F384390

General Info

Members Datasets Scaffolds Average Seq Length
281 174 562 257

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10016389|Ga0316575_100163892
Length 312
Sequence MRSRVSPWNPWIAENRYFDGFRARIQQNRYNAPPSVAPGTSRQEHFEAMELIDIGCNLTHDTFDADREQVLADARQAGVVQLIVTGASEDGSRMALELARRHPGVLYATAGVHPHHAADYTAETDALLRELAAHDEVVAVGETGLDYFRDFSPRDAQRAAFARQLRIGADTGLPLFLHLRDAHDDFHAMLSEHRAALSEVVVHCFTGSREEMLQYIELGCHIGITGWICDERRGTHMKDYLAEIPAERLMIETDAPYLKPRNLRPRVKSHRNEPRFLPWIAGTLAAVRDEHPERLAAQTTANARRFFRIAAP

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 4.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10016389 3300031665 Bacteria 2805
2 JGI25407J50210_10064511 3300003373 Bacteria 917
3 Ga0065707_10214644 3300005295 Bacteria 1250
4 Ga0070690_100082741 3300005330 Bacteria 2102
5 Ga0070670_100135596 3300005331 Bacteria 2127
6 Ga0070689_100000086 3300005340 Bacteria 54637
7 Ga0070689_100006635 3300005340 Bacteria 8039
8 Ga0070689_100038374 3300005340 Bacteria 3664
9 Ga0070691_10031173 3300005341 Bacteria 2499
10 Ga0070692_10257162 3300005345 Bacteria 1048
11 Ga0070668_100010041 3300005347 Bacteria 7016
12 Ga0070688_100000449 3300005365 Bacteria 20823
13 Ga0070688_100000869 3300005365 Bacteria 15022
14 Ga0070688_100002004 3300005365 Bacteria 10268
15 Ga0070667_100089386 3300005367 Bacteria 2646
16 Ga0070709_10002682 3300005434 Bacteria 9605
17 Ga0070714_100036633 3300005435 Bacteria 4115
18 Ga0070713_100020548 3300005436 Bacteria 5065
19 Ga0070713_100056332 3300005436 Bacteria 3270
20 Ga0070710_10002828 3300005437 Bacteria 8276
21 Ga0070701_10022724 3300005438 Unclassified 3010
22 Ga0070701_10120699 3300005438 Bacteria 1476
23 Ga0070711_100029777 3300005439 Bacteria 3607
24 Ga0070700_100131958 3300005441 Bacteria 1687
25 Ga0070694_100055194 3300005444 Bacteria 2694
26 Ga0070694_100538576 3300005444 Bacteria 933
27 Ga0070708_100070720 3300005445 Bacteria 3140
28 Ga0070663_100000699 3300005455 Bacteria 18083
29 Ga0068867_100066244 3300005459 Bacteria 2690
30 Ga0070685_10000432 3300005466 Bacteria 24501
31 Ga0070685_10037897 3300005466 Bacteria 2732
32 Ga0070685_10225356 3300005466 Unclassified 1230
33 Ga0070706_100023590 3300005467 Bacteria 5665
34 Ga0070706_100146748 3300005467 Bacteria 2203
35 Ga0070707_100002286 3300005468 Bacteria 18310
36 Ga0070707_100062064 3300005468 Bacteria 3585
37 Ga0070698_100003103 3300005471 Bacteria 18310
38 Ga0070698_100013440 3300005471 Bacteria 8666
39 Ga0070698_100041669 3300005471 Bacteria 4714
40 Ga0070698_100060383 3300005471 Bacteria 3826
41 Ga0068853_100009129 3300005539 Bacteria 7987
42 Ga0070686_100056935 3300005544 Bacteria 2509
43 Ga0070695_100001208 3300005545 Bacteria 14201
44 Ga0070695_100500235 3300005545 Unclassified 940
45 Ga0070696_100221151 3300005546 Bacteria 1421
46 Ga0070665_100000053 3300005548 Bacteria 244523
47 Ga0070704_100032653 3300005549 Bacteria 3513
48 Ga0070704_100037945 3300005549 Bacteria 3296
49 Ga0070704_100142801 3300005549 Bacteria 1871
50 Ga0070704_100335373 3300005549 Bacteria 1272
51 Ga0068855_100149153 3300005563 Bacteria 2659
52 Ga0068857_100015059 3300005577 Bacteria 6750
53 Ga0068859_100071671 3300005617 Bacteria 3501
