F384176

General Info

Members Datasets Scaffolds Average Seq Length
281 204 264 410

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100001306|Ga0068859_10000130618
Length 433
Sequence MKMIGDWLAAEGLAMPGPGEFFAAGFAFTLALLALLSGWIAGRRLGPRAGALWVRRVGGHVEGVAPRIGQIVRHGSAALLLALVYNADDWTSLARVGLGFALASATALLMVAILRGVSLPRWVAWSVAGTIFVAILSSALGGLHGLSEGLDAVGFAIGKRRFSLLALLTIVIXXXXLFAAVRFANRIVSHSIHQSRGFDPAQKLLFEKLSTIAIIVAAFFVGIDLLDIDLTSLAVFSGAVGLAVGFGLQKTVGNLIAGIILLTDRSIKPGDVIVVGDSFGWVNKIGVRAVSVITREGKEHLIPNENLMTQEVENWSYSNRNVRLRIPVSVAYDCDLKLAQELMLRAATESPRVLDEPRPNVWLVEFGESAVKHEIRVWISDPEGGVSNLRSDVLNRLWWLFKEHGIVIPFPQRDVRIRQWSGTPVQGGDTEPS

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
5 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
6 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
7 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
8 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
9 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
10 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
13 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
14 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
15 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
16 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
17 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
141 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
185 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.95
Metatranscriptomes 0
Isolates 6.05

