 Ga0265331_10047363 3300031250 Bacteria 2068
122 Ga0265331_10049831 3300031250 Bacteria 2010
123 Ga0265327_10097354 3300031251 Bacteria 1425
124 Ga0265327_10150616 3300031251 Bacteria 1080
125 Ga0265327_10257534 3300031251 Bacteria 775
126 Ga0265327_10374715 3300031251 Bacteria 620
127 Ga0265316_10018439 3300031344 Bacteria 5997
128 Ga0265316_10112601 3300031344 Bacteria 2059
129 Ga0265316_10202347 3300031344 Bacteria 1471
130 Ga0265313_10019822 3300031595 Bacteria 3730
131 Ga0265314_10007741 3300031711 Bacteria 9287
132 Ga0265314_10082667 3300031711 Bacteria 2112
133 Ga0265314_10102254 3300031711 Bacteria 1839
134 Ga0265314_10194144 3300031711 Bacteria 1205
135 Ga0265314_10352721 3300031711 Bacteria 809
136 Ga0265314_10470511 3300031711 Bacteria 666
137 Ga0265342_10076721 3300031712 Bacteria 1937
138 Ga0265342_10655952 3300031712 Bacteria 526
139 Ga0316583_10051930 3300032133 Bacteria 1443
140 Ga0373939_0079154 3300035114 Bacteria 1088
141 Ga0373954_0297676 3300035118 Unclassified 796
142 Ga0373956_0130381 3300035119 Unclassified 1177
143 Ga0373957_0429080 3300035120 Bacteria 571
144 Ga0373960_0224743 3300035121 Unclassified 673
145 Ga0373960_0314248 3300035121 Bacteria 586
146 Ga0373955_0431537 3300035172 Unclassified 802
147 Ga0373955_0601993 3300035172 Unclassified 673
148 Ga0373942_0159539 3300035207 Unclassified 729
149 Ga0373937_0283236 3300036401 Bacteria 1565
150 Ga0373937_1582458 3300036401 Unclassified 603
151 Ga0373937_1807423 3300036401 Archaea 557
152 Ga0395899_0123437 3300037312 Bacteria 1853
153 Ga0395899_0887015 3300037312 Bacteria 545
154 Ga0395900_0096670 3300037418 Bacteria 3034
155 Ga0395900_0414482 3300037418 Bacteria 1309
156 Ga0395900_0715395 3300037418 Bacteria 934
157 Ga0395900_0775843 3300037418 Bacteria 888
158 Ga0395898_0142046 3300037466 Bacteria 2298
159 Ga0395898_0462379 3300037466 Bacteria 1208
160 Ga0395898_1470266 3300037466 Bacteria 608
161 Ga0395905_0301177 3300037471 Bacteria 1491
162 Ga0395905_0958328 3300037471 Bacteria 759
163 Ga0395901_0438956 3300038443 Bacteria 1336
164 Ga0395901_1246289 3300038443 Bacteria 708
165 Ga0436360_0940627 3300039438 Bacteria 2561
166 Ga0436360_1086894 3300039438 Bacteria 630
167 Ga0436363_0587000 3300039450 Bacteria 985
168 Ga0436363_0678928 3300039450 Unclassified 699
169 Ga0436363_1276715 3300039450 Unclassified 1365
170 Ga0436362_0872908 3300039453 Bacteria 728
171 Ga0439448_0066855 3300042005 Bacteria 1194
172 Ga0466961_0500569 3300044693 Bacteria 734
173 Ga0466963_0476089 3300044694 Bacteria 881
174 Ga0466963_0618965 3300044694 Unclassified 764
175 Ga0466963_0891270 3300044694 Unclassified 627
176 Ga0466964_0608185 3300044706 Bacteria 600
177 Ga0466964_0649676 3300044706 Unclassified 583
178 Ga0466959_0000296 3300045049 Bacteria 29640
179 Ga0451576_0419982 3300045051 Bacteria 1403
180 Ga0466958_0193633 3300045836 Bacteria 1293
181 Ga0466967_0007997 3300045976 Bacteria 7701
182 Ga0466967_0010583 3300045976 Bacteria 6930
183 Ga0466967_0020981 3300045976 Bacteria 5292
184 Ga0466967_1461714 3300045976 Bacteria 681
185 Ga0466967_1801319 3300045976 Bacteria 609
186 Ga0466967_2155937 3300045976 Bacteria 553
187 Ga0495592_0329366 3300046454 Bacteria 985