54 Ga0068859_100153085 3300005617 Bacteria 2382
55 Ga0068859_100213768 3300005617 Bacteria 2015
56 Ga0068863_100129096 3300005841 Bacteria 2413
57 Ga0068863_100450460 3300005841 Unclassified 1263
58 Ga0068862_100384769 3300005844 Unclassified 1309
59 Ga0081538_10000369 3300005981 Bacteria 51269
60 Ga0081538_10006025 3300005981 Bacteria 10776
61 Ga0081538_10017081 3300005981 Bacteria 5527
62 Ga0081538_10036193 3300005981 Bacteria 3226
63 Ga0081539_10001616 3300005985 Bacteria 36968
64 Ga0081539_10045141 3300005985 Bacteria 2537
65 Ga0070717_10035493 3300006028 Bacteria 4036
66 Ga0075432_10044490 3300006058 Bacteria 1557
67 Ga0070715_10015443 3300006163 Bacteria 2848
68 Ga0070716_100003366 3300006173 Bacteria 7520
69 Ga0070712_100000805 3300006175 Bacteria 18632
70 Ga0068871_100143340 3300006358 Bacteria 2033
71 Ga0075428_100009951 3300006844 Bacteria 10563
72 Ga0075428_100059736 3300006844 Bacteria 4175
73 Ga0075428_100060446 3300006844 Bacteria 4149
74 Ga0075428_100085404 3300006844 Bacteria 3441
75 Ga0075428_100408057 3300006844 Bacteria 1456
76 Ga0075428_100612101 3300006844 Bacteria 1163
77 Ga0075430_100034770 3300006846 Bacteria 4277
78 Ga0075430_100221115 3300006846 Bacteria 1571
79 Ga0075430_100540509 3300006846 Bacteria 961
80 Ga0075431_100003971 3300006847 Bacteria 14413
81 Ga0075431_100264469 3300006847 Bacteria 1745
82 Ga0075433_10089647 3300006852 Bacteria 2718
83 Ga0075433_10564840 3300006852 Bacteria 1000
84 Ga0075434_100010613 3300006871 Bacteria 8642
85 Ga0075434_100058614 3300006871 Bacteria 3827
86 Ga0075434_100059349 3300006871 Bacteria 3803
87 Ga0075434_100095084 3300006871 Bacteria 2985
88 Ga0097620_100071675 3300006931 Bacteria 3501
89 Ga0097620_100153091 3300006931 Bacteria 2382
90 Ga0097620_100213764 3300006931 Bacteria 2015
91 Ga0075435_100151989 3300007076 Bacteria 1947
92 Ga0111539_10010928 3300009094 Bacteria 11427
93 Ga0111539_10015311 3300009094 Bacteria 9550
94 Ga0111539_10250980 3300009094 Bacteria 2060
95 Ga0111539_10542394 3300009094 Bacteria 1355
96 Ga0105245_10003187 3300009098 Bacteria 14669
97 Ga0114129_10053958 3300009147 Bacteria 5637
98 Ga0114129_10108608 3300009147 Bacteria 3830
99 Ga0114129_10295068 3300009147 Bacteria 2162
100 Ga0114129_10308562 3300009147 Bacteria 2107
101 Ga0114129_10313808 3300009147 Bacteria 2086
102 Ga0105243_10473114 3300009148 Bacteria 1181
103 Ga0105249_10027983 3300009553 Bacteria 5088
104 Ga0105239_10032033 3300010375 Bacteria 5777
105 Ga0157378_10013578 3300013297 Bacteria 7123
106 Ga0163162_10106992 3300013306 Bacteria 2892
107 Ga0157375_10865703 3300013308 Bacteria 1049
108 Ga0157380_10312156 3300014326 Bacteria 1454
109 Ga0157379_10076719 3300014968 Bacteria 2993
110 Ga0207692_10000732 3300025898 Bacteria 11584
111 Ga0207685_10010592 3300025905 Bacteria 2731
112 Ga0207699_10001964 3300025906 Bacteria 9710
113 Ga0207684_10007476 3300025910 Bacteria 9833
114 Ga0207684_10021267 3300025910 Bacteria 5539
115 Ga0207684_10194508 3300025910 Bacteria 1749
116 Ga0207663_10086537 3300025916 Bacteria 2067
117 Ga0207662_10038271 3300025918 Bacteria 2810
118 Ga0207662_10124970 3300025918 Bacteria 1617