Biome Distribution

Category Percentage (%)
Aerial Root 1.07
Bulb 0
Endosphere 21.35
Nodule 0
Rhizoplane 2.85
Rhizosphere 62.99
Stem 0
Stem Tuber 0
Unclassified 11.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000512 3300001904 Bacteria 7242
2 JGI24741J21665_1000327 3300001915 Bacteria 14251
3 JGI24740J21852_10003334 3300001979 Bacteria 7075
4 JGI24740J21852_10009038 3300001979 Bacteria 3923
5 JGI24737J22298_10001891 3300001990 Bacteria 7484
6 JGI24735J21928_10002500 3300002067 Bacteria 6374
7 JGI25165J46597_1000039 3300003214 Bacteria 281327
8 JGI25153J46596_10000027 3300003215 Bacteria 210760
9 JGI25153J46596_10000119 3300003215 Bacteria 89604
10 Ga0055525_1000012 3300003759 Bacteria 486564
11 Ga0055542_1000094 3300003762 Bacteria 119899
12 Ga0055529_1000045 3300003763 Bacteria 209617
13 Ga0055526_1002387 3300003771 Bacteria 12720
14 Ga0055526_1004578 3300003771 Bacteria 8250
15 Ga0055537_1000624 3300003773 Bacteria 19260
16 Ga0055537_1002194 3300003773 Bacteria 6800
17 Ga0055524_1000324 3300003775 Bacteria 44924
18 Ga0055530_10001898 3300003791 Bacteria 14338
19 Ga0055530_10004330 3300003791 Bacteria 7385
20 Ga0055540_1001940 3300003792 Bacteria 11569
21 Ga0055531_10000090 3300003794 Bacteria 100342
22 Ga0065165_1003470 3300005262 Bacteria 11026
23 Ga0065165_1003823 3300005262 Bacteria 10033
24 Ga0065165_1004436 3300005262 Bacteria 8709
25 Ga0070658_10000002 3300005327 Bacteria 637290
26 Ga0070658_10006953 3300005327 Bacteria 9143
27 Ga0070676_10008910 3300005328 Bacteria 5424
28 Ga0070670_100142604 3300005331 Bacteria 2072
29 Ga0070660_100004027 3300005339 Bacteria 10145
30 Ga0070660_100052041 3300005339 Bacteria 3155
31 Ga0070661_100009943 3300005344 Bacteria 6599
32 Ga0070661_100016737 3300005344 Bacteria 5190
33 Ga0070668_100000037 3300005347 Bacteria 80771
34 Ga0070668_100190254 3300005347 Bacteria 1680
35 Ga0070675_100059239 3300005354 Bacteria 3159
36 Ga0070674_100006093 3300005356 Bacteria 7013
37 Ga0070674_100021325 3300005356 Bacteria 4155
38 Ga0070659_100009472 3300005366 Bacteria 7156
39 Ga0070659_100102749 3300005366 Bacteria 2301
40 Ga0070663_100110772 3300005455 Bacteria 2062
41 Ga0070678_100001761 3300005456 Bacteria 11660
42 Ga0070662_100044315 3300005457 Bacteria 3186
43 Ga0070662_100073370 3300005457 Bacteria 2528
44 Ga0068853_100151483 3300005539 Bacteria 2088
45 Ga0068853_100176512 3300005539 Bacteria 1935
46 Ga0070665_100000155 3300005548 Bacteria 125017
47 Ga0068855_100108618 3300005563 Bacteria 3186
48 Ga0070664_100014269 3300005564 Bacteria 6480
49 Ga0070664_100067998 3300005564 Bacteria 3045
50 Ga0068857_100024071 3300005577 Bacteria 5360
51 Ga0068854_100078194 3300005578 Bacteria 2436
52 Ga0068856_100020148 3300005614 Bacteria 6479
53 Ga0068856_100161192 3300005614 Bacteria 2253
54 Ga0068852_100049400 3300005616 Bacteria 3599
55 Ga0068859_100001306 3300005617 Bacteria 25460
56 Ga0068859_100011190 3300005617 Bacteria 9020
57 Ga0068864_100006179 3300005618 Bacteria 9821
58 Ga0068861_100000032 3300005719 Bacteria 66248
59 Ga0068851_10001067 3300005834 Bacteria 11866
60 Ga0068863_100000145 3300005841 Bacteria 74845
61 Ga0081539_10007730 3300005985 Bacteria 9640
62 Ga0081539_10025227 3300005985 Bacteria 3834
63 Ga0075368_10000271 3300006042 Bacteria 14892
64 Ga0075367_10002375 3300006178 Bacteria 8567
65 Ga0075430_100038457 3300006846 Bacteria 4052
66 Ga0097620_100001306 3300006931 Bacteria 25460
67 Ga0097620_100011190 3300006931 Bacteria 9020
68 Ga0105251_10011677 3300009011 Bacteria 5007
69 Ga0105240_10125430 3300009093 Bacteria 3086
70 Ga0105243_10000348 3300009148 Bacteria 49756
71 Ga0105241_10003268 3300009174 Bacteria 12063
72 Ga0105241_10004712 3300009174 Bacteria 10060
73 Ga0105248_10000237 3300009177 Bacteria 63727
74 Ga0105237_10019643 3300009545 Bacteria 6976
75 Ga0105238_10084946 3300009551 Bacteria 3154
76 Ga0105249_10035867 3300009553 Bacteria 4497
77 Ga0157373_10037716 3300013100 Bacteria 3463
78 Ga0157373_10044629 3300013100 Bacteria 3164
79 Ga0157371_10000032 3300013102 Bacteria 230252
80 Ga0157370_10037139 3300013104 Bacteria 4723
81 Ga0157370_10102278 3300013104 Bacteria 2683
82 Ga0157369_10010259 3300013105 Bacteria 10689
83 Ga0157369_10081358 3300013105 Bacteria 3466
84 Ga0157369_10120790 3300013105 Bacteria 2780
85 Ga0157374_10021724 3300013296 Bacteria 5715
