F384375

General Info

Members Datasets Scaffolds Average Seq Length
281 129 540 112

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10252426|Ga0265332_102524261
Length 128
Sequence MRKVKTRGPASNKRGATKRIEAIVRPSKAGDVIDALEKVGHPGMMVTEIEGHGKQKGLEETVRGKKYKVDLITKTRIEIVVKEADVEKMLAAIRKAAFTGEIGDGKIFLHPVDDALRIRTDERGEVAV

Samples

Sample ID Description Type Environment
1 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
129 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 3.2
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.78
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265332_10252426 3300031238 Bacteria 730
2 JGI25406J46586_10063479 3300003203 Bacteria 1183
3 Ga0070658_10000989 3300005327 Bacteria 24401
4 Ga0070658_10001462 3300005327 Bacteria 20132
5 Ga0070658_10008537 3300005327 Bacteria 8236
6 Ga0070658_10093158 3300005327 Bacteria 2485
7 Ga0070658_10152173 3300005327 Bacteria 1937
8 Ga0070658_10196054 3300005327 Bacteria 1703
9 Ga0070658_10274557 3300005327 Bacteria 1434
10 Ga0070658_10371018 3300005327 Bacteria 1227
11 Ga0070658_10418601 3300005327 Bacteria 1152
12 Ga0070676_10763410 3300005328 Bacteria 711
13 Ga0070683_100046322 3300005329 Bacteria 4017
14 Ga0070683_100048613 3300005329 Bacteria 3922
15 Ga0070683_100197217 3300005329 Bacteria 1912
16 Ga0070683_100371605 3300005329 Bacteria 1362
17 Ga0070683_100891840 3300005329 Bacteria 853
18 Ga0070683_101101952 3300005329 Bacteria 763
19 Ga0070683_101229580 3300005329 Bacteria 720
20 Ga0070690_100047657 3300005330 Bacteria 2727
21 Ga0070670_100132618 3300005331 Bacteria 2152
22 Ga0070680_100000056 3300005336 Bacteria 57426
23 Ga0070680_100001800 3300005336 Bacteria 15728
24 Ga0070680_100031393 3300005336 Bacteria 4271
25 Ga0070680_100090064 3300005336 Bacteria 2539
26 Ga0070680_100226925 3300005336 Bacteria 1577
27 Ga0070680_100450146 3300005336 Bacteria 1100
28 Ga0070680_100586014 3300005336 Bacteria 957
29 Ga0070660_100026478 3300005339 Bacteria 4318
30 Ga0070660_100038227 3300005339 Bacteria 3642
31 Ga0070660_100107947 3300005339 Bacteria 2212
32 Ga0070660_100891836 3300005339 Bacteria 750
33 Ga0070692_10059595 3300005345 Bacteria 2007
34 Ga0070674_100703961 3300005356 Bacteria 864
35 Ga0070659_100013165 3300005366 Bacteria 6151
36 Ga0070667_101374621 3300005367 Bacteria 662
37 Ga0070714_101480265 3300005435 Bacteria 663
38 Ga0070713_101581752 3300005436 Unclassified 636
39 Ga0070713_101624324 3300005436 Bacteria 627
40 Ga0070681_10000046 3300005458 Bacteria 84043
41 Ga0070681_10000520 3300005458 Bacteria 31480
42 Ga0070681_10158181 3300005458 Bacteria 2190
43 Ga0070681_10176124 3300005458 Bacteria 2061
44 Ga0070681_10381223 3300005458 Bacteria 1321
45 Ga0070681_11539726 3300005458 Bacteria 590
46 Ga0070681_11594566 3300005458 Bacteria 578
47 Ga0070679_100000872 3300005530 Bacteria 26178
48 Ga0070679_100001357 3300005530 Bacteria 21606
49 Ga0070679_100036551 3300005530 Bacteria 4874
50 Ga0070679_100224630 3300005530 Bacteria 1838