119 Ga0207646_10000457 3300025922 Bacteria 54593
120 Ga0207646_10013160 3300025922 Bacteria 7918
121 Ga0207646_10490320 3300025922 Bacteria 1107
122 Ga0207650_10109263 3300025925 Bacteria 2138
123 Ga0207700_10029472 3300025928 Bacteria 3873
124 Ga0207664_10014972 3300025929 Bacteria 5616
125 Ga0207664_10106553 3300025929 Bacteria 2324
126 Ga0207706_10013027 3300025933 Bacteria 7568
127 Ga0207670_10000027 3300025936 Bacteria 129850
128 Ga0207670_10001827 3300025936 Bacteria 11096
129 Ga0207670_10025787 3300025936 Bacteria 3695
130 Ga0207670_10107327 3300025936 Unclassified 2004
131 Ga0207665_10002107 3300025939 Bacteria 13449
132 Ga0207667_10027748 3300025949 Bacteria 6158
133 Ga0207651_10119748 3300025960 Bacteria 1994
134 Ga0207658_10030792 3300025986 Bacteria 3803
135 Ga0207703_10310727 3300026035 Bacteria 1441
136 Ga0207639_10018199 3300026041 Bacteria 4989
137 Ga0207678_10001749 3300026067 Bacteria 19881
138 Ga0207708_10013105 3300026075 Bacteria 6187
139 Ga0207708_10037763 3300026075 Bacteria 3679
140 Ga0207708_10056037 3300026075 Bacteria 3006
141 Ga0207708_10206340 3300026075 Bacteria 1569
142 Ga0207708_10242102 3300026075 Bacteria 1451
143 Ga0207641_10015206 3300026088 Bacteria 6307
144 Ga0207641_10137964 3300026088 Unclassified 2197
145 Ga0207641_10156998 3300026088 Bacteria 2065
146 Ga0207648_10081760 3300026089 Bacteria 2817
147 Ga0207676_10115113 3300026095 Bacteria 2257
148 Ga0207675_100033992 3300026118 Bacteria 4752
149 Ga0207428_10048210 3300027907 Bacteria 3419
150 Ga0207428_10077080 3300027907 Bacteria 2610
151 Ga0268266_10000001 3300028379 Bacteria 4040580
152 Ga0307408_100012612 3300031548 Bacteria 5603
153 Ga0316576_10041333 3300031727 Bacteria 3318
154 Ga0316576_10141093 3300031727 Bacteria 1814
155 Ga0316578_10044447 3300031728 Bacteria 2584
156 Ga0307405_10030929 3300031731 Bacteria 3145
157 Ga0307410_10019070 3300031852 Bacteria 4164
158 Ga0307407_10255496 3300031903 Unclassified 1203
159 Ga0307409_100100482 3300031995 Bacteria 2398
160 Ga0307415_100034060 3300032126 Bacteria 3311
161 Ga0316580_10014402 3300032139 Bacteria 2415
162 Ga0373934_0000295 3300035086 Bacteria 17738
163 Ga0373923_0008321 3300035111 Bacteria 3694
164 Ga0373945_0012059 3300035116 Bacteria 2865
165 Ga0373953_0006196 3300035117 Bacteria 3929
166 Ga0373956_0001285 3300035119 Bacteria 10396
167 Ga0373955_0007416 3300035172 Bacteria 5043
168 Ga0373962_0023355 3300035242 Bacteria 1647
169 Ga0316574_0002569 3300035398 Bacteria 9141
170 Ga0316574_0006842 3300035398 Bacteria 6198
171 Ga0316574_0011304 3300035398 Bacteria 5069
172 Ga0316574_0101207 3300035398 Bacteria 1845
173 Ga0316574_0163888 3300035398 Bacteria 1431
174 Ga0316574_0198398 3300035398 Bacteria 1289
175 Ga0373933_0008958 3300035724 Bacteria 5458
176 Ga0373947_0361394 3300035725 Bacteria 975
177 Ga0373937_0109811 3300036401 Bacteria 2565
178 Ga0316582_0062381 3300036647 Bacteria 2393
179 Ga0316584_0032869 3300036712 Bacteria 3840
180 Ga0395899_0017559 3300037312 Bacteria 5451
181 Ga0395899_0032171 3300037312 Bacteria 3940
182 Ga0395900_0013414 3300037418 Bacteria 8372
183 Ga0395898_0016885 3300037466 Bacteria 7453
