F384277

General Info

Members Datasets Scaffolds Average Seq Length
281 159 562 398

Family's Representative Sequence

Representative Sequence 3300009984|Ga0105029_101279|Ga0105029_1012791
Length 421
Sequence VSKPEKSPTLTQVMEQKKEEQFNLEEIKKKALEQFRSGKSLYGKDGAFAPLLKSFLEAALEGEMESHLDEDERQEGNRRNGKTRKTVQTSSGPVVLETSRDRNGTFEPELVKKRETVLADTLEGKILGMYGLGMSFRDISSHLKEMYDADISHSTLSAITDRIIPAIKEWQARPLESLYCIVWLDAMHYKVKDQGKIVSRAVYHILGINQEGRKELLGMYVSESEGANFWLGVLSDLRNRGLEDILIACIDNLKGFAEAIQATFPKTEVQSCIVHQIRNSLKYVASKDQKPFLTDLKEVYQASTKEFAEQQLDALDEKWGKKYPVVIASWRNNWAKLSTYFKYDPSIRKLIYTTNTIEGFHRQVRKVTKTKGAFPSDMALLKLIYLAYTNIQKKWTHPLQNWSITVSQLAIWFEGRMHLSI

Samples

Sample ID Description Type Environment
1 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
96 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
97 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
100 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
115 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
141 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
142 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
143 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
144 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
147 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
148 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
156 2739367651 Pedobacter sp. OK291 Isolate Unclassified
157 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
158 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
159 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 0.71
Rhizosphere 82.92
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105029_101279 3300009984 Bacteria 1535
2 JGI24741J21665_1011604 3300001915 Bacteria 1534
3 JGI24740J21852_10038086 3300001979 Bacteria 1478
4 rootH1_10073719 3300003316 Bacteria 1352
5 rootH1_10097048 3300003316 Bacteria 1551
6 rootH2_10002202 3300003320 Bacteria 120052
7 rootH2_10009245 3300003320 Bacteria 27016
8 rootH2_10054091 3300003320 Bacteria 3491
9 rootH2_10054092 3300003320 Bacteria 6104
10 rootH2_10101222 3300003320 Unclassified 1367
11 rootL2_10103824 3300003322 Bacteria 5695
12 rootL2_10153601 3300003322 Bacteria 6173
13 rootH1_10002411 3300003323 Bacteria 3666
14 rootH1_10040578 3300003323 Bacteria 1467
15 rootH1_10053236 3300003323 Bacteria 1449
16 rootH1_10190823 3300003323 Bacteria 1310
17 Ga0070658_10144946 3300005327 Bacteria 1985
18 Ga0070658_10176730 3300005327 Bacteria 1796
19 Ga0070658_10206928 3300005327 Bacteria 1657
20 Ga0070658_10267172 3300005327 Unclassified 1454
21 Ga0070666_10010736 3300005335 Bacteria 5730
22 Ga0070680_100167023 3300005336 Bacteria 1850
23 Ga0070680_100176382 3300005336 Bacteria 1799
24 Ga0070680_100201080 3300005336 Bacteria 1680
25 Ga0068868_100323897 3300005338 Bacteria 1313
26 Ga0070660_100022871 3300005339 Bacteria 4628
27 Ga0070660_100151527 3300005339 Bacteria 1864
