F384801

General Info

Members Datasets Scaffolds Average Seq Length
282 172 564 96

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100687270|Ga0070698_1006872702
Length 114
Sequence MPCLKEQYLILADKDDDVIPERDPEGNETRHLHNLVEFANPSVLEIGCGDGRLTRRYAAFARQIAAIDPDPVRLTTAVENHPASLTHVNFVQAYAEALPFPSEKFDLALLAWSL

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 6.74
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 27.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100687270 3300005471 Bacteria 965
2 JGI24746J21847_1035161 3300001977 Unclassified 693
3 Ga0065712_10198356 3300005290 Unclassified 1118
4 Ga0065707_10366635 3300005295 Unclassified 896
5 Ga0070690_100024454 3300005330 Bacteria 3713
6 Ga0070690_100189510 3300005330 Bacteria 1425
7 Ga0070670_100830313 3300005331 Unclassified 835
8 Ga0070666_10010997 3300005335 Bacteria 5671
9 Ga0070666_10100892 3300005335 Bacteria 1989
10 Ga0068868_100126760 3300005338 Bacteria 2086
11 Ga0070687_100078121 3300005343 Bacteria 1798
12 Ga0070661_100262405 3300005344 Bacteria 1336
13 Ga0070669_101097260 3300005353 Bacteria 685
14 Ga0070675_100739315 3300005354 Bacteria 897
15 Ga0070675_100740892 3300005354 Bacteria 896
16 Ga0070675_101470334 3300005354 Unclassified 628
17 Ga0070671_100230353 3300005355 Unclassified 1572
18 Ga0070671_101958671 3300005355 Bacteria 521
19 Ga0070673_100507746 3300005364 Unclassified 1091
20 Ga0070688_100354390 3300005365 Bacteria 1075
21 Ga0070688_101006068 3300005365 Unclassified 662
22 Ga0070659_100991416 3300005366 Unclassified 737
23 Ga0070667_100527601 3300005367 Unclassified 1084
24 Ga0070703_10000371 3300005406 Bacteria 19262
25 Ga0070705_100046986 3300005440 Bacteria 2492
26 Ga0070705_101239829 3300005440 Unclassified 616
27 Ga0070700_101653884 3300005441 Bacteria 548
28 Ga0070694_100081379 3300005444 Bacteria 2253
29 Ga0070694_101281618 3300005444 Unclassified 616
30 Ga0070708_100109692 3300005445 Bacteria 2535
31 Ga0070708_100331596 3300005445 Unclassified 1434
32 Ga0070708_101805220 3300005445 Unclassified 567
33 Ga0070708_101885819 3300005445 Unclassified 554
34 Ga0070678_101539771 3300005456 Bacteria 623
35 Ga0070707_100012120 3300005468 Bacteria 8048
36 Ga0070707_100469161 3300005468 Bacteria 1220
37 Ga0070707_100685595 3300005468 Bacteria 987
38 Ga0070707_100795277 3300005468 Unclassified 910
39 Ga0070698_100132643 3300005471 Bacteria 2446
40 Ga0070698_100138659 3300005471 Bacteria 2385
41 Ga0070698_100248169 3300005471 Bacteria 1713
42 Ga0070698_101097542 3300005471 Bacteria 744
43 Ga0070684_100431766 3300005535 Bacteria 1216
44 Ga0070684_101725097 3300005535 Bacteria 591
45 Ga0070697_100383693 3300005536 Bacteria 1217
46 Ga0070672_100857157 3300005543 Bacteria 801
47 Ga0070686_100001271 3300005544 Bacteria 14282
48 Ga0070686_100072309 3300005544 Unclassified 2261
49 Ga0070695_100002512 3300005545 Bacteria 10575
50 Ga0070695_100506862 3300005545 Bacteria 934
51 Ga0070695_101346394 3300005545 Unclassified 591
52 Ga0070696_100280342 3300005546 Bacteria 1270
53 Ga0070665_100007825 3300005548 Bacteria 10841
54 Ga0070704_100020835 3300005549 Bacteria 4238
55 Ga0070704_100076378 3300005549 Bacteria 2450
56 Ga0070704_100592096 3300005549 Bacteria 974
57 Ga0068855_100246695 3300005563 Unclassified 1993
58 Ga0070664_100428851 3300005564 Bacteria 1212
59 Ga0070664_100566313 3300005564 Archaea 1052
60 Ga0068857_101095733 3300005577 Bacteria 769
61 Ga0068854_100085241 3300005578 Bacteria 2339
62 Ga0068854_100187990 3300005578 Unclassified 1617