184 Ga0395898_0044096 3300037466 Bacteria 4393
185 Ga0395898_0054833 3300037466 Bacteria 3888
186 Ga0395898_0334681 3300037466 Bacteria 1444
187 Ga0395905_0027644 3300037471 Bacteria 5349
188 Ga0395905_0062096 3300037471 Bacteria 3495
189 Ga0395905_0077730 3300037471 Bacteria 3109
190 Ga0395901_0023616 3300038443 Bacteria 6304
191 Ga0395901_0073304 3300038443 Bacteria 3570
192 Ga0395901_0538907 3300038443 Bacteria 1184
193 Ga0436363_0986562 3300039450 Bacteria 1854
194 Ga0451837_0233852 3300041494 Bacteria 3352
195 Ga0451577_0178297 3300042876 Bacteria 1915
196 Ga0453684_0270649 3300044712 Bacteria 1941
197 Ga0451576_0025546 3300045051 Bacteria 6363
198 Ga0451576_0041936 3300045051 Bacteria 4834
199 Ga0451576_0045818 3300045051 Bacteria 4604
200 Ga0451576_0278148 3300045051 Bacteria 1750
201 Ga0451576_0591192 3300045051 Bacteria 1166
202 Ga0495603_0054146 3300046455 Bacteria 2379
203 Ga0495580_0171278 3300046472 Bacteria 1501
204 Ga0495664_0134827 3300046477 Bacteria 1496
205 Ga0495608_0003821 3300046511 Bacteria 10824
206 Ga0495618_0000679 3300046514 Bacteria 23900
207 Ga0495628_0024056 3300046516 Bacteria 4990
208 Ga0495652_0044449 3300046529 Bacteria 3825
209 Ga0495587_0019736 3300046536 Bacteria 4168
210 Ga0495598_0165840 3300046537 Bacteria 780
211 Ga0495645_0023572 3300046543 Bacteria 4458
212 Ga0495635_0280290 3300046663 Bacteria 1120
213 Ga0495599_0062612 3300046678 Bacteria 2324
214 Ga0495589_0052074 3300046794 Bacteria 2023
215 Ga0495604_0190626 3300047317 Bacteria 1429
216 Ga0495680_0093938 3300047322 Bacteria 2244
217 Ga0495680_0149294 3300047322 Bacteria 1705
218 Ga0495680_0441146 3300047322 Bacteria 892
219 Ga0495675_0006797 3300047444 Bacteria 7016
220 Ga0495684_0124630 3300047471 Bacteria 1939
221 Ga0495686_0001969 3300047472 Bacteria 20403
222 Ga0501032_0243650 3300049569 Unclassified 1168
223 Ga0501038_0174043 3300049574 Bacteria 1740
224 Ga0501039_0186090 3300049575 Bacteria 1633
225 Ga0501040_0047322 3300049576 Bacteria 2938
226 Ga0501041_0321107 3300049577 Bacteria 977
227 Ga0501042_0050254 3300049578 Bacteria 2974
228 Ga0501043_0204710 3300049579 Bacteria 1530
229 Ga0501046_0012938 3300049580 Bacteria 7091
230 Ga0501048_0126859 3300049582 Bacteria 1804
231 Ga0501067_0037662 3300049583 Bacteria 2686
232 Ga0501069_0118870 3300049585 Bacteria 1509
233 Ga0501069_0243324 3300049585 Bacteria 1048
234 Ga0501070_0083863 3300049586 Bacteria 2638
235 Ga0501071_0035980 3300049587 Bacteria 3529
236 Ga0501071_0083115 3300049587 Bacteria 2346
237 Ga0501071_0095245 3300049587 Bacteria 2191
238 Ga0501072_0526288 3300049588 Bacteria 934
239 Ga0501074_0164590 3300049590 Bacteria 1583
240 Ga0501075_0110577 3300049591 Bacteria 2089
241 Ga0501076_0080683 3300049592 Bacteria 2612
242 Ga0501076_0173328 3300049592 Bacteria 1759
243 Ga0501076_0449435 3300049592 Bacteria 1061
244 Ga0501225_0042494 3300049705 Unclassified 1255
245 Ga0501079_0389973 3300049741 Bacteria 1092
246 Ga0501079_0451012 3300049741 Bacteria 1010
247 Ga0501080_0126448 3300049742 Bacteria 2367
248 Ga0501080_0264397 3300049742 Bacteria 1566
249 Ga0501081_0033604 3300049743 Bacteria 3486
250 Ga0501081_0069556 3300049743 Bacteria 2452