28 Ga0070660_100202036 3300005339 Bacteria 1612
29 Ga0070689_100199954 3300005340 Bacteria 1631
30 Ga0070661_100133625 3300005344 Bacteria 1865
31 Ga0070659_100035611 3300005366 Unclassified 3876
32 Ga0070659_100256614 3300005366 Unclassified 1450
33 Ga0070662_100089226 3300005457 Unclassified 2312
34 Ga0070681_10114433 3300005458 Unclassified 2636
35 Ga0070681_10168079 3300005458 Bacteria 2115
36 Ga0070681_10327103 3300005458 Bacteria 1442
37 Ga0070679_100239007 3300005530 Unclassified 1774
38 Ga0070679_100279604 3300005530 Unclassified 1622
39 Ga0070684_100009909 3300005535 Bacteria 7530
40 Ga0070684_100173531 3300005535 Bacteria 1959
41 Ga0070684_100202046 3300005535 Bacteria 1810
42 Ga0070697_100278333 3300005536 Bacteria 1435
43 Ga0068853_100300671 3300005539 Unclassified 1483
44 Ga0068853_100336232 3300005539 Bacteria 1402
45 Ga0068855_100063462 3300005563 Bacteria 4311
46 Ga0068855_100179090 3300005563 Bacteria 2397
47 Ga0068855_100280934 3300005563 Bacteria 1849
48 Ga0068855_100349654 3300005563 Bacteria 1628
49 Ga0068855_100363729 3300005563 Unclassified 1592
50 Ga0068855_100434587 3300005563 Bacteria 1434
51 Ga0070664_100273695 3300005564 Bacteria 1521
52 Ga0068857_100079278 3300005577 Unclassified 2932
53 Ga0068857_100134451 3300005577 Bacteria 2232
54 Ga0068857_100295478 3300005577 Unclassified 1492
55 Ga0068856_100155311 3300005614 Bacteria 2298
56 Ga0068856_100380138 3300005614 Bacteria 1431
57 Ga0068852_100039308 3300005616 Bacteria 3982
58 Ga0068852_100260969 3300005616 Unclassified 1663
59 Ga0068852_100320505 3300005616 Bacteria 1505
60 Ga0068858_100284827 3300005842 Unclassified 1574
61 Ga0068860_100298586 3300005843 Unclassified 1577
62 Ga0068862_100079056 3300005844 Bacteria 2851
63 Ga0068862_100185991 3300005844 Viruses 1867
64 Ga0070717_10234748 3300006028 Bacteria 1615
65 Ga0075364_10170532 3300006051 Unclassified 1471
66 Ga0097621_100045167 3300006237 Bacteria 3557
67 Ga0105240_10000232 3300009093 Bacteria 110394
68 Ga0105240_10019373 3300009093 Bacteria 9092
69 Ga0105240_10021831 3300009093 Bacteria 8507
70 Ga0105240_10023871 3300009093 Bacteria 8077
71 Ga0105240_10164845 3300009093 Bacteria 2629
72 Ga0105240_10354270 3300009093 Bacteria 1664
73 Ga0105240_10367807 3300009093 Bacteria 1627
74 Ga0105241_10054545 3300009174 Bacteria 3060
75 Ga0105241_10216583 3300009174 Unclassified 1607
76 Ga0105237_10004986 3300009545 Bacteria 15131
77 Ga0105237_10022364 3300009545 Bacteria 6488
78 Ga0105249_10174763 3300009553 Unclassified 2085
79 Ga0105249_10341914 3300009553 Bacteria 1513
80 Ga0105239_10274752 3300010375 Bacteria 1896
81 Ga0105239_10340354 3300010375 Unclassified 1693
82 Ga0157373_10006680 3300013100 Bacteria 8592
83 Ga0157373_10160154 3300013100 Unclassified 1584
84 Ga0157371_10084409 3300013102 Bacteria 2250
85 Ga0157371_10113479 3300013102 Bacteria 1924
86 Ga0157371_10131806 3300013102 Bacteria 1779