86 Ga0163162_10006494 3300013306 Bacteria 11323
87 Ga0157372_10073407 3300013307 Bacteria 3857
88 Ga0157379_10038488 3300014968 Bacteria 4267
89 Ga0163161_10020370 3300017792 Bacteria 4654
90 Ga0213876_10000178 3300021384 Bacteria 65721
91 Ga0209563_100030 3300025230 Bacteria 489259
92 Ga0207425_1000005 3300025245 Bacteria 900502
93 Ga0207425_1022354 3300025245 Bacteria 1333
94 Ga0209148_1000011 3300025254 Bacteria 1196503
95 Ga0209129_1000501 3300025258 Bacteria 28470
96 Ga0209233_1000052 3300025261 Bacteria 445813
97 Ga0209565_1000011 3300025263 Bacteria 637062
98 Ga0209565_1000215 3300025263 Bacteria 66331
99 Ga0209455_1000006 3300025272 Bacteria 1196503
100 Ga0209025_1000763 3300025294 Bacteria 53526
101 Ga0209564_1001029 3300025295 Bacteria 34324
102 Ga0209758_1000002 3300025297 Bacteria 1400310
103 Ga0209758_1000328 3300025297 Bacteria 89656
104 Ga0209758_1010283 3300025297 Bacteria 5628
105 Ga0209050_1000001 3300025298 Bacteria 3563507
106 Ga0209050_1000051 3300025298 Bacteria 353153
107 Ga0209050_1001664 3300025298 Bacteria 22448
108 Ga0209050_1009643 3300025298 Bacteria 4904
109 Ga0209256_1000016 3300025299 Bacteria 599092
110 Ga0209051_1000518 3300025303 Bacteria 48528
111 Ga0209257_1000028 3300025304 Bacteria 699493
112 Ga0209257_1000555 3300025304 Bacteria 64065
113 Ga0209257_1000855 3300025304 Bacteria 43394
114 Ga0209257_1001184 3300025304 Bacteria 32997
115 Ga0209257_1013100 3300025304 Bacteria 3735
116 Ga0207656_10006535 3300025321 Bacteria 4198
117 Ga0207647_10013754 3300025904 Bacteria 5604
118 Ga0207645_10038998 3300025907 Bacteria 3044
119 Ga0207705_10000005 3300025909 Bacteria 673478
120 Ga0207705_10000415 3300025909 Bacteria 37487
121 Ga0207695_10021853 3300025913 Bacteria 7285
122 Ga0207671_10007239 3300025914 Bacteria 9663
123 Ga0207671_10007270 3300025914 Bacteria 9634
124 Ga0207657_10001431 3300025919 Bacteria 25493
125 Ga0207657_10036812 3300025919 Bacteria 4377
126 Ga0207649_10002300 3300025920 Bacteria 10750
127 Ga0207694_10010326 3300025924 Bacteria 7042
128 Ga0207644_10000039 3300025931 Bacteria 121348
129 Ga0207690_10007400 3300025932 Bacteria 6519
130 Ga0207690_10040355 3300025932 Bacteria 3051
131 Ga0207706_10215855 3300025933 Bacteria 1680
132 Ga0207709_10000145 3300025935 Bacteria 98629
133 Ga0207669_10000651 3300025937 Bacteria 15043
134 Ga0207669_10000701 3300025937 Bacteria 14447
135 Ga0207711_10000222 3300025941 Bacteria 60984
136 Ga0207679_10035123 3300025945 Bacteria 3543
137 Ga0207667_10000002 3300025949 Bacteria 895662
138 Ga0207667_10147413 3300025949 Bacteria 2422
139 Ga0207712_10019129 3300025961 Bacteria 4468
140 Ga0207668_10000029 3300025972 Bacteria 123784
141 Ga0207640_10009451 3300025981 Bacteria 5462
142 Ga0207703_10001205 3300026035 Bacteria 24220
143 Ga0207639_10006404 3300026041 Bacteria 7998
144 Ga0207639_10089968 3300026041 Bacteria 2454
145 Ga0207639_10312126 3300026041 Bacteria 1393
146 Ga0207678_10002160 3300026067 Bacteria 17803
147 Ga0207678_10006919 3300026067 Bacteria 10062
148 Ga0207702_10003351 3300026078 Bacteria 14693
149 Ga0207702_10012656 3300026078 Bacteria 7022
150 Ga0207641_10000214 3300026088 Bacteria 74908
151 Ga0207676_10001264 3300026095 Bacteria 18812
152 Ga0207674_10015846 3300026116 Bacteria 8266
153 Ga0207674_10054520 3300026116 Bacteria 4070
154 Ga0207674_10056919 3300026116 Bacteria 3966
155 Ga0207675_100000058 3300026118 Bacteria 81487
156 Ga0207683_10001435 3300026121 Bacteria 21555
157 Ga0207698_10004977 3300026142 Bacteria 8147
158 Ga0209813_10000190 3300027866 Bacteria 19350
159 Ga0268266_10000002 3300028379 Bacteria 3059047
160 Ga0268264_10002820 3300028381 Bacteria 15170
161 Ga0307517_10013727 3300028786 Bacteria 10972
162 Ga0307517_10014263 3300028786 Bacteria 10697
163 Ga0307513_10038556 3300031456 Bacteria 5304
164 Ga0307412_10001357 3300031911 Bacteria 13610
165 Ga0307510_10005337 3300033180 Bacteria 15296
166 Ga0395899_0099967 3300037312 Bacteria 2094
167 Ga0436365_1679154 3300039437 Bacteria 73730
168 Ga0439461_0000058 3300041410 Bacteria 13742
169 Ga0439461_0003019 3300041410 Bacteria 2741
170 Ga0439465_0000338 3300041413 Bacteria 13389
171 Ga0451807_0370030 3300041486 Bacteria 960
172 Ga0439431_0002541 3300041997 Bacteria 4027
173 Ga0439442_002099 3300042002 Bacteria 3914
174 Ga0439445_0000413 3300042004 Bacteria 8616