63 Ga0068864_100015335 3300005618 Bacteria 6370
64 Ga0068864_100678910 3300005618 Unclassified 1005
65 Ga0068864_101119407 3300005618 Bacteria 784
66 Ga0068851_10072155 3300005834 Bacteria 1788
67 Ga0068863_100005374 3300005841 Bacteria 12631
68 Ga0068863_100066971 3300005841 Bacteria 3397
69 Ga0068863_100305727 3300005841 Bacteria 1543
70 Ga0068863_100949368 3300005841 Unclassified 861
71 Ga0068858_100092781 3300005842 Bacteria 2810
72 Ga0068858_100285672 3300005842 Bacteria 1571
73 Ga0068860_100136221 3300005843 Bacteria 2358
74 Ga0068860_100187448 3300005843 Bacteria 2001
75 Ga0068860_101339218 3300005843 Unclassified 737
76 Ga0068860_102596425 3300005843 Unclassified 526
77 Ga0081455_10024575 3300005937 Bacteria 5577
78 Ga0070712_100092238 3300006175 Bacteria 2221
79 Ga0075367_10610249 3300006178 Unclassified 693
80 Ga0068871_100111337 3300006358 Bacteria 2303
81 Ga0075431_100038989 3300006847 Bacteria 4894
82 Ga0075433_10015330 3300006852 Bacteria 6283
83 Ga0075433_10162170 3300006852 Unclassified 1990
84 Ga0075433_10725097 3300006852 Unclassified 870
85 Ga0075433_11551203 3300006852 Bacteria 572
86 Ga0075434_100189471 3300006871 Bacteria 2077
87 Ga0075434_100233246 3300006871 Unclassified 1860
88 Ga0075434_100338202 3300006871 Bacteria 1526
89 Ga0075434_100591073 3300006871 Bacteria 1129
90 Ga0075429_101173369 3300006880 Bacteria 670
91 Ga0075429_101562479 3300006880 Unclassified 574
92 Ga0075436_100542991 3300006914 Bacteria 853
93 Ga0075435_100000648 3300007076 Bacteria 21430
94 Ga0075435_100585518 3300007076 Bacteria 967
95 Ga0105251_10489724 3300009011 Bacteria 573
96 Ga0105240_10486666 3300009093 Unclassified 1374
97 Ga0105240_10874727 3300009093 Bacteria 968
98 Ga0111539_10100966 3300009094 Bacteria 3387
99 Ga0111539_10426164 3300009094 Bacteria 1545
100 Ga0105245_10009286 3300009098 Bacteria 8575
101 Ga0105247_10002359 3300009101 Bacteria 12865
102 Ga0114129_10003522 3300009147 Bacteria 22030
103 Ga0114129_10004598 3300009147 Bacteria 19482
104 Ga0114129_10013828 3300009147 Bacteria 11499
105 Ga0114129_10016163 3300009147 Bacteria 10620
106 Ga0114129_10054285 3300009147 Bacteria 5618
107 Ga0114129_10302199 3300009147 Bacteria 2132
108 Ga0105241_10106800 3300009174 Bacteria 2235
109 Ga0105241_10491553 3300009174 Bacteria 1093
110 Ga0105242_10013369 3300009176 Bacteria 6341
111 Ga0105248_10009412 3300009177 Bacteria 10756
112 Ga0105248_10040837 3300009177 Bacteria 5201
113 Ga0105248_10321987 3300009177 Unclassified 1741
114 Ga0105248_10438450 3300009177 Bacteria 1471
115 Ga0105248_11263830 3300009177 Unclassified 835
116 Ga0105249_10284334 3300009553 Bacteria 1653
117 Ga0105249_11251340 3300009553 Bacteria 813
118 Ga0105239_10703675 3300010375 Bacteria 1155
119 Ga0105239_11410222 3300010375 Unclassified 804
120 Ga0105246_10207059 3300011119 Unclassified 1529
121 Ga0157374_10021295 3300013296 Bacteria 5767
122 Ga0157378_11385933 3300013297 Unclassified 746
123 Ga0163162_11207095 3300013306 Bacteria 858
124 Ga0163162_12761556 3300013306 Unclassified 565
125 Ga0157375_13380354 3300013308 Unclassified 532
126 Ga0163163_10067636 3300014325 Bacteria 3552
127 Ga0163163_10133959 3300014325 Bacteria 2518
128 Ga0157380_10005286 3300014326 Bacteria 9030
129 Ga0157380_11174952 3300014326 Bacteria 810
130 Ga0157377_10085576 3300014745 Unclassified 1851
131 Ga0157379_10024174 3300014968 Bacteria 5393
132 Ga0157379_10164600 3300014968 Bacteria 2002
133 Ga0157376_10008974 3300014969 Bacteria 7240
134 Ga0182007_10042823 3300015262 Unclassified 1506