87 Ga0157371_10133746 3300013102 Bacteria 1765
88 Ga0157371_10154844 3300013102 Bacteria 1635
89 Ga0157371_10165601 3300013102 Unclassified 1579
90 Ga0157371_10177477 3300013102 Bacteria 1523
91 Ga0157370_10025994 3300013104 Bacteria 5785
92 Ga0157370_10138029 3300013104 Unclassified 2272
93 Ga0157370_10139538 3300013104 Unclassified 2259
94 Ga0157370_10226423 3300013104 Bacteria 1731
95 Ga0157370_10271861 3300013104 Unclassified 1566
96 Ga0157369_10378725 3300013105 Bacteria 1469
97 Ga0157369_10437236 3300013105 Bacteria 1355
98 Ga0157374_10116154 3300013296 Bacteria 2578
99 Ga0157374_10355274 3300013296 Bacteria 1457
100 Ga0157378_10091954 3300013297 Bacteria 2760
101 Ga0157378_10425764 3300013297 Bacteria 1313
102 Ga0163162_10000423 3300013306 Bacteria 39010
103 Ga0157372_10073267 3300013307 Bacteria 3860
104 Ga0157372_10273839 3300013307 Bacteria 1962
105 Ga0157372_10371887 3300013307 Bacteria 1665
106 Ga0163163_10206990 3300014325 Bacteria 2010
107 Ga0157380_10249622 3300014326 Bacteria 1605
108 Ga0182006_1024083 3300015261 Bacteria 2514
109 Ga0182006_1034150 3300015261 Bacteria 2036
110 Ga0209050_1019282 3300025298 Bacteria 2599
111 Ga0207680_10124840 3300025903 Unclassified 1688
112 Ga0207647_10054928 3300025904 Bacteria 2448
113 Ga0207647_10127667 3300025904 Bacteria 1496
114 Ga0207705_10190617 3300025909 Unclassified 1550
115 Ga0207705_10201946 3300025909 Bacteria 1506
116 Ga0207705_10207256 3300025909 Bacteria 1486
117 Ga0207654_10032415 3300025911 Bacteria 2887
118 Ga0207654_10127226 3300025911 Bacteria 1608
119 Ga0207707_10131090 3300025912 Unclassified 2192
120 Ga0207707_10231543 3300025912 Bacteria 1607
121 Ga0207707_10253519 3300025912 Bacteria 1528
122 Ga0207707_10313721 3300025912 Bacteria 1355
123 Ga0207695_10000169 3300025913 Bacteria 192566
124 Ga0207695_10012598 3300025913 Bacteria 10134
125 Ga0207695_10027072 3300025913 Bacteria 6388
126 Ga0207695_10118562 3300025913 Bacteria 2617
127 Ga0207695_10205213 3300025913 Bacteria 1884
128 Ga0207695_10261595 3300025913 Bacteria 1628
129 Ga0207671_10010140 3300025914 Bacteria 7807
130 Ga0207671_10017608 3300025914 Bacteria 5502
131 Ga0207660_10222989 3300025917 Bacteria 1480
132 Ga0207657_10014423 3300025919 Bacteria 7719
133 Ga0207657_10096858 3300025919 Bacteria 2454
134 Ga0207657_10209239 3300025919 Bacteria 1566
135 Ga0207649_10116206 3300025920 Bacteria 1796
136 Ga0207652_10255574 3300025921 Bacteria 1580
137 Ga0207652_10277366 3300025921 Bacteria 1512
138 Ga0207694_10076760 3300025924 Bacteria 2617
139 Ga0207690_10204994 3300025932 Bacteria 1500
140 Ga0207670_10192829 3300025936 Bacteria 1543
141 Ga0207661_10036551 3300025944 Bacteria 3834
142 Ga0207679_10065493 3300025945 Bacteria 2719
143 Ga0207667_10000905 3300025949 Bacteria 37857
144 Ga0207667_10011623 3300025949 Bacteria 10221
145 Ga0207667_10347346 3300025949 Bacteria 1513
