F384826

General Info

Members Datasets Scaffolds Average Seq Length
282 111 564 154

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10250581|Ga0068866_102505812
Length 189
Sequence MRKQVAISPEESADRLAIRELVEAYAHCADRRDAKGQMSLFTADTHFVVYMNAKDPAPSQELHSREALAPVFADLNQYAATMHFLGQTTILTLTGDRGTGETYCMPHHLTIDGKNRRLMIAALRYVDTYVKMDGIWLFAERLLYVDWLEERAMSLTFPQWARKLSSWARAEWSEDTPSATRLTNRPSNV

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
86 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
87 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.77
Rhizosphere 96.81
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10250581 3300005718 Bacteria 1083
2 Ga0070666_10336473 3300005335 Bacteria 1078
3 Ga0070668_101039743 3300005347 Bacteria 737
4 Ga0070709_10174469 3300005434 Bacteria 1505
5 Ga0070714_100201510 3300005435 Bacteria 1821
6 Ga0070714_101027355 3300005435 Unclassified 802
7 Ga0070714_102434500 3300005435 Unclassified 508
8 Ga0070713_100085043 3300005436 Bacteria 2708
9 Ga0070713_100990034 3300005436 Bacteria 811
10 Ga0070710_10393524 3300005437 Bacteria 927
11 Ga0070711_100189021 3300005439 Bacteria 1581
12 Ga0070711_100618890 3300005439 Unclassified 905
13 Ga0070711_100695713 3300005439 Bacteria 856
14 Ga0070705_100190309 3300005440 Bacteria 1398
15 Ga0070705_100432671 3300005440 Bacteria 983
16 Ga0070705_100816480 3300005440 Unclassified 743
17 Ga0070705_100882939 3300005440 Bacteria 718
18 Ga0070694_100815533 3300005444 Unclassified 766
19 Ga0070708_100004818 3300005445 Bacteria 10641
20 Ga0070708_100029016 3300005445 Bacteria 4767
21 Ga0070708_100034920 3300005445 Bacteria 4378
22 Ga0070708_100052999 3300005445 Bacteria 3598
23 Ga0070708_100059326 3300005445 Bacteria 3411
24 Ga0070708_100111717 3300005445 Bacteria 2512
25 Ga0070708_100193973 3300005445 Bacteria 1900
26 Ga0070708_100330404 3300005445 Bacteria 1436
27 Ga0070708_100661508 3300005445 Bacteria 984
28 Ga0070708_100671590 3300005445 Bacteria 976
29 Ga0070708_101200484 3300005445 Unclassified 710
30 Ga0068867_100320534 3300005459 Bacteria 1284
31 Ga0068867_101638321 3300005459 Archaea 602
32 Ga0070706_100039724 3300005467 Bacteria 4343
33 Ga0070706_100229903 3300005467 Bacteria 1731
34 Ga0070706_100461059 3300005467 Bacteria 1182
35 Ga0070706_100480120 3300005467 Bacteria 1156
36 Ga0070707_100009840 3300005468 Bacteria 8898
37 Ga0070707_100128814 3300005468 Bacteria 2460
38 Ga0070707_100277705 3300005468 Bacteria 1628
39 Ga0070707_100451299 3300005468 Bacteria 1246
40 Ga0070707_100635845 3300005468 Unclassified 1030
41 Ga0070707_100945992 3300005468 Bacteria 826
42 Ga0070707_100951233 3300005468 Unclassified 824
43 Ga0070698_100189574 3300005471 Bacteria 1994
44 Ga0070698_100299612 3300005471 Bacteria 1538
45 Ga0070698_100733496 3300005471 Bacteria 931
46 Ga0070698_100820231 3300005471 Bacteria 875
47 Ga0070699_100005926 3300005518 Bacteria 10672