188 Ga0495592_0855153 3300046454 Unclassified 537
189 Ga0495629_0055085 3300046459 Bacteria 2781
190 Ga0495629_0350298 3300046459 Unclassified 1007
191 Ga0495629_0419184 3300046459 Unclassified 909
192 Ga0495629_1102587 3300046459 Bacteria 513
193 Ga0495641_0600944 3300046461 Unclassified 503
194 Ga0495651_0052982 3300046462 Bacteria 3125
195 Ga0495651_0589836 3300046462 Bacteria 702
196 Ga0495651_0951509 3300046462 Bacteria 523
197 Ga0495653_0019563 3300046463 Bacteria 5490
198 Ga0495653_0065534 3300046463 Bacteria 2734
199 Ga0495582_0615548 3300046473 Bacteria 628
200 Ga0495608_0258104 3300046511 Unclassified 1085
201 Ga0495608_0676816 3300046511 Unclassified 615
202 Ga0495618_0151329 3300046514 Unclassified 1482
203 Ga0495618_0327832 3300046514 Unclassified 947
204 Ga0495618_0437626 3300046514 Bacteria 795
205 Ga0495652_0033916 3300046529 Bacteria 4452
206 Ga0495652_0140424 3300046529 Bacteria 1900
207 Ga0495640_0520368 3300046533 Unclassified 723
208 Ga0495586_0308747 3300046535 Bacteria 907
209 Ga0495667_0234660 3300046559 Bacteria 1169
210 Ga0495667_0641080 3300046559 Archaea 660
211 Ga0495634_0022822 3300046642 Bacteria 4407
212 Ga0495634_0073804 3300046642 Bacteria 2243
213 Ga0495634_0170463 3300046642 Unclassified 1368
214 Ga0495634_0768077 3300046642 Unclassified 551
215 Ga0495635_0056496 3300046663 Bacteria 2702
216 Ga0495635_0196147 3300046663 Bacteria 1370
217 Ga0495657_0353067 3300046675 Unclassified 870
218 Ga0495657_0832708 3300046675 Unclassified 526
219 Ga0495646_0382927 3300046680 Unclassified 733
220 Ga0495613_0456980 3300046689 Bacteria 865
221 Ga0495613_0961844 3300046689 Unclassified 550
222 Ga0495589_0537587 3300046794 Bacteria 533
223 Ga0495604_0640926 3300047317 Archaea 678
224 Ga0495604_1001966 3300047317 Bacteria 517
225 Ga0495674_0447914 3300047319 Bacteria 1038
226 Ga0495674_1065318 3300047319 Bacteria 617
227 Ga0495674_1179128 3300047319 Bacteria 580
228 Ga0495674_1402217 3300047319 Unclassified 521
229 Ga0495676_0533979 3300047321 Bacteria 768
230 Ga0495676_0569742 3300047321 Bacteria 739
231 Ga0495676_1091888 3300047321 Bacteria 507
232 Ga0495680_0060991 3300047322 Bacteria 2903
233 Ga0495680_0170586 3300047322 Unclassified 1575
234 Ga0495680_0233206 3300047322 Bacteria 1310
235 Ga0495680_0420877 3300047322 Unclassified 919
236 Ga0495675_0631990 3300047444 Unclassified 605
237 Ga0495684_0278775 3300047471 Unclassified 1207
238 Ga0495684_0306975 3300047471 Unclassified 1138
239 Ga0495684_0355421 3300047471 Bacteria 1039
240 Ga0495684_0571448 3300047471 Bacteria 767
241 Ga0495602_0636296 3300048088 Unclassified 730
242 Ga0495602_0792699 3300048088 Bacteria 637
243 Ga0496100_0715174 3300048903 Unclassified 782
244 Ga0496100_1515991 3300048903 Bacteria 530
245 Ga0496101_0208066 3300048904 Bacteria 1515
246 Ga0496103_0262477 3300048906 Bacteria 1111
247 Ga0496104_0549301 3300048907 Bacteria 1066
248 Ga0496105_0105805 3300048908 Bacteria 2323
249 Ga0496106_0064410 3300048909 Bacteria 2788
250 Ga0496106_1397990 3300048909 Unclassified 541
251 Ga0496107_0000634 3300048910 Bacteria 19794
252 Ga0496108_0046011 3300048911 Bacteria 3645