146 Ga0207667_10390548 3300025949 Unclassified 1417
147 Ga0207668_10300969 3300025972 Bacteria 1323
148 Ga0207677_10161309 3300026023 Bacteria 1742
149 Ga0207639_10192180 3300026041 Bacteria 1744
150 Ga0207639_10250340 3300026041 Unclassified 1545
151 Ga0207639_10258722 3300026041 Bacteria 1521
152 Ga0207702_10021405 3300026078 Bacteria 5353
153 Ga0207702_10313028 3300026078 Bacteria 1493
154 Ga0207674_10059618 3300026116 Bacteria 3861
155 Ga0207674_10064926 3300026116 Bacteria 3681
156 Ga0207674_10095661 3300026116 Bacteria 2956
157 Ga0207674_10146271 3300026116 Unclassified 2322
158 Ga0207674_10203813 3300026116 Bacteria 1927
159 Ga0207698_10162400 3300026142 Bacteria 1956
160 Ga0268266_10402388 3300028379 Bacteria 1294
161 Ga0268265_10206410 3300028380 Bacteria 1708
162 Ga0268265_10309206 3300028380 Viruses 1426
163 Ga0268264_10000041 3300028381 Bacteria 372501
164 Ga0268264_10273800 3300028381 Unclassified 1578
165 Ga0307508_10220338 3300031616 Bacteria 1497
166 Ga0307516_10000379 3300031730 Bacteria 58257
167 Ga0307405_10186315 3300031731 Bacteria 1494
168 Ga0307413_10206131 3300031824 Bacteria 1424
169 Ga0307413_10209479 3300031824 Bacteria 1414
170 Ga0307410_10128820 3300031852 Bacteria 1856
171 Ga0307407_10139861 3300031903 Bacteria 1560
172 Ga0307412_10220140 3300031911 Bacteria 1454
173 Ga0307416_100375612 3300032002 Bacteria 1449
174 Ga0307414_10115696 3300032004 Bacteria 2051
175 Ga0307414_10125632 3300032004 Bacteria 1981
176 Ga0307414_10179661 3300032004 Bacteria 1701
177 Ga0307414_10199749 3300032004 Bacteria 1625
178 Ga0307414_10215238 3300032004 Unclassified 1573
179 Ga0307414_10273219 3300032004 Bacteria 1416
180 Ga0307411_10169743 3300032005 Bacteria 1643
181 Ga0307415_100211940 3300032126 Bacteria 1546
182 Ga0307510_10030558 3300033180 Bacteria 6104
183 Ga0373935_0087511 3300035692 Bacteria 2034
184 Ga0316582_0141629 3300036647 Unclassified 1621
185 Ga0316582_0178215 3300036647 Bacteria 1445
186 Ga0316584_0137378 3300036712 Bacteria 1824
187 Ga0395899_0000806 3300037312 Bacteria 30625
188 Ga0395899_0093730 3300037312 Bacteria 2173
189 Ga0395899_0171713 3300037312 Bacteria 1526
190 Ga0395899_0182323 3300037312 Bacteria 1473
191 Ga0395899_0183066 3300037312 Unclassified 1469
192 Ga0395900_0034164 3300037418 Bacteria 5235
193 Ga0395900_0258077 3300037418 Bacteria 1741
194 Ga0395900_0343110 3300037418 Bacteria 1468
195 Ga0395898_0003048 3300037466 Bacteria 18987
196 Ga0395898_0054623 3300037466 Bacteria 3896
197 Ga0395898_0326855 3300037466 Bacteria 1462
198 Ga0395901_0024029 3300038443 Bacteria 6251
199 Ga0395901_0296912 3300038443 Bacteria 1675
200 Ga0395901_0322667 3300038443 Bacteria 1597
201 Ga0400484_02964 3300038725 Bacteria 7737
202 Ga0400491_07149 3300038727 Bacteria 1565
203 Ga0400488_02236 3300038741 Bacteria 4172
204 Ga0400488_56657 3300038741 Bacteria 1805