51 Ga0070679_100407007 3300005530 Bacteria 1306
52 Ga0070679_100424096 3300005530 Bacteria 1275
53 Ga0070679_102045106 3300005530 Bacteria 522
54 Ga0070684_100029633 3300005535 Bacteria 4641
55 Ga0070684_100160685 3300005535 Bacteria 2038
56 Ga0070684_100284634 3300005535 Bacteria 1515
57 Ga0070684_100459594 3300005535 Bacteria 1177
58 Ga0070684_100989709 3300005535 Bacteria 789
59 Ga0070684_101553875 3300005535 Bacteria 624
60 Ga0070686_100152387 3300005544 Bacteria 1620
61 Ga0070693_100915843 3300005547 Bacteria 658
62 Ga0068855_100460465 3300005563 Bacteria 1387
63 Ga0070702_100324795 3300005615 Bacteria 1074
64 Ga0068864_100813067 3300005618 Bacteria 919
65 Ga0068864_101663989 3300005618 Bacteria 643
66 Ga0081539_10000170 3300005985 Bacteria 152854
67 Ga0070715_10000009 3300006163 Bacteria 187315
68 Ga0070716_101449930 3300006173 Bacteria 560
69 Ga0105245_10913449 3300009098 Bacteria 920
70 Ga0105243_10061175 3300009148 Bacteria 3010
71 Ga0105242_10025639 3300009176 Bacteria 4668
72 Ga0105242_10616090 3300009176 Bacteria 1051
73 Ga0105242_11599487 3300009176 Bacteria 685
74 Ga0105242_13066577 3300009176 Bacteria 518
75 Ga0105248_10609135 3300009177 Bacteria 1232
76 Ga0105248_11967578 3300009177 Bacteria 664
77 Ga0105237_10048918 3300009545 Bacteria 4251
78 Ga0105033_104031 3300009986 Bacteria 1249
79 Ga0105239_10204915 3300010375 Bacteria 2210
80 Ga0105239_11949756 3300010375 Bacteria 681
81 Ga0105239_12674920 3300010375 Bacteria 582
82 Ga0157373_10538811 3300013100 Bacteria 846
83 Ga0157371_10288701 3300013102 Bacteria 1186
84 Ga0157371_10738744 3300013102 Bacteria 738
85 Ga0157371_11191563 3300013102 Bacteria 587
86 Ga0157369_10006740 3300013105 Bacteria 13255
87 Ga0157369_10378872 3300013105 Bacteria 1468
88 Ga0157369_10385192 3300013105 Bacteria 1455
89 Ga0157369_10429856 3300013105 Bacteria 1369
90 Ga0157369_10853800 3300013105 Bacteria 934
91 Ga0157369_12240738 3300013105 Bacteria 554
92 Ga0157378_10991409 3300013297 Bacteria 874
93 Ga0157372_11714962 3300013307 Bacteria 723
94 Ga0157375_10287054 3300013308 Bacteria 1808
95 Ga0163163_10387533 3300014325 Bacteria 1455
96 Ga0157380_10702920 3300014326 Bacteria 1016
97 Ga0157376_10289684 3300014969 Bacteria 1545
98 Ga0163161_10055596 3300017792 Bacteria 2873
99 Ga0197907_10279393 3300020069 Bacteria 1358
100 Ga0206356_11268141 3300020070 Bacteria 700
101 Ga0206355_1512095 3300020076 Bacteria 647
102 Ga0206354_11189937 3300020081 Bacteria 5539
103 Ga0206353_10507229 3300020082 Bacteria 2237
104 Ga0206353_10552643 3300020082 Bacteria 6014
105 Ga0206353_10914521 3300020082 Bacteria 777
106 Ga0206353_11812308 3300020082 Bacteria 1503
107 Ga0213873_10000144 3300021358 Bacteria 13528
108 Ga0213874_10178325 3300021377 Bacteria 755
109 Ga0213874_10294946 3300021377 Bacteria 609
110 Ga0213875_10012932 3300021388 Bacteria 4110
111 Ga0224712_10635447 3300022467 Bacteria 523
112 Ga0207685_10000014 3300025905 Bacteria 180422
113 Ga0207705_10001599 3300025909 Bacteria 17984
114 Ga0207705_10002132 3300025909 Bacteria 15357