253 Ga0496108_0965916 3300048911 Bacteria 729
254 Ga0496109_0163309 3300048912 Bacteria 2087
255 Ga0496109_0166487 3300048912 Bacteria 2067
256 Ga0496109_0223086 3300048912 Bacteria 1773
257 Ga0496109_0870112 3300048912 Unclassified 839
258 Ga0496109_1211158 3300048912 Unclassified 692
259 Ga0496110_0075648 3300048913 Bacteria 2992
260 Ga0496112_0050450 3300048915 Bacteria 4081
261 Ga0496112_0082597 3300048915 Bacteria 3177
262 Ga0496112_0117884 3300048915 Bacteria 2625
263 Ga0496112_0261520 3300048915 Bacteria 1680
264 Ga0496112_0944513 3300048915 Bacteria 783
265 Ga0496113_0157599 3300048916 Bacteria 1794
266 Ga0496113_0578368 3300048916 Bacteria 900
267 Ga0496113_1137792 3300048916 Bacteria 611
268 Ga0496114_0595168 3300048917 Bacteria 975
269 Ga0496115_0523188 3300048918 Bacteria 951
270 Ga0501067_0038451 3300049583 Bacteria 2657
271 Ga0501069_0043510 3300049585 Bacteria 2486
272 nmdc:mga05p37_341553_c1 3300050507 Bacteria 1765
273 nmdc:mga0n895_982452_c1 3300050512 Bacteria 826
274 Ga0495601_0622522 3300053077 Bacteria 692
275 Ga0495601_0645451 3300053077 Archaea 677
276 Ga0495612_0380055 3300053078 Bacteria 640
277 Ga0495595_0028815 3300053084 Unclassified 2481
278 Ga0495595_0303363 3300053084 Bacteria 803
279 Ga0495595_0741377 3300053084 Unclassified 504
280 Ga0495619_0039053 3300053085 Bacteria 3098
281 Ga0495619_0860326 3300053085 Bacteria 611
282 Ga0495619_1055178 3300053085 Bacteria 542
283 Ga0070716_101319385
284 Ga0070680_101017537
285 Ga0070661_100142646
286 Ga0070671_100126663
287 Ga0070659_101690742
288 Ga0070709_11599215
289 Ga0070714_100605389
290 Ga0070714_100805356
291 Ga0070714_100894174
292 Ga0070714_101741491
293 Ga0070701_11092468
294 Ga0070705_101562294
295 Ga0070708_100691131
296 Ga0070708_101422164
297 Ga0070681_10396767
298 Ga0070706_100052803
299 Ga0070706_100405108
300 Ga0070706_101781791
301 Ga0070707_100134349
302 Ga0070707_100220222
303 Ga0070707_100460949
304 Ga0070707_100990321
305 Ga0070707_101749745
306 Ga0070698_100192194
307 Ga0070698_100547391
308 Ga0070698_101470392
309 Ga0070699_100073286
310 Ga0070699_101451350
311 Ga0070684_101811626
312 Ga0070696_101850967
313 Ga0070704_101132028
314 Ga0068855_101058755
315 Ga0070717_10454570
316 Ga0070717_11189684
317 Ga0070712_100148537
318 Ga0075434_101677664
319 Ga0075435_100718852
320 Ga0099795_10183875
321 Ga0105245_10723368
322 Ga0105245_13285982
323 Ga0114129_10253371
324 Ga0105243_12040873
325 Ga0105242_11477889
326 Ga0105242_11748472
327 Ga0105248_11771943
328 Ga0105237_10836303
329 Ga0105249_13305528
330 Ga0099796_10189280
331 Ga0105239_12395842
332 Ga0105246_11511623
333 Ga0163162_11081935
334 Ga0157372_11077157
335 Ga0182008_10018598
336 Ga0157379_11450558
337 Ga0182005_1244655
338 Ga0213873_10215185
339 Ga0213871_10116146
340 Ga0207699_10201104
341 Ga0207705_10321329
342 Ga0207684_10323870
343 Ga0207707_10377864
344 Ga0207707_11139467
345 Ga0207693_10088105
346 Ga0207693_11276784
347 Ga0207663_10655530
348 Ga0207660_11318037
349 Ga0207657_10747438
350 Ga0207649_10277163
351 Ga0207652_10862678
352 Ga0207646_10118071
353 Ga0207646_10167205
354 Ga0207646_10426132
355 Ga0207646_10771019
356 Ga0207646_11090053
357 Ga0207687_10989662