205 Ga0400483_060274 3300039062 Bacteria 1386
206 Ga0400483_282367 3300039062 Bacteria 1276
207 Ga0400489_71599 3300039093 Bacteria 1519
208 Ga0400489_88682 3300039093 Bacteria 2820
209 Ga0400487_47433 3300039110 Bacteria 3926
210 Ga0436365_0520212 3300039437 Bacteria 2271
211 Ga0439436_0024013 3300041404 Bacteria 1801
212 Ga0439438_030550 3300041405 Bacteria 1436
213 Ga0439439_0018169 3300041406 Bacteria 1735
214 Ga0439461_0017970 3300041410 Bacteria 1379
215 Ga0439465_0014323 3300041413 Bacteria 2472
216 Ga0451807_0024369 3300041486 Bacteria 1985
217 Ga0451807_2492621 3300041486 Bacteria 1883
218 Ga0451853_1995651 3300041512 Bacteria 4893
219 Ga0439431_0011183 3300041997 Bacteria 2046
220 Ga0439442_012925 3300042002 Bacteria 1710
221 Ga0439445_0010830 3300042004 Bacteria 2165
222 Ga0439457_017246 3300042014 Bacteria 1604
223 Ga0439462_0007461 3300042015 Bacteria 2738
224 Ga0450897_000311 3300042128 Bacteria 2577
225 Ga0450905_006700 3300042142 Bacteria 1562
226 Ga0439446_0017527 3300042156 Bacteria 2002
227 Ga0439434_0023659 3300042435 Bacteria 1850
228 Ga0466972_0070307 3300044658 Unclassified 1670
229 Ga0466965_0070818 3300044683 Bacteria 1753
230 Ga0466970_0089505 3300044765 Bacteria 1670
231 Ga0466957_0112368 3300044842 Unclassified 1729
232 Ga0451576_0325925 3300045051 Unclassified 1607
233 Ga0451576_0628422 3300045051 Bacteria 1128
234 Ga0495651_0195074 3300046462 Bacteria 1422
235 Ga0495630_0247077 3300046517 Bacteria 1363
236 Ga0495643_0115572 3300046522 Bacteria 1360
237 Ga0495668_0000153 3300046616 Bacteria 104580
238 Ga0495625_0116096 3300046660 Bacteria 1826
239 Ga0495636_0000670 3300047318 Bacteria 12571
240 Ga0495686_0042201 3300047472 Unclassified 2902
241 Ga0495686_0107273 3300047472 Bacteria 1678
242 Ga0495686_0146114 3300047472 Bacteria 1391
243 Ga0496122_0001885 3300048925 Bacteria 31746
244 Ga0496125_0101309 3300048928 Bacteria 2120
245 Ga0501032_0105488 3300049569 Bacteria 1867
246 Ga0501033_0130688 3300049570 Bacteria 1819
247 Ga0501034_0066277 3300049571 Unclassified 3624
248 Ga0501034_0239123 3300049571 Bacteria 1762
249 Ga0501038_0240773 3300049574 Bacteria 1436
250 Ga0501046_0187683 3300049580 Bacteria 1543
251 Ga0501048_0159663 3300049582 Bacteria 1595
252 Ga0501206_003283 3300049653 Unclassified 2052
253 Ga0501223_018387 3300049663 Bacteria 1375
254 Ga0501239_004417 3300049672 Bacteria 1379
255 Ga0501250_004723 3300049680 Bacteria 1370
256 Ga0501251_005138 3300049681 Bacteria 1377
257 Ga0501253_008232 3300049683 Bacteria 1492
258 Ga0501261_008716 3300049690 Bacteria 1313
259 Ga0501225_0038976 3300049705 Bacteria 1309
260 Ga0501241_002018 3300049758 Bacteria 3981
261 Ga0501270_001857 3300049767 Bacteria 2093
262 Ga0501271_002463 3300049768 Bacteria 1655
263 Ga0501035_0139264 3300049822 Bacteria 2110
264 Ga0501035_0357137 3300049822 Bacteria 1222
265 Ga0500646_0027320 3300053090 Bacteria 1552