115 Ga0207705_10010058 3300025909 Bacteria 6885
116 Ga0207705_10230009 3300025909 Bacteria 1410
117 Ga0207705_10677168 3300025909 Bacteria 802
118 Ga0207705_10705496 3300025909 Bacteria 784
119 Ga0207705_11247743 3300025909 Bacteria 569
120 Ga0207707_10000737 3300025912 Bacteria 32379
121 Ga0207707_10001969 3300025912 Bacteria 18647
122 Ga0207707_10069642 3300025912 Bacteria 3066
123 Ga0207707_10086705 3300025912 Bacteria 2736
124 Ga0207707_10590267 3300025912 Bacteria 941
125 Ga0207707_11188091 3300025912 Bacteria 618
126 Ga0207707_11306238 3300025912 Bacteria 583
127 Ga0207671_10010049 3300025914 Bacteria 7846
128 Ga0207660_10000168 3300025917 Bacteria 41428
129 Ga0207660_10002012 3300025917 Bacteria 13518
130 Ga0207660_10073551 3300025917 Bacteria 2492
131 Ga0207660_10114499 3300025917 Bacteria 2034
132 Ga0207660_10117109 3300025917 Bacteria 2013
133 Ga0207660_10184769 3300025917 Bacteria 1621
134 Ga0207657_10039259 3300025919 Bacteria 4209
135 Ga0207657_10061780 3300025919 Bacteria 3210
136 Ga0207657_10096666 3300025919 Bacteria 2456
137 Ga0207657_10180909 3300025919 Bacteria 1704
138 Ga0207657_10767320 3300025919 Bacteria 747
139 Ga0207652_10000461 3300025921 Bacteria 41921
140 Ga0207652_10001037 3300025921 Bacteria 25456
141 Ga0207652_10043920 3300025921 Bacteria 3806
142 Ga0207652_10075477 3300025921 Bacteria 2938
143 Ga0207652_10262842 3300025921 Bacteria 1557
144 Ga0207652_10406748 3300025921 Bacteria 1228
145 Ga0207652_10484675 3300025921 Bacteria 1114
146 Ga0207652_10550094 3300025921 Bacteria 1037
147 Ga0207646_11121465 3300025922 Bacteria 692
148 Ga0207700_10895976 3300025928 Bacteria 794
149 Ga0207700_11849336 3300025928 Unclassified 530
150 Ga0207664_11002250 3300025929 Bacteria 749
151 Ga0207706_11324432 3300025933 Bacteria 594
152 Ga0207686_10113816 3300025934 Bacteria 1830
153 Ga0207686_10785982 3300025934 Bacteria 762
154 Ga0207709_10644608 3300025935 Bacteria 843
155 Ga0207665_10656833 3300025939 Bacteria 822
156 Ga0207691_10610888 3300025940 Bacteria 923
157 Ga0207661_10049113 3300025944 Bacteria 3357
158 Ga0207661_10108317 3300025944 Bacteria 2345
159 Ga0207661_10469220 3300025944 Bacteria 1148
160 Ga0207661_11017907 3300025944 Bacteria 763
161 Ga0207661_11296111 3300025944 Bacteria 669
162 Ga0207667_10163719 3300025949 Bacteria 2287
163 Ga0207667_10541397 3300025949 Bacteria 1178
164 Ga0207658_11458162 3300025986 Bacteria 626
165 Ga0207702_12035406 3300026078 Bacteria 564
166 Ga0207676_10653561 3300026095 Bacteria 1015
167 Ga0207675_102140176 3300026118 Bacteria 575
168 Ga0265319_1027216 3300028563 Bacteria 2030
169 Ga0265334_10000639 3300028573 Bacteria 17719
170 Ga0265318_10038894 3300028577 Bacteria 1817
171 Ga0265323_10004404 3300028653 Bacteria 6070
172 Ga0265323_10025914 3300028653 Unclassified 2214
173 Ga0265323_10042283 3300028653 Bacteria 1651
174 Ga0265323_10107688 3300028653 Unclassified 916
175 Ga0265323_10225978 3300028653 Bacteria 585
176 Ga0265322_10001546 3300028654 Bacteria 7398