175 Ga0439432_002007 3300042006 Bacteria 7705
176 Ga0439452_012197 3300042010 Bacteria 2452
177 Ga0439462_0000627 3300042015 Bacteria 7084
178 Ga0439462_0012877 3300042015 Bacteria 2140
179 Ga0439446_0022047 3300042156 Bacteria 1803
180 Ga0439434_0000055 3300042435 Bacteria 27855
181 Ga0439434_0006872 3300042435 Bacteria 3321
182 Ga0495627_000036 3300046453 Bacteria 205589
183 Ga0495638_0001432 3300046460 Bacteria 21598
184 Ga0495650_0000629 3300046471 Bacteria 47390
185 Ga0495585_0002525 3300046492 Bacteria 13004
186 Ga0495583_0000420 3300046506 Bacteria 64084
187 Ga0495583_0020317 3300046506 Bacteria 3444
188 Ga0495606_0001518 3300046507 Bacteria 30743
189 Ga0495606_0012231 3300046507 Bacteria 6907
190 Ga0495616_0086584 3300046513 Bacteria 1490
191 Ga0495643_0000959 3300046522 Bacteria 29584
192 Ga0495643_0001226 3300046522 Bacteria 24753
193 Ga0495648_0000179 3300046524 Bacteria 73718
194 Ga0495648_0005139 3300046524 Bacteria 10954
195 Ga0495663_0008749 3300046525 Bacteria 2807
196 Ga0495622_0001887 3300046557 Bacteria 10312
197 Ga0495633_0000284 3300046558 Bacteria 58250
198 Ga0495633_0023710 3300046558 Bacteria 3038
199 Ga0495668_0000016 3300046616 Bacteria 438197
200 Ga0495611_0008768 3300046648 Bacteria 4276
201 Ga0495625_0000521 3300046660 Bacteria 56689
202 Ga0495625_0011604 3300046660 Bacteria 7168
203 Ga0495625_0014628 3300046660 Bacteria 6252
204 Ga0495669_0000214 3300046684 Bacteria 34972
205 Ga0495670_0000031 3300046691 Bacteria 85620
206 Ga0495683_0006343 3300047323 Bacteria 6464
207 Ga0495687_000591 3300047443 Bacteria 42289
208 Ga0495687_001639 3300047443 Bacteria 20146
209 Ga0495677_0002249 3300047445 Bacteria 7633
210 Ga0495681_0005899 3300047470 Bacteria 8127
211 Ga0496102_0000358 3300048905 Bacteria 55213
212 Ga0496103_0000440 3300048906 Bacteria 35885
213 Ga0496105_0000319 3300048908 Bacteria 31608
214 Ga0496110_0023666 3300048913 Bacteria 5226
215 Ga0496115_0000204 3300048918 Bacteria 55334
216 Ga0496115_0000419 3300048918 Bacteria 34639
217 Ga0496116_0001502 3300048919 Bacteria 25979
218 Ga0496116_0037390 3300048919 Bacteria 3386
219 Ga0496117_0000659 3300048920 Bacteria 55198
220 Ga0496117_0024816 3300048920 Bacteria 4727
221 Ga0496118_0000092 3300048921 Bacteria 169106
222 Ga0496118_0011104 3300048921 Bacteria 8840
223 Ga0496119_0011260 3300048922 Bacteria 7438
224 Ga0496119_0018871 3300048922 Bacteria 5109
225 Ga0496121_0000789 3300048924 Bacteria 57941
226 Ga0496121_0001136 3300048924 Bacteria 46762
227 Ga0496121_0040591 3300048924 Bacteria 4080
228 Ga0496122_0011675 3300048925 Bacteria 8852
229 Ga0496122_0062404 3300048925 Bacteria 2728
230 Ga0496123_0018357 3300048926 Bacteria 5569
231 Ga0496124_0000081 3300048927 Bacteria 208413
232 Ga0496124_0000912 3300048927 Bacteria 47709
233 Ga0496124_0008211 3300048927 Bacteria 10952
234 Ga0496124_0022505 3300048927 Bacteria 5774
235 Ga0496124_0023907 3300048927 Bacteria 5565
236 Ga0496124_0026182 3300048927 Bacteria 5265
237 Ga0496125_0000624 3300048928 Bacteria 59464
238 Ga0496125_0007224 3300048928 Bacteria 11839
239 Ga0496126_0000803 3300048929 Bacteria 56250
240 Ga0501034_0036873 3300049571 Bacteria 4951
241 Ga0501223_000058 3300049663 Bacteria 36525
242 Ga0501223_010841 3300049663 Bacteria 1830
243 Ga0501224_000021 3300049664 Bacteria 68878
244 Ga0501233_005860 3300049668 Bacteria 2289
245 Ga0501257_000066 3300049686 Bacteria 28746
246 Ga0501225_0000022 3300049705 Bacteria 55780
247 Ga0501234_005475 3300049707 Bacteria 1987
248 Ga0501280_000899 3300049776 Bacteria 6357
249 Ga0501226_000031 3300049853 Bacteria 74305
250 nmdc:mga06z11_63_c1 3300050494 Bacteria 44638
251 nmdc:mga04h51_38_c1 3300050495 Bacteria 45254
252 nmdc:mga0qj67_34958_c1 3300050509 Bacteria 3928
253 Ga0500610_0000034 3300053079 Bacteria 49152
254 Ga0500643_009009 3300053087 Bacteria 3856
255 Ga0500643_016625 3300053087 Bacteria 2487
256 Ga0500566_0005399 3300053094 Bacteria 7602
257 Ga0500641_0022298 3300053096 Bacteria 2423
258 Ga0500595_003177 3300053119 Bacteria 7775
259 Ga0500642_0000984 3300053130 Bacteria 8181
260 Ga0500658_0002147 3300053134 Bacteria 7672
261 Ga0500658_0009814 3300053134 Bacteria 3529
262 Ga0500573_0000039 3300053140 Bacteria 105413
263 Ga0500636_0000413 3300053177 Bacteria 23522
264 Ga0500645_000001 3300053730 Bacteria 455558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0370030 Ga0451807_0370030_49_945 262