48 Ga0070699_100071514 3300005518 Bacteria 3017
49 Ga0070699_100215177 3300005518 Bacteria 1711
50 Ga0070699_100292525 3300005518 Bacteria 1460
51 Ga0070699_100530598 3300005518 Bacteria 1071
52 Ga0070699_100599995 3300005518 Unclassified 1004
53 Ga0070699_100698949 3300005518 Unclassified 926
54 Ga0070697_100007284 3300005536 Bacteria 8604
55 Ga0070697_100036393 3300005536 Bacteria 3976
56 Ga0070697_100088384 3300005536 Bacteria 2559
57 Ga0070697_100413834 3300005536 Bacteria 1171
58 Ga0070697_100470330 3300005536 Bacteria 1097
59 Ga0070697_100946635 3300005536 Bacteria 765
60 Ga0070697_101184778 3300005536 Unclassified 681
61 Ga0070686_101360309 3300005544 Bacteria 595
62 Ga0070695_100769842 3300005545 Bacteria 769
63 Ga0070695_100810908 3300005545 Bacteria 751
64 Ga0070696_100023453 3300005546 Bacteria 4193
65 Ga0070704_100186238 3300005549 Bacteria 1665
66 Ga0068855_101531802 3300005563 Bacteria 684
67 Ga0068852_101504647 3300005616 Bacteria 695
68 Ga0068859_100258543 3300005617 Bacteria 1832
69 Ga0068861_100648665 3300005719 Unclassified 975
70 Ga0068863_101896232 3300005841 Bacteria 606
71 Ga0068858_100120797 3300005842 Bacteria 2450
72 Ga0068860_101655787 3300005843 Bacteria 662
73 Ga0081455_10033790 3300005937 Bacteria 4590
74 Ga0070717_10001502 3300006028 Bacteria 16141
75 Ga0070717_10108621 3300006028 Bacteria 2364
76 Ga0070717_10580991 3300006028 Bacteria 1016
77 Ga0070717_10834898 3300006028 Bacteria 838
78 Ga0075432_10012258 3300006058 Bacteria 2914
79 Ga0070715_10000042 3300006163 Bacteria 61224
80 Ga0070715_10124375 3300006163 Bacteria 1233
81 Ga0070715_10125075 3300006163 Bacteria 1230
82 Ga0070715_10182598 3300006163 Bacteria 1053
83 Ga0070715_10594423 3300006163 Unclassified 648
84 Ga0070715_10600958 3300006163 Bacteria 645
85 Ga0070716_100012992 3300006173 Bacteria 4233
86 Ga0070716_100245367 3300006173 Bacteria 1217
87 Ga0070716_100394402 3300006173 Unclassified 993
88 Ga0070716_101127885 3300006173 Unclassified 627
89 Ga0070716_101270417 3300006173 Bacteria 594
90 Ga0070712_100015638 3300006175 Bacteria 4892
91 Ga0070712_100250740 3300006175 Bacteria 1414
92 Ga0070712_100359706 3300006175 Unclassified 1193
93 Ga0070712_100508405 3300006175 Bacteria 1011
94 Ga0075428_100051924 3300006844 Bacteria 4496
95 Ga0075428_100994696 3300006844 Bacteria 888
96 Ga0075428_101203851 3300006844 Bacteria 798
97 Ga0075431_100029881 3300006847 Bacteria 5610
98 Ga0075433_10002905 3300006852 Bacteria 13137
99 Ga0075433_10036024 3300006852 Bacteria 4259
100 Ga0075433_10036803 3300006852 Bacteria 4219
101 Ga0075433_10055195 3300006852 Bacteria 3467
102 Ga0075433_10065362 3300006852 Bacteria 3191
103 Ga0075433_10184559 3300006852 Bacteria 1856
104 Ga0075433_10252171 3300006852 Bacteria 1566
105 Ga0075433_10271618 3300006852 Unclassified 1502
106 Ga0075433_10410270 3300006852 Archaea 1195