251 Ga0501081_0293634 3300049743 Bacteria 1192
252 Ga0501035_0141373 3300049822 Bacteria 2092
253 Ga0501035_0331350 3300049822 Bacteria 1277
254 Ga0501044_0186766 3300049823 Bacteria 2037
255 nmdc:mga05p37_14819_c1 3300050507 Bacteria 9360
256 nmdc:mga05p37_281005_c1 3300050507 Bacteria 1985
257 nmdc:mga05p37_293850_c1 3300050507 Bacteria 1933
258 nmdc:mga05p37_305923_c1 3300050507 Unclassified 1886
259 nmdc:mga05p37_427768_c1 3300050507 Bacteria 1539
260 nmdc:mga0qj67_78943_c1 3300050509 Bacteria 2635
261 nmdc:mga06r32_112323_c1 3300050510 Bacteria 2681
262 nmdc:mga08y16_139176_c1 3300050511 Bacteria 2523
263 nmdc:mga08y16_33442_c1 3300050511 Bacteria 5400
264 nmdc:mga08y16_411818_c1 3300050511 Unclassified 1382
265 nmdc:mga08y16_555938_c1 3300050511 Bacteria 1161
266 nmdc:mga08y16_75293_c1 3300050511 Bacteria 3519
267 nmdc:mga0n895_106479_c1 3300050512 Bacteria 2817
268 nmdc:mga0n895_130413_c1 3300050512 Bacteria 2539
269 nmdc:mga0n895_153894_c1 3300050512 Bacteria 2330
270 nmdc:mga0n895_44852_c1 3300050512 Bacteria 4312
271 nmdc:mga0rr50_199555_c1 3300050513 Bacteria 1643
272 nmdc:mga0a205_37504_c1 3300050515 Bacteria 4661
273 nmdc:mga0a205_54699_c1 3300050515 Bacteria 3853
274 Ga0495595_0003540 3300053084 Bacteria 6200
275 Ga0495619_0116639 3300053085 Bacteria 1828
276 Ga0495619_0379983 3300053085 Bacteria 976
277 Ga0501084_0284372 3300054114 Bacteria 1397
278 Ga0501084_0541787 3300054114 Bacteria 983
279 Ga0501082_0193889 3300060353 Bacteria 1767
280 Ga0501082_0264017 3300060353 Bacteria 1498
281 Ga0530510_0094891 3300061734 Bacteria 2179
282 Ga0316575_10016389
283 JGI25407J50210_10064511
284 Ga0065707_10214644
285 Ga0070690_100082741
286 Ga0070670_100135596
287 Ga0070689_100000086
288 Ga0070689_100006635
289 Ga0070689_100038374
290 Ga0070691_10031173
291 Ga0070692_10257162
292 Ga0070668_100010041
293 Ga0070688_100000449
294 Ga0070688_100000869
295 Ga0070688_100002004
296 Ga0070667_100089386
297 Ga0070709_10002682
298 Ga0070714_100036633
299 Ga0070713_100020548
300 Ga0070713_100056332
301 Ga0070710_10002828
302 Ga0070701_10022724
303 Ga0070701_10120699
304 Ga0070711_100029777
305 Ga0070700_100131958
306 Ga0070694_100055194
307 Ga0070694_100538576
308 Ga0070708_100070720
309 Ga0070663_100000699
310 Ga0068867_100066244
311 Ga0070685_10000432
312 Ga0070685_10037897
313 Ga0070685_10225356
314 Ga0070706_100023590
315 Ga0070706_100146748
316 Ga0070707_100002286
317 Ga0070707_100062064
318 Ga0070698_100003103
319 Ga0070698_100013440
320 Ga0070698_100041669
321 Ga0070698_100060383
322 Ga0068853_100009129
323 Ga0070686_100056935
324 Ga0070695_100001208
325 Ga0070695_100500235
326 Ga0070696_100221151
327 Ga0070665_100000053
328 Ga0070704_100032653
329 Ga0070704_100037945
330 Ga0070704_100142801
331 Ga0070704_100335373
332 Ga0068855_100149153
333 Ga0068857_100015059
334 Ga0068859_100071671
335 Ga0068859_100153085
336 Ga0068859_100213768
337 Ga0068863_100129096
338 Ga0068863_100450460
339 Ga0068862_100384769
340 Ga0081538_10000369
341 Ga0081538_10006025
342 Ga0081538_10017081
343 Ga0081538_10036193
344 Ga0081539_10001616
345 Ga0081539_10045141
346 Ga0070717_10035493
347 Ga0075432_10044490