2 3300048924 Ga0496121_0040591 Ga0496121_0040591_304_1590 312
3 3300005354 Ga0070675_100059239 Ga0070675_1000592393 330
4 3300013105 Ga0157369_10010259 Ga0157369_100102595 331
5 3300049663 Ga0501223_000058 Ga0501223_000058_10558_11859 333
6 3300049664 Ga0501224_000021 Ga0501224_000021_35265_36566 333
7 3300049705 Ga0501225_0000022 Ga0501225_0000022_19215_20516 333
8 3300049707 Ga0501234_005475 Ga0501234_005475_590_1891 333
9 3300049853 Ga0501226_000031 Ga0501226_000031_41506_42807 333
10 3300005347 Ga0070668_100000037 Ga0070668_10000003731 334
11 3300005841 Ga0068863_100000145 Ga0068863_10000014538 334
12 3300025961 Ga0207712_10019129 Ga0207712_100191293 334
13 3300025972 Ga0207668_10000029 Ga0207668_10000029141 334
14 3300026088 Ga0207641_10000214 Ga0207641_1000021438 334
15 3300028381 Ga0268264_10002820 Ga0268264_100028209 334
16 3300031456 Ga0307513_10038556 Ga0307513_100385562 334
17 3300033180 Ga0307510_10005337 Ga0307510_100053379 334
18 3300046660 Ga0495625_0011604 Ga0495625_0011604_918_2201 334
19 3300053087 Ga0500643_016625 Ga0500643_016625_122_1405 334
20 3300005618 Ga0068864_100006179 Ga0068864_1000061796 335
21 3300013306 Ga0163162_10006494 Ga0163162_100064947 335
22 3300026035 Ga0207703_10001205 Ga0207703_1000120513 335
23 3300026095 Ga0207676_10001264 Ga0207676_100012646 335
24 3300049668 Ga0501233_005860 Ga0501233_005860_354_1655 336
25 3300005331 Ga0070670_100142604 Ga0070670_1001426041 337
26 3300009553 Ga0105249_10035867 Ga0105249_100358673 337
27 3300025931 Ga0207644_10000039 Ga0207644_1000003994 337
28 3300048927 Ga0496124_0026182 Ga0496124_0026182_2782_4038 337
29 3300005985 Ga0081539_10007730 Ga0081539_100077305 339
30 3300049776 Ga0501280_000899 Ga0501280_000899_112_1401 339
31 3300026116 Ga0207674_10054520 Ga0207674_100545204 340
32 3300048927 Ga0496124_0008211 Ga0496124_0008211_4980_6263 340
33 3300053094 Ga0500566_0005399 Ga0500566_0005399_3830_5104 340
34 3300049663 Ga0501223_010841 Ga0501223_010841_436_1725 341
35 3300049686 Ga0501257_000066 Ga0501257_000066_8677_9966 341
36 3300001979 JGI24740J21852_10009038 JGI24740J21852_100090383 343
37 3300005327 Ga0070658_10006953 Ga0070658_100069535 343
38 3300005339 Ga0070660_100052041 Ga0070660_1000520412 343
39 3300005344 Ga0070661_100009943 Ga0070661_1000099433 343
40 3300005366 Ga0070659_100102749 Ga0070659_1001027491 343
41 3300005455 Ga0070663_100110772 Ga0070663_1001107721 343
42 3300005539 Ga0068853_100176512 Ga0068853_1001765122 343
43 3300005563 Ga0068855_100108618 Ga0068855_1001086182 343
44 3300005564 Ga0070664_100014269 Ga0070664_1000142696 343
45 3300005577 Ga0068857_100024071 Ga0068857_1000240714 343
46 3300005578 Ga0068854_100078194 Ga0068854_1000781942 343
47 3300005614 Ga0068856_100161192 Ga0068856_1001611922 343
48 3300005616 Ga0068852_100049400 Ga0068852_1000494002 343
49 3300005834 Ga0068851_10001067 Ga0068851_100010672 343
50 3300009093 Ga0105240_10125430 Ga0105240_101254303 343
51 3300009174 Ga0105241_10004712 Ga0105241_100047123 343
52 3300009551 Ga0105238_10084946 Ga0105238_100849462 343
53 3300013100 Ga0157373_10044629 Ga0157373_100446292 343
54 3300013102 Ga0157371_10000032 Ga0157371_10000032201 343
55 3300013104 Ga0157370_10102278 Ga0157370_101022782 343
56 3300013105 Ga0157369_10120790 Ga0157369_101207902 343
57 3300013307 Ga0157372_10073407 Ga0157372_100734073 343
58 3300025321 Ga0207656_10006535 Ga0207656_100065353 343
59 3300025909 Ga0207705_10000415 Ga0207705_1000041534 343
60 3300025913 Ga0207695_10021853 Ga0207695_100218533 343
61 3300025914 Ga0207671_10007270 Ga0207671_100072704 343
62 3300025919 Ga0207657_10036812 Ga0207657_100368122 343
63 3300025920 Ga0207649_10002300 Ga0207649_100023007 343
64 3300025924 Ga0207694_10010326 Ga0207694_100103264 343
65 3300025932 Ga0207690_10040355 Ga0207690_100403552 343
66 3300025945 Ga0207679_10035123 Ga0207679_100351232 343
67 3300025949 Ga0207667_10000002 Ga0207667_10000002448 343
68 3300025981 Ga0207640_10009451 Ga0207640_100094512 343
69 3300026041 Ga0207639_10006404 Ga0207639_100064046 343
70 3300026067 Ga0207678_10006919 Ga0207678_100069196 343
71 3300026078 Ga0207702_10012656 Ga0207702_100126565 343
72 3300026116 Ga0207674_10015846 Ga0207674_100158466 343
73 3300026142 Ga0207698_10004977 Ga0207698_100049772 343