177 Ga0265322_10015405 3300028654 Bacteria 2210
178 Ga0265322_10031164 3300028654 Unclassified 1522
179 Ga0265322_10119007 3300028654 Unclassified 752
180 Ga0265336_10013716 3300028666 Unclassified 2697
181 Ga0265338_10021759 3300028800 Bacteria 6667
182 Ga0265338_10089915 3300028800 Bacteria 2543
183 Ga0265324_10295137 3300029957 Unclassified 551
184 Ga0265330_10024147 3300031235 Bacteria 2758
185 Ga0265332_10041650 3300031238 Bacteria 1986
186 Ga0265332_10076547 3300031238 Bacteria 1422
187 Ga0265320_10002960 3300031240 Bacteria 11614
188 Ga0265320_10014566 3300031240 Bacteria 4470
189 Ga0265329_10005739 3300031242 Unclassified 4988
190 Ga0265329_10013270 3300031242 Bacteria 2943
191 Ga0265329_10077983 3300031242 Bacteria 1049
192 Ga0265340_10210467 3300031247 Unclassified 873
193 Ga0265340_10355735 3300031247 Unclassified 647
194 Ga0265339_10023245 3300031249 Bacteria 3586
195 Ga0265339_10034171 3300031249 Bacteria 2858
196 Ga0265316_10001088 3300031344 Bacteria 29441
197 Ga0265316_10001137 3300031344 Bacteria 28885
198 Ga0265316_10001345 3300031344 Bacteria 26441
199 Ga0265316_10001957 3300031344 Bacteria 21647
200 Ga0265316_10007348 3300031344 Bacteria 10385
201 Ga0265316_10014464 3300031344 Bacteria 6939
202 Ga0265316_10035334 3300031344 Bacteria 4050
203 Ga0265316_10052997 3300031344 Bacteria 3180
204 Ga0265316_10112368 3300031344 Bacteria 2062
205 Ga0265316_10300797 3300031344 Bacteria 1168
206 Ga0316579_10150216 3300031691 Bacteria 1124
207 Ga0265314_10032420 3300031711 Bacteria 3843
208 Ga0265314_10124367 3300031711 Bacteria 1618
209 Ga0265342_10000028 3300031712 Bacteria 156813
210 Ga0265342_10000111 3300031712 Bacteria 90609
211 Ga0265342_10000391 3300031712 Bacteria 48414
212 Ga0265342_10063427 3300031712 Unclassified 2172
213 Ga0316574_0112283 3300035398 Bacteria 1747
214 Ga0373924_0316705 3300035410 Unclassified 693
215 Ga0316584_0116815 3300036712 Bacteria 1995
216 Ga0395898_0159294 3300037466 Bacteria 2159
217 Ga0436364_0404799 3300037853 Bacteria 53106
218 Ga0395901_0175092 3300038443 Bacteria 2251
219 Ga0395901_0971814 3300038443 Bacteria 827
220 Ga0436365_0584086 3300039437 Bacteria 2358
221 Ga0436363_0085556 3300039450 Bacteria 1384
222 Ga0436363_1129967 3300039450 Bacteria 769
223 Ga0436363_1313958 3300039450 Bacteria 638
224 Ga0436362_0543778 3300039453 Bacteria 67112
225 Ga0436362_1030512 3300039453 Bacteria 725
226 Ga0466969_0294381 3300044656 Bacteria 735
227 Ga0466966_0046434 3300044684 Bacteria 2773
228 Ga0466966_0114696 3300044684 Bacteria 1659
229 Ga0466966_0284793 3300044684 Bacteria 994
230 Ga0466966_0574571 3300044684 Bacteria 678
231 Ga0466961_0005516 3300044693 Bacteria 7981
232 Ga0466961_0032362 3300044693 Bacteria 3360
233 Ga0466961_0079308 3300044693 Bacteria 2079
234 Ga0466961_0098763 3300044693 Bacteria 1840
235 Ga0466961_0131024 3300044693 Bacteria 1572
236 Ga0466961_0201912 3300044693 Bacteria 1229
237 Ga0453684_0382428 3300044712 Bacteria 1580
238 Ga0453684_0397273 3300044712 Bacteria 1545