107 Ga0075433_10770222 3300006852 Bacteria 841
108 Ga0075434_100008726 3300006871 Bacteria 9433
109 Ga0075434_100011223 3300006871 Bacteria 8435
110 Ga0075434_100021983 3300006871 Bacteria 6209
111 Ga0075434_100023560 3300006871 Bacteria 6001
112 Ga0075434_100036751 3300006871 Bacteria 4845
113 Ga0075434_100070670 3300006871 Bacteria 3481
114 Ga0075434_100387019 3300006871 Bacteria 1419
115 Ga0075434_100839392 3300006871 Unclassified 934
116 Ga0075429_100130139 3300006880 Bacteria 2201
117 Ga0075429_100261818 3300006880 Bacteria 1514
118 Ga0068865_100248377 3300006881 Bacteria 1403
119 Ga0075436_100094439 3300006914 Bacteria 2080
120 Ga0075436_100129129 3300006914 Unclassified 1772
121 Ga0075436_100194808 3300006914 Bacteria 1434
122 Ga0075436_100710932 3300006914 Bacteria 745
123 Ga0097620_100258535 3300006931 Bacteria 1832
124 Ga0075435_100010292 3300007076 Bacteria 6835
125 Ga0075435_100011467 3300007076 Bacteria 6521
126 Ga0075435_100127010 3300007076 Bacteria 2132
127 Ga0075435_100279696 3300007076 Unclassified 1424
128 Ga0075435_100550067 3300007076 Bacteria 999
129 Ga0075435_100672387 3300007076 Unclassified 899
130 Ga0099794_10055134 3300007265 Bacteria 1920
131 Ga0099794_10092524 3300007265 Bacteria 1502
132 Ga0099794_10366694 3300007265 Bacteria 750
133 Ga0111539_10080708 3300009094 Bacteria 3826
134 Ga0111539_10730940 3300009094 Bacteria 1152
135 Ga0111539_10772761 3300009094 Bacteria 1118
136 Ga0105245_10338983 3300009098 Bacteria 1486
137 Ga0114129_10004290 3300009147 Bacteria 20149
138 Ga0114129_10054085 3300009147 Bacteria 5629
139 Ga0114129_10111518 3300009147 Bacteria 3774
140 Ga0114129_10311679 3300009147 Bacteria 2094
141 Ga0114129_10366956 3300009147 Bacteria 1904
142 Ga0114129_10377648 3300009147 Bacteria 1872
143 Ga0114129_10586865 3300009147 Bacteria 1445
144 Ga0114129_10840072 3300009147 Bacteria 1168
145 Ga0114129_11050842 3300009147 Bacteria 1022
146 Ga0114129_11827329 3300009147 Bacteria 738
147 Ga0105242_10314355 3300009176 Bacteria 1434
148 Ga0105248_10160538 3300009177 Bacteria 2536
149 Ga0105249_13244330 3300009553 Unclassified 523
150 Ga0099796_10066367 3300010159 Bacteria 1292
151 Ga0099796_10163225 3300010159 Bacteria 884
152 Ga0157346_1013927 3300012480 Bacteria 627
153 Ga0157378_10485147 3300013297 Bacteria 1232
154 Ga0157378_10793056 3300013297 Bacteria 973
155 Ga0157378_11597688 3300013297 Unclassified 698
156 Ga0157378_11838518 3300013297 Bacteria 654
157 Ga0163162_10020658 3300013306 Bacteria 6472
158 Ga0163162_10100913 3300013306 Bacteria 2978
159 Ga0163162_10765591 3300013306 Unclassified 1084
160 Ga0157375_11872999 3300013308 Bacteria 712
161 Ga0157377_11520905 3300014745 Bacteria 533
162 Ga0157376_11327622 3300014969 Unclassified 750
163 Ga0163161_10025269 3300017792 Bacteria 4203
164 Ga0163161_10306673 3300017792 Bacteria 1252