266 Ga0500646_0028031 3300053090 Bacteria 1536
267 Ga0500559_0065180 3300053136 Bacteria 1631
268 Ga0500588_0023352 3300053146 Unclassified 1694
269 Ga0500616_0057121 3300053153 Bacteria 2034
270 Ga0500645_026952 3300053730 Bacteria 1745
271 Ga0500661_003496 3300055283 Bacteria 2946
272 2739591419 2739367651 Bacteria 6359826
273 2884792153 2884791551 Bacteria 8511252
274 2884792713 2884791551 Bacteria 8511252
275 2884794355 2884791551 Bacteria 8511252
276 2884794640 2884791551 Bacteria 8511252
277 2884797081 2884791551 Bacteria 8511252
278 2884798202 2884791551 Bacteria 8511252
279 2884798357 2884791551 Bacteria 8511252
280 2896344314 2896344016 Bacteria 3811746
281 2916179181 2916178963 Bacteria 5265078
282 Ga0105029_101279
283 JGI24741J21665_1011604
284 JGI24740J21852_10038086
285 rootH1_10073719
286 rootH1_10097048
287 rootH2_10002202
288 rootH2_10009245
289 rootH2_10054091
290 rootH2_10054092
291 rootH2_10101222
292 rootL2_10103824
293 rootL2_10153601
294 rootH1_10002411
295 rootH1_10040578
296 rootH1_10053236
297 rootH1_10190823
298 Ga0070658_10144946
299 Ga0070658_10176730
300 Ga0070658_10206928
301 Ga0070658_10267172
302 Ga0070666_10010736
303 Ga0070680_100167023
304 Ga0070680_100176382
305 Ga0070680_100201080
306 Ga0068868_100323897
307 Ga0070660_100022871
308 Ga0070660_100151527
309 Ga0070660_100202036
310 Ga0070689_100199954
311 Ga0070661_100133625
312 Ga0070659_100035611
313 Ga0070659_100256614
314 Ga0070662_100089226
315 Ga0070681_10114433
316 Ga0070681_10168079
317 Ga0070681_10327103
318 Ga0070679_100239007
319 Ga0070679_100279604
320 Ga0070684_100009909
321 Ga0070684_100173531
322 Ga0070684_100202046
323 Ga0070697_100278333
324 Ga0068853_100300671
325 Ga0068853_100336232
326 Ga0068855_100063462
327 Ga0068855_100179090
328 Ga0068855_100280934
329 Ga0068855_100349654
330 Ga0068855_100363729
331 Ga0068855_100434587
332 Ga0070664_100273695
333 Ga0068857_100079278
334 Ga0068857_100134451
335 Ga0068857_100295478
336 Ga0068856_100155311
337 Ga0068856_100380138
338 Ga0068852_100039308
339 Ga0068852_100260969
340 Ga0068852_100320505
341 Ga0068858_100284827
342 Ga0068860_100298586
343 Ga0068862_100079056
344 Ga0068862_100185991
345 Ga0070717_10234748
346 Ga0075364_10170532
347 Ga0097621_100045167
348 Ga0105240_10000232
349 Ga0105240_10019373
350 Ga0105240_10021831
351 Ga0105240_10023871
352 Ga0105240_10164845
353 Ga0105240_10354270
354 Ga0105240_10367807
355 Ga0105241_10054545
356 Ga0105241_10216583
357 Ga0105237_10004986
358 Ga0105237_10022364
359 Ga0105249_10174763
360 Ga0105249_10341914
361 Ga0105239_10274752
362 Ga0105239_10340354
363 Ga0157373_10006680
364 Ga0157373_10160154
365 Ga0157371_10084409
366 Ga0157371_10113479
367 Ga0157371_10131806
368 Ga0157371_10133746
369 Ga0157371_10154844
370 Ga0157371_10165601
371 Ga0157371_10177477
372 Ga0157370_10025994
373 Ga0157370_10138029
374 Ga0157370_10139538