239 Ga0453684_0403771 3300044712 Bacteria 1530
240 Ga0453684_2438118 3300044712 Bacteria 517
241 Ga0466957_0349487 3300044842 Bacteria 1003
242 Ga0466959_0176154 3300045049 Bacteria 1498
243 Ga0466959_0821859 3300045049 Bacteria 621
244 Ga0451576_2387238 3300045051 Bacteria 541
245 Ga0466958_0077132 3300045836 Bacteria 2046
246 Ga0466958_0320112 3300045836 Bacteria 997
247 Ga0466967_0846750 3300045976 Bacteria 909
248 Ga0466967_1229454 3300045976 Bacteria 746
249 Ga0466967_1529309 3300045976 Bacteria 665
250 Ga0495651_0191890 3300046462 Bacteria 1437
251 Ga0495653_0927849 3300046463 Bacteria 517
252 Ga0495608_0063499 3300046511 Bacteria 2423
253 Ga0495657_0164405 3300046675 Bacteria 1371
254 Ga0495669_0128820 3300046684 Bacteria 1190
255 Ga0495600_0571123 3300046809 Bacteria 689
256 Ga0495675_0559091 3300047444 Bacteria 652
257 Ga0496102_0190858 3300048905 Bacteria 1930
258 Ga0496108_0252531 3300048911 Bacteria 1534
259 Ga0496111_0451314 3300048914 Bacteria 949
260 Ga0496112_0867804 3300048915 Bacteria 825
261 Ga0496113_0702699 3300048916 Bacteria 807
262 Ga0496117_0076241 3300048920 Bacteria 2224
263 Ga0496118_0015611 3300048921 Bacteria 7019
264 Ga0501031_0659513 3300049568 Bacteria 672
265 Ga0501036_0901243 3300049572 Bacteria 726
266 Ga0501042_0658245 3300049578 Bacteria 761
267 Ga0501067_0416253 3300049583 Bacteria 750
268 Ga0495595_0114273 3300053084 Bacteria 1311
269 Ga0466962_0629022 3300061719 Bacteria 548
270 8056449919 8056447290 Bacteria 7680491
271 Ga0265332_10252426
272 JGI25406J46586_10063479
273 Ga0070658_10000989
274 Ga0070658_10001462
275 Ga0070658_10008537
276 Ga0070658_10093158
277 Ga0070658_10152173
278 Ga0070658_10196054
279 Ga0070658_10274557
280 Ga0070658_10371018
281 Ga0070658_10418601
282 Ga0070676_10763410
283 Ga0070683_100046322
284 Ga0070683_100048613
285 Ga0070683_100197217
286 Ga0070683_100371605
287 Ga0070683_100891840
288 Ga0070683_101101952
289 Ga0070683_101229580
290 Ga0070690_100047657
291 Ga0070670_100132618
292 Ga0070680_100000056
293 Ga0070680_100001800
294 Ga0070680_100031393
295 Ga0070680_100090064
296 Ga0070680_100226925
297 Ga0070680_100450146
298 Ga0070680_100586014
299 Ga0070660_100026478
300 Ga0070660_100038227
301 Ga0070660_100107947
302 Ga0070660_100891836
303 Ga0070692_10059595
304 Ga0070674_100703961
305 Ga0070659_100013165
306 Ga0070667_101374621
307 Ga0070714_101480265
308 Ga0070713_101581752
309 Ga0070713_101624324
310 Ga0070681_10000046
311 Ga0070681_10000520
312 Ga0070681_10158181
313 Ga0070681_10176124
314 Ga0070681_10381223
315 Ga0070681_11539726
316 Ga0070681_11594566
317 Ga0070679_100000872
318 Ga0070679_100001357
319 Ga0070679_100036551
320 Ga0070679_100224630
321 Ga0070679_100407007
322 Ga0070679_100424096
323 Ga0070679_102045106
324 Ga0070684_100029633
325 Ga0070684_100160685
326 Ga0070684_100284634
327 Ga0070684_100459594
328 Ga0070684_100989709
329 Ga0070684_101553875
330 Ga0070686_100152387
331 Ga0070693_100915843
332 Ga0068855_100460465
333 Ga0070702_100324795