165 Ga0163161_10915493 3300017792 Unclassified 744
166 Ga0207692_10026606 3300025898 Bacteria 2715
167 Ga0207692_10134142 3300025898 Bacteria 1402
168 Ga0207692_10173381 3300025898 Unclassified 1251
169 Ga0207692_10319287 3300025898 Bacteria 950
170 Ga0207685_10000040 3300025905 Bacteria 59221
171 Ga0207685_10311925 3300025905 Bacteria 782
172 Ga0207685_10489227 3300025905 Bacteria 646
173 Ga0207699_10145099 3300025906 Bacteria 1564
174 Ga0207684_10012903 3300025910 Bacteria 7237
175 Ga0207684_10040032 3300025910 Bacteria 3973
176 Ga0207684_10123278 3300025910 Bacteria 2223
177 Ga0207684_10171610 3300025910 Bacteria 1869
178 Ga0207684_10546179 3300025910 Bacteria 991
179 Ga0207684_10623906 3300025910 Unclassified 920
180 Ga0207693_10014674 3300025915 Bacteria 6294
181 Ga0207693_10031071 3300025915 Bacteria 4219
182 Ga0207693_10051819 3300025915 Bacteria 3219
183 Ga0207693_10246879 3300025915 Bacteria 1401
184 Ga0207693_10281616 3300025915 Bacteria 1303
185 Ga0207693_10527317 3300025915 Unclassified 921
186 Ga0207693_11032385 3300025915 Bacteria 627
187 Ga0207663_10548908 3300025916 Unclassified 903
188 Ga0207663_10673660 3300025916 Unclassified 817
189 Ga0207646_10000118 3300025922 Bacteria 109016
190 Ga0207646_10082793 3300025922 Bacteria 2870
191 Ga0207646_10110987 3300025922 Bacteria 2461
192 Ga0207646_10156831 3300025922 Bacteria 2053
193 Ga0207646_10427966 3300025922 Bacteria 1195
194 Ga0207646_10684219 3300025922 Unclassified 918
195 Ga0207687_10168886 3300025927 Bacteria 1685
196 Ga0207700_10367016 3300025928 Bacteria 1256
197 Ga0207664_10057863 3300025929 Bacteria 3083
198 Ga0207664_10089671 3300025929 Bacteria 2518
199 Ga0207664_10517644 3300025929 Bacteria 1069
200 Ga0207644_10362764 3300025931 Bacteria 1179
201 Ga0207706_10299000 3300025933 Bacteria 1403
202 Ga0207686_10048761 3300025934 Bacteria 2625
203 Ga0207665_10023434 3300025939 Bacteria 4068
204 Ga0207665_10031715 3300025939 Bacteria 3498
205 Ga0207665_10086880 3300025939 Unclassified 2161
206 Ga0207711_10956971 3300025941 Bacteria 795
207 Ga0207668_10087513 3300025972 Bacteria 2279
208 Ga0207708_10002332 3300026075 Bacteria 13937
209 Ga0207641_10588289 3300026088 Bacteria 1088
210 Ga0207675_101918215 3300026118 Bacteria 611
211 Ga0207428_10050427 3300027907 Bacteria 3330
212 Ga0265354_1005196 3300028016 Unclassified 1332
213 Ga0268264_11409968 3300028381 Bacteria 707
214 Ga0265334_10004821 3300028573 Bacteria 5929
215 Ga0307513_10095778 3300031456 Bacteria 3008
216 Ga0307508_10000029 3300031616 Bacteria 168411
217 Ga0307514_10421292 3300031649 Bacteria 671
218 Ga0373949_0055824 3300035090 Bacteria 1006
219 Ga0373941_0506471 3300035115 Bacteria 514
220 Ga0373960_0044114 3300035121 Bacteria 1301
221 Ga0373931_0117637 3300035691 Bacteria 1515
222 Ga0373927_0368589 3300035695 Bacteria 947
223 Ga0242420_066127 3300038996 Bacteria 728