74 3300048925 Ga0496122_0062404 Ga0496122_0062404_336_1592 344
75 3300005339 Ga0070660_100004027 Ga0070660_1000040276 345
76 3300025919 Ga0207657_10001431 Ga0207657_1000143114 345
77 3300053096 Ga0500641_0022298 Ga0500641_0022298_885_2180 345
78 iso_pu_bacteria 2879163058 2879163126 345
79 3300003771 Ga0055526_1002387 Ga0055526_10023874 346
80 3300003771 Ga0055526_1004578 Ga0055526_10045785 346
81 3300025295 Ga0209564_1001029 Ga0209564_10010294 346
82 3300025914 Ga0207671_10007239 Ga0207671_100072392 346
83 3300048919 Ga0496116_0037390 Ga0496116_0037390_1180_2436 346
84 3300048920 Ga0496117_0024816 Ga0496117_0024816_1753_3009 346
85 3300048921 Ga0496118_0011104 Ga0496118_0011104_671_1927 346
86 3300048922 Ga0496119_0018871 Ga0496119_0018871_1961_3217 346
87 3300048927 Ga0496124_0022505 Ga0496124_0022505_2102_3373 346
88 iso_pu_bacteria 2928526807 2928529649 346
89 3300006846 Ga0075430_100038457 Ga0075430_1000384573 347
90 3300049571 Ga0501034_0036873 Ga0501034_0036873_2191_3462 347
91 3300050509 nmdc:mga0qj67_34958_c1 nmdc:mga0qj67_34958_c1_1457_2716 347
92 iso_pu_bacteria 2599185359 2600226920 347
93 3300005262 Ga0065165_1003823 Ga0065165_10038232 348
94 3300005327 Ga0070658_10000002 Ga0070658_10000002171 348
95 3300005366 Ga0070659_100009472 Ga0070659_1000094725 348
96 3300005457 Ga0070662_100044315 Ga0070662_1000443152 348
97 3300021384 Ga0213876_10000178 Ga0213876_1000017843 348
98 3300025909 Ga0207705_10000005 Ga0207705_10000005617 348
99 3300025932 Ga0207690_10007400 Ga0207690_100074002 348
100 3300025949 Ga0207667_10147413 Ga0207667_101474131 348
101 3300039437 Ga0436365_1679154 Ga0436365_1679154_63068_64372 348
102 3300046691 Ga0495670_0000031 Ga0495670_0000031_33573_34835 349
103 iso_pu_bacteria 2643221622 2644127858 349
104 iso_pu_bacteria 2928027323 2928030974 349
105 iso_pu_bacteria 2984555340 2984556126 349
106 iso_pu_bacteria 2984564862 2984565766 349
107 iso_pu_bacteria 2993356040 2993356777 349
108 3300003214 JGI25165J46597_1000039 JGI25165J46597_100003964 350
109 3300003215 JGI25153J46596_10000119 JGI25153J46596_1000011949 350
110 3300025261 Ga0209233_1000052 Ga0209233_1000052220 350
111 3300025297 Ga0209758_1000328 Ga0209758_100032841 350
112 3300031911 Ga0307412_10001357 Ga0307412_1000135710 350
113 3300048924 Ga0496121_0000789 Ga0496121_0000789_27269_28537 350
114 3300048927 Ga0496124_0000912 Ga0496124_0000912_32218_33501 350
115 iso_pu_bacteria 2512564014 2512644088 350
116 iso_pu_bacteria 2830075706 2830078782 350
117 iso_pu_bacteria 2852680915 2852683422 350
118 3300001990 JGI24737J22298_10001891 JGI24737J22298_100018915 351
119 3300003773 Ga0055537_1000624 Ga0055537_10006247 351
120 3300003775 Ga0055524_1000324 Ga0055524_100032435 351
121 3300003791 Ga0055530_10004330 Ga0055530_100043306 351
122 3300005262 Ga0065165_1004436 Ga0065165_10044367 351
123 3300005539 Ga0068853_100151483 Ga0068853_1001514832 351
124 3300005617 Ga0068859_100011190 Ga0068859_1000111906 351
125 3300005985 Ga0081539_10025227 Ga0081539_100252274 351
126 3300006931 Ga0097620_100011190 Ga0097620_1000111906 351
127 3300025245 Ga0207425_1022354 Ga0207425_10223541 351
128 3300025263 Ga0209565_1000011 Ga0209565_1000011277 351
129 3300025297 Ga0209758_1010283 Ga0209758_10102835 351
130 3300025298 Ga0209050_1001664 Ga0209050_10016641 351
131 3300025299 Ga0209256_1000016 Ga0209256_1000016322 351
132 3300025304 Ga0209257_1000855 Ga0209257_100085519 351
133 3300026041 Ga0207639_10089968 Ga0207639_100899682 351
134 iso_pu_bacteria 2818991466 2819715629 351
135 iso_pu_bacteria 2928968154 2928970863 351
136 3300003215 JGI25153J46596_10000027 JGI25153J46596_1000002790 352
137 3300003759 Ga0055525_1000012 Ga0055525_1000012446 352
138 3300003762 Ga0055542_1000094 Ga0055542_100009492 352
139 3300003763 Ga0055529_1000045 Ga0055529_100004541 352
140 3300003773 Ga0055537_1002194 Ga0055537_10021944 352
141 3300003791 Ga0055530_10001898 Ga0055530_100018986 352
142 3300003792 Ga0055540_1001940 Ga0055540_10019405 352
143 3300003794 Ga0055531_10000090 Ga0055531_100000906 352
144 3300005328 Ga0070676_10008910 Ga0070676_100089102 352
145 3300005347 Ga0070668_100190254 Ga0070668_1001902542 352
146 3300005356 Ga0070674_100006093 Ga0070674_1000060935 352
147 3300005356 Ga0070674_100021325 Ga0070674_1000213254 352
148 3300005456 Ga0070678_100001761 Ga0070678_1000017617 352