135 Ga0182005_1168139 3300015265 Bacteria 646
136 Ga0163161_11752374 3300017792 Unclassified 551
137 Ga0207653_10000238 3300025885 Bacteria 36578
138 Ga0207710_10021450 3300025900 Bacteria 2768
139 Ga0207688_10515950 3300025901 Bacteria 749
140 Ga0207680_10041912 3300025903 Bacteria 2675
141 Ga0207654_10122801 3300025911 Bacteria 1633
142 Ga0207654_10266799 3300025911 Bacteria 1153
143 Ga0207695_10418364 3300025913 Unclassified 1224
144 Ga0207695_10618272 3300025913 Bacteria 964
145 Ga0207662_10082032 3300025918 Bacteria 1969
146 Ga0207649_10209631 3300025920 Bacteria 1381
147 Ga0207646_10012146 3300025922 Bacteria 8285
148 Ga0207646_10024956 3300025922 Bacteria 5469
149 Ga0207646_10369776 3300025922 Bacteria 1295
150 Ga0207681_11609355 3300025923 Unclassified 544
151 Ga0207659_10002454 3300025926 Bacteria 11059
152 Ga0207659_10475287 3300025926 Bacteria 1055
153 Ga0207659_10540538 3300025926 Unclassified 990
154 Ga0207659_10664731 3300025926 Bacteria 891
155 Ga0207659_11001915 3300025926 Bacteria 719
156 Ga0207687_10415157 3300025927 Unclassified 1110
157 Ga0207644_10110465 3300025931 Unclassified 2078
158 Ga0207690_10884493 3300025932 Unclassified 740
159 Ga0207686_10008931 3300025934 Bacteria 5422
160 Ga0207670_10186923 3300025936 Unclassified 1565
161 Ga0207669_10078110 3300025937 Unclassified 2108
162 Ga0207711_10029732 3300025941 Bacteria 4609
163 Ga0207711_10264036 3300025941 Bacteria 1583
164 Ga0207711_10303062 3300025941 Unclassified 1474
165 Ga0207711_10318557 3300025941 Bacteria 1437
166 Ga0207689_10038930 3300025942 Bacteria 3937
167 Ga0207679_10368651 3300025945 Bacteria 1256
168 Ga0207667_11012136 3300025949 Unclassified 818
169 Ga0207651_10210804 3300025960 Bacteria 1564
170 Ga0207712_11505655 3300025961 Unclassified 603
171 Ga0207640_10033124 3300025981 Bacteria 3211
172 Ga0207640_10071227 3300025981 Bacteria 2340
173 Ga0207677_10507051 3300026023 Unclassified 1044
174 Ga0207703_10012666 3300026035 Bacteria 6576
175 Ga0207703_10201898 3300026035 Bacteria 1767
176 Ga0207639_10492844 3300026041 Bacteria 1118
177 Ga0207708_11627454 3300026075 Bacteria 567
178 Ga0207641_10007441 3300026088 Bacteria 9108
179 Ga0207641_10039996 3300026088 Bacteria 3923
180 Ga0207641_11539508 3300026088 Bacteria 667
181 Ga0207676_10082717 3300026095 Bacteria 2612
182 Ga0207674_10175117 3300026116 Unclassified 2098
183 Ga0207674_11621083 3300026116 Unclassified 616
184 Ga0207683_10926610 3300026121 Bacteria 809
185 Ga0207428_10068160 3300027907 Bacteria 2799
186 Ga0268266_10019084 3300028379 Bacteria 5839
187 Ga0268265_10640159 3300028380 Bacteria 1021
188 Ga0268265_11918033 3300028380 Unclassified 599
189 Ga0268264_10210989 3300028381 Bacteria 1783
190 Ga0268264_10323101 3300028381 Bacteria 1460
191 Ga0268264_11988256 3300028381 Unclassified 591
192 Ga0316575_10135139 3300031665 Bacteria 1013
193 Ga0316579_10275686 3300031691 Bacteria 813
194 Ga0316576_10121622 3300031727 Bacteria 1960
195 Ga0316578_10302287 3300031728 Bacteria 956
196 Ga0316583_10041444 3300032133 Bacteria 1630
197 Ga0316580_10118063 3300032139 Bacteria 812
198 Ga0316596_1051359 3300033541 Unclassified 1091
199 Ga0373930_0001130 3300034816 Bacteria 3885
200 Ga0373948_0001233 3300034817 Bacteria 3486
201 Ga0373950_0000994 3300034818 Bacteria 3591
202 Ga0373958_0003246 3300034819 Unclassified 2334
203 Ga0373959_0015188 3300034820 Bacteria 1411
204 Ga0373938_0000384 3300034957 Bacteria 7096
205 Ga0373928_0004347 3300035084 Unclassified 2701