224 Ga0451577_0181519 3300042876 Bacteria 1897
225 Ga0451577_0844772 3300042876 Bacteria 826
226 Ga0453683_0023319 3300044673 Bacteria 3944
227 Ga0453683_0423352 3300044673 Bacteria 859
228 Ga0453684_0019348 3300044712 Bacteria 10371
229 Ga0451576_0093615 3300045051 Bacteria 3124
230 Ga0495584_0292659 3300046491 Bacteria 827
231 Ga0495644_0325923 3300046523 Bacteria 603
232 Ga0495665_0143668 3300046531 Bacteria 1246
233 Ga0495658_0215517 3300046683 Bacteria 1201
234 Ga0496101_0135754 3300048904 Bacteria 1872
235 Ga0496106_1196550 3300048909 Bacteria 593
236 Ga0496114_0056615 3300048917 Bacteria 3273
237 Ga0496115_0170509 3300048918 Bacteria 1800
238 Ga0496115_1006657 3300048918 Bacteria 637
239 nmdc:mga05p37_1432638_c1 3300050507 Bacteria 693
240 nmdc:mga05p37_184314_c1 3300050507 Plasmid 2538
241 nmdc:mga05p37_46224_c1 3300050507 Bacteria 5353
242 nmdc:mga05p37_48078_c1 3300050507 Bacteria 5247
243 nmdc:mga05p37_4897_c1 3300050507 Bacteria 15678
244 nmdc:mga05p37_544096_c1 3300050507 Bacteria 1323
245 nmdc:mga05p37_677747_c1 3300050507 Bacteria 1150
246 nmdc:mga09592_275060_c1 3300050508 Bacteria 1461
247 nmdc:mga06r32_1010190_c1 3300050510 Bacteria 784
248 nmdc:mga06r32_75059_c1 3300050510 Bacteria 3280
249 nmdc:mga08y16_92307_c1 3300050511 Bacteria 3155
250 nmdc:mga0n895_15423_c1 3300050512 Bacteria 6967
251 nmdc:mga0n895_178769_c1 3300050512 Bacteria 2153
252 nmdc:mga0n895_21850_c1 3300050512 Bacteria 5991
253 nmdc:mga0n895_242126_c1 3300050512 Bacteria 1831
254 nmdc:mga0n895_34262_c1 3300050512 Bacteria 4886
255 nmdc:mga0n895_38957_c1 3300050512 Bacteria 4608
256 nmdc:mga0n895_5555_c1 3300050512 Bacteria 10555
257 nmdc:mga0n895_718258_c1 3300050512 Bacteria 994
258 nmdc:mga0rr50_21711_c1 3300050513 Bacteria 4389
259 nmdc:mga0rr50_416625_c1 3300050513 Bacteria 1136
260 nmdc:mga0rr50_50571_c1 3300050513 Bacteria 3080
261 nmdc:mga0rr50_509539_c1 3300050513 Bacteria 1023
262 nmdc:mga0rr50_521689_c1 3300050513 Unclassified 1011
263 nmdc:mga0rr50_6895_c1 3300050513 Bacteria 6966
264 nmdc:mga08x19_12466_c1 3300050514 Bacteria 5122
265 nmdc:mga08x19_266154_c1 3300050514 Bacteria 1186
266 nmdc:mga08x19_678128_c1 3300050514 Bacteria 731
267 nmdc:mga08x19_73503_c1 3300050514 Unclassified 2232
268 nmdc:mga0a205_181296_c1 3300050515 Bacteria 2000
269 nmdc:mga0a205_197766_c2 3300050515 Unclassified 1457
270 nmdc:mga0a205_202397_c1 3300050515 Bacteria 1876
271 nmdc:mga0a205_297662_c1 3300050515 Bacteria 1487
272 nmdc:mga0a205_346646_c1 3300050515 Bacteria 1353
273 nmdc:mga0a205_362959_c1 3300050515 Bacteria 1315
274 nmdc:mga0a205_48751_c2 3300050515 Bacteria 3125
275 nmdc:mga0a205_487594_c1 3300050515 Bacteria 1090
276 nmdc:mga0a205_587647_c1 3300050515 Unclassified 967
277 nmdc:mga0a205_66667_c1 3300050515 Bacteria 3478
278 nmdc:mga0a205_676329_c1 3300050515 Bacteria 883
279 nmdc:mga0a205_682113_c1 3300050515 Bacteria 878