375 Ga0157370_10226423
376 Ga0157370_10271861
377 Ga0157369_10378725
378 Ga0157369_10437236
379 Ga0157374_10116154
380 Ga0157374_10355274
381 Ga0157378_10091954
382 Ga0157378_10425764
383 Ga0163162_10000423
384 Ga0157372_10073267
385 Ga0157372_10273839
386 Ga0157372_10371887
387 Ga0163163_10206990
388 Ga0157380_10249622
389 Ga0182006_1024083
390 Ga0182006_1034150
391 Ga0209050_1019282
392 Ga0207680_10124840
393 Ga0207647_10054928
394 Ga0207647_10127667
395 Ga0207705_10190617
396 Ga0207705_10201946
397 Ga0207705_10207256
398 Ga0207654_10032415
399 Ga0207654_10127226
400 Ga0207707_10131090
401 Ga0207707_10231543
402 Ga0207707_10253519
403 Ga0207707_10313721
404 Ga0207695_10000169
405 Ga0207695_10012598
406 Ga0207695_10027072
407 Ga0207695_10118562
408 Ga0207695_10205213
409 Ga0207695_10261595
410 Ga0207671_10010140
411 Ga0207671_10017608
412 Ga0207660_10222989
413 Ga0207657_10014423
414 Ga0207657_10096858
415 Ga0207657_10209239
416 Ga0207649_10116206
417 Ga0207652_10255574
418 Ga0207652_10277366
419 Ga0207694_10076760
420 Ga0207690_10204994
421 Ga0207670_10192829
422 Ga0207661_10036551
423 Ga0207679_10065493
424 Ga0207667_10000905
425 Ga0207667_10011623
426 Ga0207667_10347346
427 Ga0207667_10390548
428 Ga0207668_10300969
429 Ga0207677_10161309
430 Ga0207639_10192180
431 Ga0207639_10250340
432 Ga0207639_10258722
433 Ga0207702_10021405
434 Ga0207702_10313028
435 Ga0207674_10059618
436 Ga0207674_10064926
437 Ga0207674_10095661
438 Ga0207674_10146271
439 Ga0207674_10203813
440 Ga0207698_10162400
441 Ga0268266_10402388
442 Ga0268265_10206410
443 Ga0268265_10309206
444 Ga0268264_10000041
445 Ga0268264_10273800
446 Ga0307508_10220338
447 Ga0307516_10000379
448 Ga0307405_10186315
449 Ga0307413_10206131
450 Ga0307413_10209479
451 Ga0307410_10128820
452 Ga0307407_10139861
453 Ga0307412_10220140
454 Ga0307416_100375612
455 Ga0307414_10115696
456 Ga0307414_10125632
457 Ga0307414_10179661
458 Ga0307414_10199749
459 Ga0307414_10215238
460 Ga0307414_10273219
461 Ga0307411_10169743
462 Ga0307415_100211940
463 Ga0307510_10030558
464 Ga0373935_0087511
465 Ga0316582_0141629
466 Ga0316582_0178215
467 Ga0316584_0137378
468 Ga0395899_0000806
469 Ga0395899_0093730
470 Ga0395899_0171713
471 Ga0395899_0182323
472 Ga0395899_0183066
473 Ga0395900_0034164
474 Ga0395900_0258077
475 Ga0395900_0343110
476 Ga0395898_0003048
477 Ga0395898_0054623
478 Ga0395898_0326855
479 Ga0395901_0024029
480 Ga0395901_0296912
481 Ga0395901_0322667
482 Ga0400484_02964
483 Ga0400491_07149
484 Ga0400488_02236
485 Ga0400488_56657
486 Ga0400483_060274
487 Ga0400483_282367
488 Ga0400489_71599
489 Ga0400489_88682
490 Ga0400487_47433
491 Ga0436365_0520212
492 Ga0439436_0024013
493 Ga0439438_030550
494 Ga0439439_0018169
495 Ga0439461_0017970
496 Ga0439465_0014323
497 Ga0451807_0024369
498 Ga0451807_2492621
499 Ga0451853_1995651
500 Ga0439431_0011183
501 Ga0439442_012925