334 Ga0068864_100813067
335 Ga0068864_101663989
336 Ga0081539_10000170
337 Ga0070715_10000009
338 Ga0070716_101449930
339 Ga0105245_10913449
340 Ga0105243_10061175
341 Ga0105242_10025639
342 Ga0105242_10616090
343 Ga0105242_11599487
344 Ga0105242_13066577
345 Ga0105248_10609135
346 Ga0105248_11967578
347 Ga0105237_10048918
348 Ga0105033_104031
349 Ga0105239_10204915
350 Ga0105239_11949756
351 Ga0105239_12674920
352 Ga0157373_10538811
353 Ga0157371_10288701
354 Ga0157371_10738744
355 Ga0157371_11191563
356 Ga0157369_10006740
357 Ga0157369_10378872
358 Ga0157369_10385192
359 Ga0157369_10429856
360 Ga0157369_10853800
361 Ga0157369_12240738
362 Ga0157378_10991409
363 Ga0157372_11714962
364 Ga0157375_10287054
365 Ga0163163_10387533
366 Ga0157380_10702920
367 Ga0157376_10289684
368 Ga0163161_10055596
369 Ga0197907_10279393
370 Ga0206356_11268141
371 Ga0206355_1512095
372 Ga0206354_11189937
373 Ga0206353_10507229
374 Ga0206353_10552643
375 Ga0206353_10914521
376 Ga0206353_11812308
377 Ga0213873_10000144
378 Ga0213874_10178325
379 Ga0213874_10294946
380 Ga0213875_10012932
381 Ga0224712_10635447
382 Ga0207685_10000014
383 Ga0207705_10001599
384 Ga0207705_10002132
385 Ga0207705_10010058
386 Ga0207705_10230009
387 Ga0207705_10677168
388 Ga0207705_10705496
389 Ga0207705_11247743
390 Ga0207707_10000737
391 Ga0207707_10001969
392 Ga0207707_10069642
393 Ga0207707_10086705
394 Ga0207707_10590267
395 Ga0207707_11188091
396 Ga0207707_11306238
397 Ga0207671_10010049
398 Ga0207660_10000168
399 Ga0207660_10002012
400 Ga0207660_10073551
401 Ga0207660_10114499
402 Ga0207660_10117109
403 Ga0207660_10184769
404 Ga0207657_10039259
405 Ga0207657_10061780
406 Ga0207657_10096666
407 Ga0207657_10180909
408 Ga0207657_10767320
409 Ga0207652_10000461
410 Ga0207652_10001037
411 Ga0207652_10043920
412 Ga0207652_10075477
413 Ga0207652_10262842
414 Ga0207652_10406748
415 Ga0207652_10484675
416 Ga0207652_10550094
417 Ga0207646_11121465
418 Ga0207700_10895976
419 Ga0207700_11849336
420 Ga0207664_11002250
421 Ga0207706_11324432
422 Ga0207686_10113816
423 Ga0207686_10785982
424 Ga0207709_10644608
425 Ga0207665_10656833
426 Ga0207691_10610888
427 Ga0207661_10049113
428 Ga0207661_10108317
429 Ga0207661_10469220
430 Ga0207661_11017907
431 Ga0207661_11296111
432 Ga0207667_10163719
433 Ga0207667_10541397
434 Ga0207658_11458162
435 Ga0207702_12035406
436 Ga0207676_10653561
437 Ga0207675_102140176
438 Ga0265319_1027216
439 Ga0265334_10000639
440 Ga0265318_10038894
441 Ga0265323_10004404
442 Ga0265323_10025914
443 Ga0265323_10042283
444 Ga0265323_10107688
445 Ga0265323_10225978
446 Ga0265322_10001546
447 Ga0265322_10015405
448 Ga0265322_10031164
449 Ga0265322_10119007
450 Ga0265336_10013716
451 Ga0265338_10021759
452 Ga0265338_10089915
453 Ga0265324_10295137
454 Ga0265330_10024147
455 Ga0265332_10041650
456 Ga0265332_10076547
457 Ga0265320_10002960
458 Ga0265320_10014566
459 Ga0265329_10005739
460 Ga0265329_10013270
461 Ga0265329_10077983
462 Ga0265340_10210467
463 Ga0265340_10355735