206 Ga0373929_0001154 3300035085 Bacteria 5110
207 Ga0373929_0072316 3300035085 Unclassified 827
208 Ga0373940_0002837 3300035088 Bacteria 3445
209 Ga0373949_0003026 3300035090 Bacteria 4129
210 Ga0373951_0000324 3300035091 Bacteria 14868
211 Ga0373952_0005539 3300035092 Bacteria 2311
212 Ga0373952_0035327 3300035092 Bacteria 1131
213 Ga0373932_0001694 3300035112 Bacteria 5998
214 Ga0373939_0000186 3300035114 Bacteria 17245
215 Ga0373941_0000502 3300035115 Bacteria 7830
216 Ga0373941_0224246 3300035115 Bacteria 724
217 Ga0373960_0000900 3300035121 Bacteria 6317
218 Ga0373942_0000983 3300035207 Bacteria 7742
219 Ga0373961_0000673 3300035241 Bacteria 12117
220 Ga0373962_0000560 3300035242 Bacteria 8381
221 Ga0373962_0034481 3300035242 Bacteria 1402
222 Ga0316574_0112755 3300035398 Bacteria 1743
223 Ga0316574_0501801 3300035398 Unclassified 756
224 Ga0316574_0723654 3300035398 Unclassified 609
225 Ga0373931_0002253 3300035691 Bacteria 8523
226 Ga0373931_0050361 3300035691 Bacteria 2216
227 Ga0316582_0043516 3300036647 Bacteria 2817
228 Ga0316582_1023857 3300036647 Unclassified 563
229 Ga0316584_0162187 3300036712 Bacteria 1660
230 Ga0316584_0368442 3300036712 Bacteria 1028
231 Ga0395905_1346004 3300037471 Bacteria 618
232 Ga0395901_1121228 3300038443 Bacteria 756
233 Ga0395901_1409083 3300038443 Bacteria 655
234 Ga0439441_050701 3300042001 Unclassified 854
235 Ga0453684_0243943 3300044712 Unclassified 2067
236 Ga0451576_0223259 3300045051 Bacteria 1967
237 Ga0451576_2698740 3300045051 Unclassified 506
238 Ga0495585_0467436 3300046492 Bacteria 602
239 Ga0495621_0001836 3300046539 Bacteria 5583
240 Ga0495669_0353473 3300046684 Unclassified 710
241 Ga0495670_0296718 3300046691 Unclassified 866
242 Ga0496101_0896704 3300048904 Bacteria 698
243 Ga0496102_1412600 3300048905 Unclassified 615
244 Ga0496103_0470276 3300048906 Unclassified 806
245 Ga0496103_0832450 3300048906 Unclassified 581
246 Ga0496104_0369749 3300048907 Archaea 1346
247 Ga0496105_0811858 3300048908 Bacteria 710
248 Ga0496106_0147212 3300048909 Bacteria 1856
249 Ga0496106_0487827 3300048909 Bacteria 990
250 Ga0496107_0696659 3300048910 Bacteria 747
251 Ga0496108_0176138 3300048911 Unclassified 1851
252 Ga0496109_0521637 3300048912 Unclassified 1121
253 Ga0496109_1454381 3300048912 Bacteria 620
254 Ga0496110_1920343 3300048913 Viruses 502
255 Ga0496111_0876544 3300048914 Bacteria 647
256 Ga0496112_0009449 3300048915 Bacteria 8789
257 Ga0496112_0578217 3300048915 Bacteria 1056
258 Ga0496112_0712372 3300048915 Unclassified 931
259 Ga0496113_0193356 3300048916 Bacteria 1615
260 Ga0496115_0146775 3300048918 Bacteria 1947
261 Ga0501072_0133709 3300049588 Bacteria 1978
262 nmdc:mga05p37_115085_c1 3300050507 Bacteria 3306
263 nmdc:mga05p37_12210_c1 3300050507 Bacteria 10256
264 nmdc:mga05p37_1425557_c1 3300050507 Bacteria 696
265 nmdc:mga05p37_675071_c1 3300050507 Unclassified 1153
266 nmdc:mga05p37_728522_c1 3300050507 Bacteria 1097
267 nmdc:mga05p37_80710_c1 3300050507 Bacteria 4007
268 nmdc:mga06r32_17687_c1 3300050510 Bacteria 6512
269 nmdc:mga08y16_215737_c1 3300050511 Bacteria 1987
270 nmdc:mga0n895_1326639_c1 3300050512 Bacteria 690
271 nmdc:mga0n895_1329292_c1 3300050512 Unclassified 689
272 nmdc:mga0n895_450403_c1 3300050512 Bacteria 1300
273 nmdc:mga0n895_535982_c1 3300050512 Bacteria 1177
274 nmdc:mga0rr50_104290_c1 3300050513 Unclassified 2233
275 nmdc:mga0rr50_2311_c1 3300050513 Bacteria 10693
276 nmdc:mga0rr50_561043_c1 3300050513 Bacteria 972