348 Ga0070715_10015443
349 Ga0070716_100003366
350 Ga0070712_100000805
351 Ga0068871_100143340
352 Ga0075428_100009951
353 Ga0075428_100059736
354 Ga0075428_100060446
355 Ga0075428_100085404
356 Ga0075428_100408057
357 Ga0075428_100612101
358 Ga0075430_100034770
359 Ga0075430_100221115
360 Ga0075430_100540509
361 Ga0075431_100003971
362 Ga0075431_100264469
363 Ga0075433_10089647
364 Ga0075433_10564840
365 Ga0075434_100010613
366 Ga0075434_100058614
367 Ga0075434_100059349
368 Ga0075434_100095084
369 Ga0097620_100071675
370 Ga0097620_100153091
371 Ga0097620_100213764
372 Ga0075435_100151989
373 Ga0111539_10010928
374 Ga0111539_10015311
375 Ga0111539_10250980
376 Ga0111539_10542394
377 Ga0105245_10003187
378 Ga0114129_10053958
379 Ga0114129_10108608
380 Ga0114129_10295068
381 Ga0114129_10308562
382 Ga0114129_10313808
383 Ga0105243_10473114
384 Ga0105249_10027983
385 Ga0105239_10032033
386 Ga0157378_10013578
387 Ga0163162_10106992
388 Ga0157375_10865703
389 Ga0157380_10312156
390 Ga0157379_10076719
391 Ga0207692_10000732
392 Ga0207685_10010592
393 Ga0207699_10001964
394 Ga0207684_10007476
395 Ga0207684_10021267
396 Ga0207684_10194508
397 Ga0207663_10086537
398 Ga0207662_10038271
399 Ga0207662_10124970
400 Ga0207646_10000457
401 Ga0207646_10013160
402 Ga0207646_10490320
403 Ga0207650_10109263
404 Ga0207700_10029472
405 Ga0207664_10014972
406 Ga0207664_10106553
407 Ga0207706_10013027
408 Ga0207670_10000027
409 Ga0207670_10001827
410 Ga0207670_10025787
411 Ga0207670_10107327
412 Ga0207665_10002107
413 Ga0207667_10027748
414 Ga0207651_10119748
415 Ga0207658_10030792
416 Ga0207703_10310727
417 Ga0207639_10018199
418 Ga0207678_10001749
419 Ga0207708_10013105
420 Ga0207708_10037763
421 Ga0207708_10056037
422 Ga0207708_10206340
423 Ga0207708_10242102
424 Ga0207641_10015206
425 Ga0207641_10137964
426 Ga0207641_10156998
427 Ga0207648_10081760
428 Ga0207676_10115113
429 Ga0207675_100033992
430 Ga0207428_10048210
431 Ga0207428_10077080
432 Ga0268266_10000001
433 Ga0307408_100012612
434 Ga0316576_10041333
435 Ga0316576_10141093
436 Ga0316578_10044447
437 Ga0307405_10030929
438 Ga0307410_10019070
439 Ga0307407_10255496
440 Ga0307409_100100482
441 Ga0307415_100034060
442 Ga0316580_10014402
443 Ga0373934_0000295
444 Ga0373923_0008321
445 Ga0373945_0012059
446 Ga0373953_0006196
447 Ga0373956_0001285
448 Ga0373955_0007416
449 Ga0373962_0023355
450 Ga0316574_0002569
451 Ga0316574_0006842
452 Ga0316574_0011304
453 Ga0316574_0101207
454 Ga0316574_0163888
455 Ga0316574_0198398
456 Ga0373933_0008958
457 Ga0373947_0361394
458 Ga0373937_0109811
459 Ga0316582_0062381
460 Ga0316584_0032869
461 Ga0395899_0017559
462 Ga0395899_0032171
463 Ga0395900_0013414
464 Ga0395898_0016885
465 Ga0395898_0044096
466 Ga0395898_0054833
467 Ga0395898_0334681
468 Ga0395905_0027644
469 Ga0395905_0062096
470 Ga0395905_0077730
471 Ga0395901_0023616
472 Ga0395901_0073304
473 Ga0395901_0538907
474 Ga0436363_0986562
475 Ga0451837_0233852
476 Ga0451577_0178297
477 Ga0453684_0270649
478 Ga0451576_0025546
479 Ga0451576_0041936
480 Ga0451576_0045818
481 Ga0451576_0278148
482 Ga0451576_0591192
483 Ga0495603_0054146
484 Ga0495580_0171278