280 nmdc:mga0a205_752_c1 3300050515 Bacteria 13786
281 nmdc:mga0a205_822561_c1 3300050515 Bacteria 776
282 Ga0500616_0002197 3300053153 Bacteria 16765
283 Ga0068866_10250581
284 Ga0070666_10336473
285 Ga0070668_101039743
286 Ga0070709_10174469
287 Ga0070714_100201510
288 Ga0070714_101027355
289 Ga0070714_102434500
290 Ga0070713_100085043
291 Ga0070713_100990034
292 Ga0070710_10393524
293 Ga0070711_100189021
294 Ga0070711_100618890
295 Ga0070711_100695713
296 Ga0070705_100190309
297 Ga0070705_100432671
298 Ga0070705_100816480
299 Ga0070705_100882939
300 Ga0070694_100815533
301 Ga0070708_100004818
302 Ga0070708_100029016
303 Ga0070708_100034920
304 Ga0070708_100052999
305 Ga0070708_100059326
306 Ga0070708_100111717
307 Ga0070708_100193973
308 Ga0070708_100330404
309 Ga0070708_100661508
310 Ga0070708_100671590
311 Ga0070708_101200484
312 Ga0068867_100320534
313 Ga0068867_101638321
314 Ga0070706_100039724
315 Ga0070706_100229903
316 Ga0070706_100461059
317 Ga0070706_100480120
318 Ga0070707_100009840
319 Ga0070707_100128814
320 Ga0070707_100277705
321 Ga0070707_100451299
322 Ga0070707_100635845
323 Ga0070707_100945992
324 Ga0070707_100951233
325 Ga0070698_100189574
326 Ga0070698_100299612
327 Ga0070698_100733496
328 Ga0070698_100820231
329 Ga0070699_100005926
330 Ga0070699_100071514
331 Ga0070699_100215177
332 Ga0070699_100292525
333 Ga0070699_100530598
334 Ga0070699_100599995
335 Ga0070699_100698949
336 Ga0070697_100007284
337 Ga0070697_100036393
338 Ga0070697_100088384
339 Ga0070697_100413834
340 Ga0070697_100470330
341 Ga0070697_100946635
342 Ga0070697_101184778
343 Ga0070686_101360309
344 Ga0070695_100769842
345 Ga0070695_100810908
346 Ga0070696_100023453
347 Ga0070704_100186238
348 Ga0068855_101531802
349 Ga0068852_101504647
350 Ga0068859_100258543
351 Ga0068861_100648665
352 Ga0068863_101896232
353 Ga0068858_100120797
354 Ga0068860_101655787
355 Ga0081455_10033790
356 Ga0070717_10001502
357 Ga0070717_10108621
358 Ga0070717_10580991
359 Ga0070717_10834898
360 Ga0075432_10012258
361 Ga0070715_10000042
362 Ga0070715_10124375
363 Ga0070715_10125075
364 Ga0070715_10182598
365 Ga0070715_10594423
366 Ga0070715_10600958
367 Ga0070716_100012992
368 Ga0070716_100245367
369 Ga0070716_100394402
370 Ga0070716_101127885
371 Ga0070716_101270417
372 Ga0070712_100015638
373 Ga0070712_100250740
374 Ga0070712_100359706
375 Ga0070712_100508405
376 Ga0075428_100051924
377 Ga0075428_100994696
378 Ga0075428_101203851
379 Ga0075431_100029881
380 Ga0075433_10002905
381 Ga0075433_10036024
382 Ga0075433_10036803
383 Ga0075433_10055195
384 Ga0075433_10065362
385 Ga0075433_10184559
386 Ga0075433_10252171
387 Ga0075433_10271618
388 Ga0075433_10410270
389 Ga0075433_10770222
390 Ga0075434_100008726
391 Ga0075434_100011223
392 Ga0075434_100021983
393 Ga0075434_100023560
394 Ga0075434_100036751
395 Ga0075434_100070670