277 nmdc:mga08x19_1168486_c1 3300050514 Bacteria 546
278 nmdc:mga08x19_901400_c1 3300050514 Unclassified 628
279 nmdc:mga0a205_345454_c1 3300050515 Bacteria 1356
280 nmdc:mga0a205_421471_c1 3300050515 Bacteria 1197
281 nmdc:mga0a205_442338_c1 3300050515 Bacteria 1160
282 nmdc:mga0a205_53354_c1 3300050515 Bacteria 3902
283 Ga0070698_100687270
284 JGI24746J21847_1035161
285 Ga0065712_10198356
286 Ga0065707_10366635
287 Ga0070690_100024454
288 Ga0070690_100189510
289 Ga0070670_100830313
290 Ga0070666_10010997
291 Ga0070666_10100892
292 Ga0068868_100126760
293 Ga0070687_100078121
294 Ga0070661_100262405
295 Ga0070669_101097260
296 Ga0070675_100739315
297 Ga0070675_100740892
298 Ga0070675_101470334
299 Ga0070671_100230353
300 Ga0070671_101958671
301 Ga0070673_100507746
302 Ga0070688_100354390
303 Ga0070688_101006068
304 Ga0070659_100991416
305 Ga0070667_100527601
306 Ga0070703_10000371
307 Ga0070705_100046986
308 Ga0070705_101239829
309 Ga0070700_101653884
310 Ga0070694_100081379
311 Ga0070694_101281618
312 Ga0070708_100109692
313 Ga0070708_100331596
314 Ga0070708_101805220
315 Ga0070708_101885819
316 Ga0070678_101539771
317 Ga0070707_100012120
318 Ga0070707_100469161
319 Ga0070707_100685595
320 Ga0070707_100795277
321 Ga0070698_100132643
322 Ga0070698_100138659
323 Ga0070698_100248169
324 Ga0070698_101097542
325 Ga0070684_100431766
326 Ga0070684_101725097
327 Ga0070697_100383693
328 Ga0070672_100857157
329 Ga0070686_100001271
330 Ga0070686_100072309
331 Ga0070695_100002512
332 Ga0070695_100506862
333 Ga0070695_101346394
334 Ga0070696_100280342
335 Ga0070665_100007825
336 Ga0070704_100020835
337 Ga0070704_100076378
338 Ga0070704_100592096
339 Ga0068855_100246695
340 Ga0070664_100428851
341 Ga0070664_100566313
342 Ga0068857_101095733
343 Ga0068854_100085241
344 Ga0068854_100187990
345 Ga0068864_100015335
346 Ga0068864_100678910
347 Ga0068864_101119407
348 Ga0068851_10072155
349 Ga0068863_100005374
350 Ga0068863_100066971
351 Ga0068863_100305727
352 Ga0068863_100949368
353 Ga0068858_100092781
354 Ga0068858_100285672
355 Ga0068860_100136221
356 Ga0068860_100187448
357 Ga0068860_101339218
358 Ga0068860_102596425
359 Ga0081455_10024575
360 Ga0070712_100092238
361 Ga0075367_10610249
362 Ga0068871_100111337
363 Ga0075431_100038989
364 Ga0075433_10015330
365 Ga0075433_10162170
366 Ga0075433_10725097
367 Ga0075433_11551203
368 Ga0075434_100189471
369 Ga0075434_100233246
370 Ga0075434_100338202
371 Ga0075434_100591073
372 Ga0075429_101173369
373 Ga0075429_101562479
374 Ga0075436_100542991
375 Ga0075435_100000648
376 Ga0075435_100585518
377 Ga0105251_10489724
378 Ga0105240_10486666
379 Ga0105240_10874727
380 Ga0111539_10100966
381 Ga0111539_10426164
382 Ga0105245_10009286
383 Ga0105247_10002359
384 Ga0114129_10003522
385 Ga0114129_10004598
386 Ga0114129_10013828
387 Ga0114129_10016163
388 Ga0114129_10054285
389 Ga0114129_10302199
390 Ga0105241_10106800
391 Ga0105241_10491553
392 Ga0105242_10013369
393 Ga0105248_10009412
394 Ga0105248_10040837
395 Ga0105248_10321987
396 Ga0105248_10438450
397 Ga0105248_11263830
398 Ga0105249_10284334
399 Ga0105249_11251340
400 Ga0105239_10703675
401 Ga0105239_11410222
402 Ga0105246_10207059
403 Ga0157374_10021295
404 Ga0157378_11385933
405 Ga0163162_11207095
406 Ga0163162_12761556
407 Ga0157375_13380354
408 Ga0163163_10067636
409 Ga0163163_10133959
410 Ga0157380_10005286
411 Ga0157380_11174952
412 Ga0157377_10085576
413 Ga0157379_10024174
414 Ga0157379_10164600
415 Ga0157376_10008974
416 Ga0182007_10042823