149 3300005457 Ga0070662_100073370 Ga0070662_1000733701 352
150 3300005548 Ga0070665_100000155 Ga0070665_10000015515 352
151 3300009148 Ga0105243_10000348 Ga0105243_1000034843 352
152 3300013296 Ga0157374_10021724 Ga0157374_100217244 352
153 3300025230 Ga0209563_100030 Ga0209563_1000304 352
154 3300025245 Ga0207425_1000005 Ga0207425_1000005315 352
155 3300025254 Ga0209148_1000011 Ga0209148_1000011725 352
156 3300025258 Ga0209129_1000501 Ga0209129_100050116 352
157 3300025263 Ga0209565_1000215 Ga0209565_100021550 352
158 3300025272 Ga0209455_1000006 Ga0209455_1000006468 352
159 3300025294 Ga0209025_1000763 Ga0209025_100076344 352
160 3300025297 Ga0209758_1000002 Ga0209758_10000021029 352
161 3300025298 Ga0209050_1000001 Ga0209050_10000011012 352
162 3300025298 Ga0209050_1000051 Ga0209050_1000051232 352
163 3300025298 Ga0209050_1009643 Ga0209050_10096433 352
164 3300025303 Ga0209051_1000518 Ga0209051_100051838 352
165 3300025304 Ga0209257_1000028 Ga0209257_1000028136 352
166 3300025304 Ga0209257_1000555 Ga0209257_100055547 352
167 3300025304 Ga0209257_1001184 Ga0209257_100118421 352
168 3300025304 Ga0209257_1013100 Ga0209257_10131002 352
169 3300025907 Ga0207645_10038998 Ga0207645_100389982 352
170 3300025933 Ga0207706_10215855 Ga0207706_102158552 352
171 3300025935 Ga0207709_10000145 Ga0207709_1000014515 352
172 3300025937 Ga0207669_10000651 Ga0207669_100006515 352
173 3300025937 Ga0207669_10000701 Ga0207669_100007015 352
174 3300026121 Ga0207683_10001435 Ga0207683_1000143515 352
175 3300028379 Ga0268266_10000002 Ga0268266_100000021495 352
176 3300028786 Ga0307517_10014263 Ga0307517_100142636 352
177 3300037312 Ga0395899_0099967 Ga0395899_0099967_735_2012 352
178 3300046471 Ga0495650_0000629 Ga0495650_0000629_28881_30158 352
179 3300046492 Ga0495585_0002525 Ga0495585_0002525_1444_2721 352
180 3300046506 Ga0495583_0000420 Ga0495583_0000420_30181_31458 352
181 3300046506 Ga0495583_0020317 Ga0495583_0020317_579_1856 352
182 3300046507 Ga0495606_0001518 Ga0495606_0001518_15511_16788 352
183 3300046507 Ga0495606_0012231 Ga0495606_0012231_4942_6219 352
184 3300046513 Ga0495616_0086584 Ga0495616_0086584_88_1365 352
185 3300046522 Ga0495643_0000959 Ga0495643_0000959_21286_22563 352
186 3300046522 Ga0495643_0001226 Ga0495643_0001226_5222_6499 352
187 3300046524 Ga0495648_0000179 Ga0495648_0000179_40078_41355 352
188 3300046557 Ga0495622_0001887 Ga0495622_0001887_8073_9350 352
189 3300046558 Ga0495633_0000284 Ga0495633_0000284_32218_33495 352
190 3300046558 Ga0495633_0023710 Ga0495633_0023710_301_1578 352
191 3300046616 Ga0495668_0000016 Ga0495668_0000016_403506_404783 352
192 3300046648 Ga0495611_0008768 Ga0495611_0008768_2539_3816 352
193 3300046660 Ga0495625_0000521 Ga0495625_0000521_30872_32149 352
194 3300046660 Ga0495625_0014628 Ga0495625_0014628_4722_5999 352
195 3300046684 Ga0495669_0000214 Ga0495669_0000214_23406_24683 352
196 3300047323 Ga0495683_0006343 Ga0495683_0006343_2405_3682 352
197 3300047443 Ga0495687_000591 Ga0495687_000591_34446_35723 352
198 3300047443 Ga0495687_001639 Ga0495687_001639_10941_12218 352
199 3300047445 Ga0495677_0002249 Ga0495677_0002249_710_1987 352
200 3300047470 Ga0495681_0005899 Ga0495681_0005899_4250_5527 352
201 3300048905 Ga0496102_0000358 Ga0496102_0000358_28673_29950 352
202 3300048906 Ga0496103_0000440 Ga0496103_0000440_32152_33429 352
203 3300048908 Ga0496105_0000319 Ga0496105_0000319_3409_4686 352
204 3300048913 Ga0496110_0023666 Ga0496110_0023666_3811_5088 352
205 3300048918 Ga0496115_0000204 Ga0496115_0000204_25282_26559 352
206 3300048918 Ga0496115_0000419 Ga0496115_0000419_25183_26454 352
207 3300048919 Ga0496116_0001502 Ga0496116_0001502_19535_20812 352
208 3300048920 Ga0496117_0000659 Ga0496117_0000659_28723_30000 352
209 3300048921 Ga0496118_0000092 Ga0496118_0000092_25243_26520 352
210 3300048922 Ga0496119_0011260 Ga0496119_0011260_4795_6072 352
211 3300048924 Ga0496121_0001136 Ga0496121_0001136_20372_21649 352
212 3300048925 Ga0496122_0011675 Ga0496122_0011675_2233_3510 352
213 3300048926 Ga0496123_0018357 Ga0496123_0018357_1504_2781 352
214 3300048927 Ga0496124_0000081 Ga0496124_0000081_181822_183099 352
215 3300048928 Ga0496125_0000624 Ga0496125_0000624_31324_32601 352
216 3300048929 Ga0496126_0000803 Ga0496126_0000803_28699_29976 352
217 3300053079 Ga0500610_0000034 Ga0500610_0000034_18797_20074 352