358 Ga0207700_10825788
359 Ga0207664_10061482
360 Ga0207664_10070283
361 Ga0207664_10083229
362 Ga0207664_10663860
363 Ga0207644_10068570
364 Ga0207686_10800606
365 Ga0207669_11851880
366 Ga0207704_11640095
367 Ga0207665_10108130
368 Ga0207661_10800631
369 Ga0207661_11065934
370 Ga0265337_1024836
371 Ga0265337_1082483
372 Ga0265319_1011187
373 Ga0265319_1043077
374 Ga0265334_10223678
375 Ga0265334_10277284
376 Ga0265318_10009857
377 Ga0265322_10035806
378 Ga0265322_10078916
379 Ga0265336_10030499
380 Ga0265336_10040187
381 Ga0265336_10079771
382 Ga0265336_10149438
383 Ga0265336_10178638
384 Ga0265338_10011511
385 Ga0265338_10017913
386 Ga0265338_10048182
387 Ga0265338_10197473
388 Ga0265338_10318389
389 Ga0265324_10013354
390 Ga0265330_10010167
391 Ga0265330_10026766
392 Ga0265332_10213629
393 Ga0265332_10224716
394 Ga0265328_10230586
395 Ga0265320_10050019
396 Ga0265320_10069755
397 Ga0265320_10237630
398 Ga0265325_10004306
399 Ga0265325_10067207
400 Ga0265329_10008795
401 Ga0265339_10131805
402 Ga0265339_10392265
403 Ga0265331_10047363
404 Ga0265331_10049831
405 Ga0265327_10097354
406 Ga0265327_10150616
407 Ga0265327_10257534
408 Ga0265327_10374715
409 Ga0265316_10018439
410 Ga0265316_10112601
411 Ga0265316_10202347
412 Ga0265313_10019822
413 Ga0265314_10007741
414 Ga0265314_10082667
415 Ga0265314_10102254
416 Ga0265314_10194144
417 Ga0265314_10352721
418 Ga0265314_10470511
419 Ga0265342_10076721
420 Ga0265342_10655952
421 Ga0316583_10051930
422 Ga0373939_0079154
423 Ga0373954_0297676
424 Ga0373956_0130381
425 Ga0373957_0429080
426 Ga0373960_0224743
427 Ga0373960_0314248
428 Ga0373955_0431537
429 Ga0373955_0601993
430 Ga0373942_0159539
431 Ga0373937_0283236
432 Ga0373937_1582458
433 Ga0373937_1807423
434 Ga0395899_0123437
435 Ga0395899_0887015
436 Ga0395900_0096670
437 Ga0395900_0414482
438 Ga0395900_0715395
439 Ga0395900_0775843
440 Ga0395898_0142046
441 Ga0395898_0462379
442 Ga0395898_1470266
443 Ga0395905_0301177
444 Ga0395905_0958328
445 Ga0395901_0438956
446 Ga0395901_1246289
447 Ga0436360_0940627
448 Ga0436360_1086894
449 Ga0436363_0587000
450 Ga0436363_0678928
451 Ga0436363_1276715
452 Ga0436362_0872908
453 Ga0439448_0066855
454 Ga0466961_0500569
455 Ga0466963_0476089
456 Ga0466963_0618965
457 Ga0466963_0891270
458 Ga0466964_0608185
459 Ga0466964_0649676
460 Ga0466959_0000296
461 Ga0451576_0419982
462 Ga0466958_0193633
463 Ga0466967_0007997
464 Ga0466967_0010583
465 Ga0466967_0020981
466 Ga0466967_1461714
467 Ga0466967_1801319
468 Ga0466967_2155937
469 Ga0495592_0329366
470 Ga0495592_0855153
471 Ga0495629_0055085
472 Ga0495629_0350298
473 Ga0495629_0419184
474 Ga0495629_1102587
475 Ga0495641_0600944
476 Ga0495651_0052982
477 Ga0495651_0589836
478 Ga0495651_0951509
479 Ga0495653_0019563
480 Ga0495653_0065534
481 Ga0495582_0615548
482 Ga0495608_0258104
483 Ga0495608_0676816
484 Ga0495618_0151329
485 Ga0495618_0327832
486 Ga0495618_0437626
487 Ga0495652_0033916
488 Ga0495652_0140424
489 Ga0495640_0520368
490 Ga0495586_0308747
491 Ga0495667_0234660
492 Ga0495667_0641080
493 Ga0495634_0022822
494 Ga0495634_0073804
495 Ga0495634_0170463
496 Ga0495634_0768077
497 Ga0495635_0056496
498 Ga0495635_0196147