417 Ga0182005_1168139
418 Ga0163161_11752374
419 Ga0207653_10000238
420 Ga0207710_10021450
421 Ga0207688_10515950
422 Ga0207680_10041912
423 Ga0207654_10122801
424 Ga0207654_10266799
425 Ga0207695_10418364
426 Ga0207695_10618272
427 Ga0207662_10082032
428 Ga0207649_10209631
429 Ga0207646_10012146
430 Ga0207646_10024956
431 Ga0207646_10369776
432 Ga0207681_11609355
433 Ga0207659_10002454
434 Ga0207659_10475287
435 Ga0207659_10540538
436 Ga0207659_10664731
437 Ga0207659_11001915
438 Ga0207687_10415157
439 Ga0207644_10110465
440 Ga0207690_10884493
441 Ga0207686_10008931
442 Ga0207670_10186923
443 Ga0207669_10078110
444 Ga0207711_10029732
445 Ga0207711_10264036
446 Ga0207711_10303062
447 Ga0207711_10318557
448 Ga0207689_10038930
449 Ga0207679_10368651
450 Ga0207667_11012136
451 Ga0207651_10210804
452 Ga0207712_11505655
453 Ga0207640_10033124
454 Ga0207640_10071227
455 Ga0207677_10507051
456 Ga0207703_10012666
457 Ga0207703_10201898
458 Ga0207639_10492844
459 Ga0207708_11627454
460 Ga0207641_10007441
461 Ga0207641_10039996
462 Ga0207641_11539508
463 Ga0207676_10082717
464 Ga0207674_10175117
465 Ga0207674_11621083
466 Ga0207683_10926610
467 Ga0207428_10068160
468 Ga0268266_10019084
469 Ga0268265_10640159
470 Ga0268265_11918033
471 Ga0268264_10210989
472 Ga0268264_10323101
473 Ga0268264_11988256
474 Ga0316575_10135139
475 Ga0316579_10275686
476 Ga0316576_10121622
477 Ga0316578_10302287
478 Ga0316583_10041444
479 Ga0316580_10118063
480 Ga0316596_1051359
481 Ga0373930_0001130
482 Ga0373948_0001233
483 Ga0373950_0000994
484 Ga0373958_0003246
485 Ga0373959_0015188
486 Ga0373938_0000384
487 Ga0373928_0004347
488 Ga0373929_0001154
489 Ga0373929_0072316
490 Ga0373940_0002837
491 Ga0373949_0003026
492 Ga0373951_0000324
493 Ga0373952_0005539
494 Ga0373952_0035327
495 Ga0373932_0001694
496 Ga0373939_0000186
497 Ga0373941_0000502
498 Ga0373941_0224246
499 Ga0373960_0000900
500 Ga0373942_0000983
501 Ga0373961_0000673
502 Ga0373962_0000560
503 Ga0373962_0034481
504 Ga0316574_0112755
505 Ga0316574_0501801
506 Ga0316574_0723654
507 Ga0373931_0002253
508 Ga0373931_0050361
509 Ga0316582_0043516
510 Ga0316582_1023857
511 Ga0316584_0162187
512 Ga0316584_0368442
513 Ga0395905_1346004
514 Ga0395901_1121228
515 Ga0395901_1409083
516 Ga0439441_050701
517 Ga0453684_0243943
518 Ga0451576_0223259
519 Ga0451576_2698740
520 Ga0495585_0467436
521 Ga0495621_0001836
522 Ga0495669_0353473
523 Ga0495670_0296718
524 Ga0496101_0896704
525 Ga0496102_1412600
526 Ga0496103_0470276
527 Ga0496103_0832450
528 Ga0496104_0369749
529 Ga0496105_0811858
530 Ga0496106_0147212
531 Ga0496106_0487827
532 Ga0496107_0696659
533 Ga0496108_0176138
534 Ga0496109_0521637
535 Ga0496109_1454381
536 Ga0496110_1920343
537 Ga0496111_0876544
538 Ga0496112_0009449
539 Ga0496112_0578217
540 Ga0496112_0712372
541 Ga0496113_0193356
542 Ga0496115_0146775
543 Ga0501072_0133709
544 nmdc:mga05p37_115085_c1
545 nmdc:mga05p37_12210_c1
546 nmdc:mga05p37_1425557_c1
547 nmdc:mga05p37_675071_c1
548 nmdc:mga05p37_728522_c1
549 nmdc:mga05p37_80710_c1
550 nmdc:mga06r32_17687_c1
551 nmdc:mga08y16_215737_c1
552 nmdc:mga0n895_1326639_c1
553 nmdc:mga0n895_1329292_c1
554 nmdc:mga0n895_450403_c1
555 nmdc:mga0n895_535982_c1
556 nmdc:mga0rr50_104290_c1
557 nmdc:mga0rr50_2311_c1
558 nmdc:mga0rr50_561043_c1
559 nmdc:mga08x19_1168486_c1
560 nmdc:mga08x19_901400_c1
561 nmdc:mga0a205_345454_c1
562 nmdc:mga0a205_421471_c1
563 nmdc:mga0a205_442338_c1
564 nmdc:mga0a205_53354_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