218 3300053119 Ga0500595_003177 Ga0500595_003177_2590_3867 352
219 3300053130 Ga0500642_0000984 Ga0500642_0000984_2140_3417 352
220 3300053177 Ga0500636_0000413 Ga0500636_0000413_13525_14802 352
221 3300053730 Ga0500645_000001 Ga0500645_000001_42263_43540 352
222 iso_pu_bacteria 2808606401 2809062727 352
223 iso_pu_bacteria 2808606404 2809078589 352
224 iso_pu_bacteria 2808606405 2809083116 352
225 iso_pu_bacteria 2880518877 2880521417 352
226 3300005262 Ga0065165_1003470 Ga0065165_10034707 353
227 3300009011 Ga0105251_10011677 Ga0105251_100116772 353
228 3300017792 Ga0163161_10020370 Ga0163161_100203702 353
229 3300041410 Ga0439461_0000058 Ga0439461_0000058_6371_7654 353
230 3300041410 Ga0439461_0003019 Ga0439461_0003019_292_1581 353
231 3300041413 Ga0439465_0000338 Ga0439465_0000338_6696_7979 353
232 3300041997 Ga0439431_0002541 Ga0439431_0002541_2476_3759 353
233 3300042002 Ga0439442_002099 Ga0439442_002099_319_1602 353
234 3300042004 Ga0439445_0000413 Ga0439445_0000413_5707_6990 353
235 3300042006 Ga0439432_002007 Ga0439432_002007_1661_2944 353
236 3300042010 Ga0439452_012197 Ga0439452_012197_358_1647 353
237 3300042015 Ga0439462_0000627 Ga0439462_0000627_2180_3463 353
238 3300042015 Ga0439462_0012877 Ga0439462_0012877_160_1449 353
239 3300042156 Ga0439446_0022047 Ga0439446_0022047_242_1525 353
240 3300042435 Ga0439434_0000055 Ga0439434_0000055_6561_7844 353
241 3300042435 Ga0439434_0006872 Ga0439434_0006872_983_2272 353
242 3300046460 Ga0495638_0001432 Ga0495638_0001432_2587_3873 353
243 3300048927 Ga0496124_0023907 Ga0496124_0023907_1185_2441 353
244 3300048928 Ga0496125_0007224 Ga0496125_0007224_6121_7377 353
245 3300053087 Ga0500643_009009 Ga0500643_009009_166_1455 353
246 3300053134 Ga0500658_0002147 Ga0500658_0002147_4837_6123 353
247 3300053134 Ga0500658_0009814 Ga0500658_0009814_372_1661 353
248 3300005617 Ga0068859_100001306 Ga0068859_10000130618 354
249 3300005719 Ga0068861_100000032 Ga0068861_10000003238 354
250 3300006042 Ga0075368_10000271 Ga0075368_1000027110 354
251 3300006178 Ga0075367_10002375 Ga0075367_100023754 354
252 3300006931 Ga0097620_100001306 Ga0097620_10000130618 354
253 3300009177 Ga0105248_10000237 Ga0105248_1000023727 354
254 3300014968 Ga0157379_10038488 Ga0157379_100384883 354
255 3300025941 Ga0207711_10000222 Ga0207711_1000022218 354
256 3300026118 Ga0207675_100000058 Ga0207675_10000005822 354
257 3300027866 Ga0209813_10000190 Ga0209813_1000019014 354
258 3300028786 Ga0307517_10013727 Ga0307517_100137278 354
259 3300046453 Ga0495627_000036 Ga0495627_000036_150366_151619 354
260 3300046524 Ga0495648_0005139 Ga0495648_0005139_6883_8136 354
261 3300046525 Ga0495663_0008749 Ga0495663_0008749_235_1521 354
262 3300050494 nmdc:mga06z11_63_c1 nmdc:mga06z11_63_c1_40616_41911 354
263 3300050495 nmdc:mga04h51_38_c1 nmdc:mga04h51_38_c1_3338_4633 354
264 3300053140 Ga0500573_0000039 Ga0500573_0000039_87621_88922 354
265 3300001904 JGI24736J21556_1000512 JGI24736J21556_10005125 356
266 3300001915 JGI24741J21665_1000327 JGI24741J21665_10003277 356
267 3300001979 JGI24740J21852_10003334 JGI24740J21852_100033343 356
268 3300002067 JGI24735J21928_10002500 JGI24735J21928_100025005 356
269 3300005344 Ga0070661_100016737 Ga0070661_1000167372 356
270 3300005564 Ga0070664_100067998 Ga0070664_1000679981 356
271 3300005614 Ga0068856_100020148 Ga0068856_1000201484 356
272 3300009174 Ga0105241_10003268 Ga0105241_100032688 356
273 3300009545 Ga0105237_10019643 Ga0105237_100196433 356
274 3300013100 Ga0157373_10037716 Ga0157373_100377162 356
275 3300013104 Ga0157370_10037139 Ga0157370_100371394 356
276 3300013105 Ga0157369_10081358 Ga0157369_100813584 356
277 3300025904 Ga0207647_10013754 Ga0207647_100137543 356
278 3300026041 Ga0207639_10312126 Ga0207639_103121261 356
279 3300026067 Ga0207678_10002160 Ga0207678_100021607 356
280 3300026078 Ga0207702_10003351 Ga0207702_100033517 356
281 3300026116 Ga0207674_10056919 Ga0207674_100569193 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

250

317

0.98

PF21082

MS_channel_3rd

Mechanosensitive ion channel MscS, C-terminal

324

408

0.97

PF21088

MS_channel_1st

Mechanosensitive ion channel, transmembrane helices 2/3

208

249

0.97

Feature Viewer

pLDDT pTM Quality
61.83 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map