396 Ga0075434_100387019
397 Ga0075434_100839392
398 Ga0075429_100130139
399 Ga0075429_100261818
400 Ga0068865_100248377
401 Ga0075436_100094439
402 Ga0075436_100129129
403 Ga0075436_100194808
404 Ga0075436_100710932
405 Ga0097620_100258535
406 Ga0075435_100010292
407 Ga0075435_100011467
408 Ga0075435_100127010
409 Ga0075435_100279696
410 Ga0075435_100550067
411 Ga0075435_100672387
412 Ga0099794_10055134
413 Ga0099794_10092524
414 Ga0099794_10366694
415 Ga0111539_10080708
416 Ga0111539_10730940
417 Ga0111539_10772761
418 Ga0105245_10338983
419 Ga0114129_10004290
420 Ga0114129_10054085
421 Ga0114129_10111518
422 Ga0114129_10311679
423 Ga0114129_10366956
424 Ga0114129_10377648
425 Ga0114129_10586865
426 Ga0114129_10840072
427 Ga0114129_11050842
428 Ga0114129_11827329
429 Ga0105242_10314355
430 Ga0105248_10160538
431 Ga0105249_13244330
432 Ga0099796_10066367
433 Ga0099796_10163225
434 Ga0157346_1013927
435 Ga0157378_10485147
436 Ga0157378_10793056
437 Ga0157378_11597688
438 Ga0157378_11838518
439 Ga0163162_10020658
440 Ga0163162_10100913
441 Ga0163162_10765591
442 Ga0157375_11872999
443 Ga0157377_11520905
444 Ga0157376_11327622
445 Ga0163161_10025269
446 Ga0163161_10306673
447 Ga0163161_10915493
448 Ga0207692_10026606
449 Ga0207692_10134142
450 Ga0207692_10173381
451 Ga0207692_10319287
452 Ga0207685_10000040
453 Ga0207685_10311925
454 Ga0207685_10489227
455 Ga0207699_10145099
456 Ga0207684_10012903
457 Ga0207684_10040032
458 Ga0207684_10123278
459 Ga0207684_10171610
460 Ga0207684_10546179
461 Ga0207684_10623906
462 Ga0207693_10014674
463 Ga0207693_10031071
464 Ga0207693_10051819
465 Ga0207693_10246879
466 Ga0207693_10281616
467 Ga0207693_10527317
468 Ga0207693_11032385
469 Ga0207663_10548908
470 Ga0207663_10673660
471 Ga0207646_10000118
472 Ga0207646_10082793
473 Ga0207646_10110987
474 Ga0207646_10156831
475 Ga0207646_10427966
476 Ga0207646_10684219
477 Ga0207687_10168886
478 Ga0207700_10367016
479 Ga0207664_10057863
480 Ga0207664_10089671
481 Ga0207664_10517644
482 Ga0207644_10362764
483 Ga0207706_10299000
484 Ga0207686_10048761
485 Ga0207665_10023434
486 Ga0207665_10031715
487 Ga0207665_10086880
488 Ga0207711_10956971
489 Ga0207668_10087513
490 Ga0207708_10002332
491 Ga0207641_10588289
492 Ga0207675_101918215
493 Ga0207428_10050427
494 Ga0265354_1005196
495 Ga0268264_11409968
496 Ga0265334_10004821
497 Ga0307513_10095778
498 Ga0307508_10000029
499 Ga0307514_10421292
500 Ga0373949_0055824
501 Ga0373941_0506471
502 Ga0373960_0044114
503 Ga0373931_0117637
504 Ga0373927_0368589
505 Ga0242420_066127
506 Ga0451577_0181519
507 Ga0451577_0844772
508 Ga0453683_0023319
509 Ga0453683_0423352
510 Ga0453684_0019348
511 Ga0451576_0093615
512 Ga0495584_0292659
513 Ga0495644_0325923
514 Ga0495665_0143668
515 Ga0495658_0215517
516 Ga0496101_0135754
517 Ga0496106_1196550
518 Ga0496114_0056615