44

114

0.94

PF13649

Methyltransf_25

Methyltransferase domain

43

114

0.93

PF13847

Methyltransf_31

Methyltransferase domain

37

113

0.89

PF13489

Methyltransf_23

Methyltransferase domain

21

113

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.908 15 99
1xxl-assembly2.cif.gz_B the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution 0.9068 17 99
4krg-assembly2.cif.gz_B semet haemonchus contortus phosphoethanolamine n-methyltransferase 1 in complex with phosphoethanolamine and s-adenosylhomocysteine 0.9045 15 99
6wlf-assembly2.cif.gz_B phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.9032 15 99
2gs9-assembly1.cif.gz_B crystal structure of tt1324 from thermus thermophilis hb8 0.8961 18 99
ID Description Score Start End Superfamily
af_Q8BQJ6_333_493_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9241 33 80 3.40.50.150
af_A0A2R8QIW3_7_246_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9051 16 99 3.40.50.150
af_Q33AG7_179_362_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9002 33 99 3.40.50.150
af_Q8IHR1_96_382_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8971 32 73 3.40.50.150
af_A1Z909_427_794_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8965 30 82 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E8GVL9-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9371 13 101 GO:0008757
AF-A0A534S8W2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9354 29 99 GO:0008757
GO:0032259
AF-A0A7X9GDS1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9351 29 102 GO:0008757
GO:0032259
AF-A0A2V8D2F8-F1-model_v4 Methyltransferase domain-containing protein 0.9342 8 103
AF-A0A7V7ZI11-F1-model_v4 Class I SAM-dependent methyltransferase 0.9329 18 97 GO:0008168
GO:0032259

Map