502 Ga0439445_0010830
503 Ga0439457_017246
504 Ga0439462_0007461
505 Ga0450897_000311
506 Ga0450905_006700
507 Ga0439446_0017527
508 Ga0439434_0023659
509 Ga0466972_0070307
510 Ga0466965_0070818
511 Ga0466970_0089505
512 Ga0466957_0112368
513 Ga0451576_0325925
514 Ga0451576_0628422
515 Ga0495651_0195074
516 Ga0495630_0247077
517 Ga0495643_0115572
518 Ga0495668_0000153
519 Ga0495625_0116096
520 Ga0495636_0000670
521 Ga0495686_0042201
522 Ga0495686_0107273
523 Ga0495686_0146114
524 Ga0496122_0001885
525 Ga0496125_0101309
526 Ga0501032_0105488
527 Ga0501033_0130688
528 Ga0501034_0066277
529 Ga0501034_0239123
530 Ga0501038_0240773
531 Ga0501046_0187683
532 Ga0501048_0159663
533 Ga0501206_003283
534 Ga0501223_018387
535 Ga0501239_004417
536 Ga0501250_004723
537 Ga0501251_005138
538 Ga0501253_008232
539 Ga0501261_008716
540 Ga0501225_0038976
541 Ga0501241_002018
542 Ga0501270_001857
543 Ga0501271_002463
544 Ga0501035_0139264
545 Ga0501035_0357137
546 Ga0500646_0027320
547 Ga0500646_0028031
548 Ga0500559_0065180
549 Ga0500588_0023352
550 Ga0500616_0057121
551 Ga0500645_026952
552 Ga0500661_003496
553 2739591419
554 2884792153
555 2884792713
556 2884794355
557 2884794640
558 2884797081
559 2884798202
560 2884798357
561 2896344314
562 2916179181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00872

Transposase_mut

Transposase, Mutator family

23

398

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg8-assembly1.cif.gz_B iscth4 transposase, pre-cleaved complex, pcc 0.9146 101 399
6xgx-assembly1.cif.gz_B iscth4 transposase, strand transfer complex 1, stc1 0.801 4 399
6xgx-assembly1.cif.gz_B iscth4 transposase, strand transfer complex 1, stc1 0.7926 4 399
6xgw-assembly1.cif.gz_B iscth4 transposase, pre-reaction complex, prc 0.7874 6 399
6xgw-assembly1.cif.gz_B iscth4 transposase, pre-reaction complex, prc 0.7853 6 399
ID Description Score Start End Superfamily
af_K7LV62_47_129_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8636 198 262 3.30.420.10
af_I1MFY3_263_357_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8341 165 261 3.30.420.10
af_Q2QXD6_295_388_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8297 183 262 3.30.420.10
af_K7L793_270_365_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8169 165 261 3.30.420.10
af_A0A0P0VHN3_509_601_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8156 183 258 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4Q0Z9H5-F1-model_v4 Mutator family transposase 0.9938 117 248 GO:0003677
GO:0004803
GO:0006313
AF-A0A1J5NA35-F1-model_v4 Mutator family transposase 0.9932 113 254 GO:0003677
GO:0004803
GO:0006313
AF-A0A1G9ZXE4-F1-model_v4 Mutator family transposase 0.9913 109 233 GO:0003677
GO:0004803
GO:0006313
AF-D5BJJ1-F1-model_v4 Mutator family transposase 0.9888 117 399 GO:0003677
GO:0004803
GO:0006313
AF-A0A2A5K2R8-F1-model_v4 deleted 0.9875 158 256

Map