485 Ga0495664_0134827
486 Ga0495608_0003821
487 Ga0495618_0000679
488 Ga0495628_0024056
489 Ga0495652_0044449
490 Ga0495587_0019736
491 Ga0495598_0165840
492 Ga0495645_0023572
493 Ga0495635_0280290
494 Ga0495599_0062612
495 Ga0495589_0052074
496 Ga0495604_0190626
497 Ga0495680_0093938
498 Ga0495680_0149294
499 Ga0495680_0441146
500 Ga0495675_0006797
501 Ga0495684_0124630
502 Ga0495686_0001969
503 Ga0501032_0243650
504 Ga0501038_0174043
505 Ga0501039_0186090
506 Ga0501040_0047322
507 Ga0501041_0321107
508 Ga0501042_0050254
509 Ga0501043_0204710
510 Ga0501046_0012938
511 Ga0501048_0126859
512 Ga0501067_0037662
513 Ga0501069_0118870
514 Ga0501069_0243324
515 Ga0501070_0083863
516 Ga0501071_0035980
517 Ga0501071_0083115
518 Ga0501071_0095245
519 Ga0501072_0526288
520 Ga0501074_0164590
521 Ga0501075_0110577
522 Ga0501076_0080683
523 Ga0501076_0173328
524 Ga0501076_0449435
525 Ga0501225_0042494
526 Ga0501079_0389973
527 Ga0501079_0451012
528 Ga0501080_0126448
529 Ga0501080_0264397
530 Ga0501081_0033604
531 Ga0501081_0069556
532 Ga0501081_0293634
533 Ga0501035_0141373
534 Ga0501035_0331350
535 Ga0501044_0186766
536 nmdc:mga05p37_14819_c1
537 nmdc:mga05p37_281005_c1
538 nmdc:mga05p37_293850_c1
539 nmdc:mga05p37_305923_c1
540 nmdc:mga05p37_427768_c1
541 nmdc:mga0qj67_78943_c1
542 nmdc:mga06r32_112323_c1
543 nmdc:mga08y16_139176_c1
544 nmdc:mga08y16_33442_c1
545 nmdc:mga08y16_411818_c1
546 nmdc:mga08y16_555938_c1
547 nmdc:mga08y16_75293_c1
548 nmdc:mga0n895_106479_c1
549 nmdc:mga0n895_130413_c1
550 nmdc:mga0n895_153894_c1
551 nmdc:mga0n895_44852_c1
552 nmdc:mga0rr50_199555_c1
553 nmdc:mga0a205_37504_c1
554 nmdc:mga0a205_54699_c1
555 Ga0495595_0003540
556 Ga0495619_0116639
557 Ga0495619_0379983
558 Ga0501084_0284372
559 Ga0501084_0541787
560 Ga0501082_0193889
561 Ga0501082_0264017
562 Ga0530510_0094891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

52

308

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9429 2 234
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9379 4 234
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9353 2 236
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9351 2 234
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9277 2 236
ID Description Score Start End Superfamily
af_O08343_1_262_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9414 2 236 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9353 2 236 3.20.20.140
1j6oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9351 2 234 3.20.20.140
af_O08343_1_262_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9337 2 236 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9311 2 234 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A538ICX7-F1-model_v4 TatD family deoxyribonuclease 0.9827 2 171 GO:0005829
GO:0016788
AF-A0A2W5Y7Q8-F1-model_v4 TatD family deoxyribonuclease 0.9742 2 187 GO:0005829
GO:0016788
GO:0046872
AF-A0A847Z521-F1-model_v4 TatD family hydrolase 0.9714 2 127 GO:0005829
GO:0016788
AF-A0A485B649-F1-model_v4 Deoxyribonuclease TatD (EC 3.1.21.-) 0.971 2 132 GO:0004518
AF-A0A7V6RP70-F1-model_v4 TatD family hydrolase 0.9708 2 126 GO:0005829
GO:0016788

Map