499 Ga0495657_0353067
500 Ga0495657_0832708
501 Ga0495646_0382927
502 Ga0495613_0456980
503 Ga0495613_0961844
504 Ga0495589_0537587
505 Ga0495604_0640926
506 Ga0495604_1001966
507 Ga0495674_0447914
508 Ga0495674_1065318
509 Ga0495674_1179128
510 Ga0495674_1402217
511 Ga0495676_0533979
512 Ga0495676_0569742
513 Ga0495676_1091888
514 Ga0495680_0060991
515 Ga0495680_0170586
516 Ga0495680_0233206
517 Ga0495680_0420877
518 Ga0495675_0631990
519 Ga0495684_0278775
520 Ga0495684_0306975
521 Ga0495684_0355421
522 Ga0495684_0571448
523 Ga0495602_0636296
524 Ga0495602_0792699
525 Ga0496100_0715174
526 Ga0496100_1515991
527 Ga0496101_0208066
528 Ga0496103_0262477
529 Ga0496104_0549301
530 Ga0496105_0105805
531 Ga0496106_0064410
532 Ga0496106_1397990
533 Ga0496107_0000634
534 Ga0496108_0046011
535 Ga0496108_0965916
536 Ga0496109_0163309
537 Ga0496109_0166487
538 Ga0496109_0223086
539 Ga0496109_0870112
540 Ga0496109_1211158
541 Ga0496110_0075648
542 Ga0496112_0050450
543 Ga0496112_0082597
544 Ga0496112_0117884
545 Ga0496112_0261520
546 Ga0496112_0944513
547 Ga0496113_0157599
548 Ga0496113_0578368
549 Ga0496113_1137792
550 Ga0496114_0595168
551 Ga0496115_0523188
552 Ga0501067_0038451
553 Ga0501069_0043510
554 nmdc:mga05p37_341553_c1
555 nmdc:mga0n895_982452_c1
556 Ga0495601_0622522
557 Ga0495601_0645451
558 Ga0495612_0380055
559 Ga0495595_0028815
560 Ga0495595_0303363
561 Ga0495595_0741377
562 Ga0495619_0039053
563 Ga0495619_0860326
564 Ga0495619_1055178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01371

Trp_repressor

Trp repressor protein

27

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g1c-assembly1.cif.gz_A-2 the crystal structure of a trpr like protein from eubacterium eligens atcc 27750 0.9255 11 97
3frw-assembly1.cif.gz_A crystal structure of putative trpr protein from ruminococcus obeum 0.9208 12 103
3frw-assembly2.cif.gz_D crystal structure of putative trpr protein from ruminococcus obeum 0.9148 12 100
1tro-assembly2.cif.gz_E crystal structure of trp repressor operator complex at atomic resolution 0.9003 13 85
3frw-assembly1.cif.gz_A crystal structure of putative trpr protein from ruminococcus obeum 0.8937 12 103
ID Description Score Start End Superfamily
3g1cA00 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.9255 11 97 1.10.1270.10
3korC00 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.9207 12 93 1.10.1270.10
af_Q2G1Y1_2_100_1.10.1270.10 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.9102 12 99 1.10.1270.10
3frwF00 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.9014 8 93 1.10.1270.10
1troE00 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;TrpR-like 0.9003 13 85 1.10.1270.10
ID Description Score Start End GO Terms
AF-A0A2M7UQV8-F1-model_v4 DNA-binding transcriptional regulator 0.9744 11 99 GO:0003700
GO:0043565
AF-A0A2E6YAM1-F1-model_v4 Transposase 0.9744 19 97 GO:0003700
GO:0043565
AF-A0A2D9SG75-F1-model_v4 TrpR, YerC/YecD 0.9736 12 102 GO:0003700
GO:0043565
AF-A0A3N5M2V2-F1-model_v4 DNA-binding transcriptional regulator 0.9733 13 102 GO:0003700
GO:0043565
AF-A0A366IFM5-F1-model_v4 Trp operon repressor family 0.9725 14 103 GO:0003700
GO:0043565

Map