464 Ga0265339_10023245
465 Ga0265339_10034171
466 Ga0265316_10001088
467 Ga0265316_10001137
468 Ga0265316_10001345
469 Ga0265316_10001957
470 Ga0265316_10007348
471 Ga0265316_10014464
472 Ga0265316_10035334
473 Ga0265316_10052997
474 Ga0265316_10112368
475 Ga0265316_10300797
476 Ga0316579_10150216
477 Ga0265314_10032420
478 Ga0265314_10124367
479 Ga0265342_10000028
480 Ga0265342_10000111
481 Ga0265342_10000391
482 Ga0265342_10063427
483 Ga0316574_0112283
484 Ga0373924_0316705
485 Ga0316584_0116815
486 Ga0395898_0159294
487 Ga0436364_0404799
488 Ga0395901_0175092
489 Ga0395901_0971814
490 Ga0436365_0584086
491 Ga0436363_0085556
492 Ga0436363_1129967
493 Ga0436363_1313958
494 Ga0436362_0543778
495 Ga0436362_1030512
496 Ga0466969_0294381
497 Ga0466966_0046434
498 Ga0466966_0114696
499 Ga0466966_0284793
500 Ga0466966_0574571
501 Ga0466961_0005516
502 Ga0466961_0032362
503 Ga0466961_0079308
504 Ga0466961_0098763
505 Ga0466961_0131024
506 Ga0466961_0201912
507 Ga0453684_0382428
508 Ga0453684_0397273
509 Ga0453684_0403771
510 Ga0453684_2438118
511 Ga0466957_0349487
512 Ga0466959_0176154
513 Ga0466959_0821859
514 Ga0451576_2387238
515 Ga0466958_0077132
516 Ga0466958_0320112
517 Ga0466967_0846750
518 Ga0466967_1229454
519 Ga0466967_1529309
520 Ga0495651_0191890
521 Ga0495653_0927849
522 Ga0495608_0063499
523 Ga0495657_0164405
524 Ga0495669_0128820
525 Ga0495600_0571123
526 Ga0495675_0559091
527 Ga0496102_0190858
528 Ga0496108_0252531
529 Ga0496111_0451314
530 Ga0496112_0867804
531 Ga0496113_0702699
532 Ga0496117_0076241
533 Ga0496118_0015611
534 Ga0501031_0659513
535 Ga0501036_0901243
536 Ga0501042_0658245
537 Ga0501067_0416253
538 Ga0495595_0114273
539 Ga0466962_0629022
540 8056449919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

17

122

0.97

PF11582

DUF3240

Protein of unknown function (DUF3240)

7

118

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9946 1 112
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.992 1 108
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9896 2 112
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.9888 1 108
6yc7-assembly1.cif.gz_F structure of adenylylated c. glutamicum glnk 0.9879 1 112
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9747 1 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9648 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9642 2 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9617 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.931 2 109 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A7Y8HQB2-F1-model_v4 P-II family nitrogen regulator 0.984 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A2N3F8I2-F1-model_v4 Transcriptional regulator 0.9817 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0009399
GO:0030234
AF-W0I613-F1-model_v4 Putative Nitrogen regulatory protein P-II 0.9813 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A7J6ZCP2-F1-model_v4 deleted 0.9762 1 105
AF-A0A181C720-F1-model_v4 deleted 0.9746 2 112

Map