519 Ga0496115_0170509
520 Ga0496115_1006657
521 nmdc:mga05p37_1432638_c1
522 nmdc:mga05p37_184314_c1
523 nmdc:mga05p37_46224_c1
524 nmdc:mga05p37_48078_c1
525 nmdc:mga05p37_4897_c1
526 nmdc:mga05p37_544096_c1
527 nmdc:mga05p37_677747_c1
528 nmdc:mga09592_275060_c1
529 nmdc:mga06r32_1010190_c1
530 nmdc:mga06r32_75059_c1
531 nmdc:mga08y16_92307_c1
532 nmdc:mga0n895_15423_c1
533 nmdc:mga0n895_178769_c1
534 nmdc:mga0n895_21850_c1
535 nmdc:mga0n895_242126_c1
536 nmdc:mga0n895_34262_c1
537 nmdc:mga0n895_38957_c1
538 nmdc:mga0n895_5555_c1
539 nmdc:mga0n895_718258_c1
540 nmdc:mga0rr50_21711_c1
541 nmdc:mga0rr50_416625_c1
542 nmdc:mga0rr50_50571_c1
543 nmdc:mga0rr50_509539_c1
544 nmdc:mga0rr50_521689_c1
545 nmdc:mga0rr50_6895_c1
546 nmdc:mga08x19_12466_c1
547 nmdc:mga08x19_266154_c1
548 nmdc:mga08x19_678128_c1
549 nmdc:mga08x19_73503_c1
550 nmdc:mga0a205_181296_c1
551 nmdc:mga0a205_197766_c2
552 nmdc:mga0a205_202397_c1
553 nmdc:mga0a205_297662_c1
554 nmdc:mga0a205_346646_c1
555 nmdc:mga0a205_362959_c1
556 nmdc:mga0a205_48751_c2
557 nmdc:mga0a205_487594_c1
558 nmdc:mga0a205_587647_c1
559 nmdc:mga0a205_66667_c1
560 nmdc:mga0a205_676329_c1
561 nmdc:mga0a205_682113_c1
562 nmdc:mga0a205_752_c1
563 nmdc:mga0a205_822561_c1
564 Ga0500616_0002197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

10

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mws-assembly1.cif.gz_A structure of nitrocefin acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.00 a resolution. 0.6965 82 140
3a76-assembly1.cif.gz_A the crystal structure of lina 0.6961 11 148
5kvb-assembly1.cif.gz_A the crystal structure of hexachlorocyclohexane dehydrochlorinase lina-type3 from novosphingobium barchaimii ll02 0.6959 11 151
7sjy-assembly2.cif.gz_B crystal structure of clostridium thermocellum rsgi9 s1c-ntf2 bi-domain 0.6903 63 144
5m18-assembly1.cif.gz_A crystal structure of pbp2a from mrsa in the presence of cefepime ligand 0.6898 82 140
ID Description Score Start End Superfamily
af_Q05704_217_345_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.8111 83 153 3.15.10.10
af_P9WM01_47_220_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.735 66 144 3.40.630.30
af_O53973_67_188_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7287 70 142 3.10.450.50
af_O53651_117_225_3.10.450.230 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.7286 66 142 3.10.450.230
af_I6YGA5_49_159_3.10.450.230 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.7253 65 142 3.10.450.230
ID Description Score Start End GO Terms
AF-A0A7X6AR38-F1-model_v4 Nuclear transport factor 2 family protein 0.9395 77 154
AF-A0A537AR22-F1-model_v4 Nuclear transport factor 2 family protein 0.9096 81 151
AF-A0A6P1PIA5-F1-model_v4 deleted 0.9076 81 154
AF-A0A4V1B0E6-F1-model_v4 SnoaL-like domain-containing protein 0.9069 84 154
AF-X8C645-F1-model_v4 deleted 0.9003 80 151

Map