F384027

General Info

Members Datasets Scaffolds Average Seq Length
281 203 562 249

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10024872|JGI24740J21852_100248722
Length 274
Sequence MNANDRSARLQLRDETAVVSIVGVRKRYGGRAGLGDEVSIGPVDLEIPAEGVTALIGPNGAGKSTLLTMIGRLLGMDHGSIRISGFDVGTTKSKDLATVVSILRQENHFVTRLTVRQLVGFGRFPHSRGRLTRADEEAVSRAIDFLELGELEKRYLDELSGGQRQRAYVAMVLAQDTGTVLLDEPLNNLDMKHAVRMMRHLQRISGELGKSVVVVLHDINFAAHYADRICVMKDGAVVAFGPVAEIMRGDVLTEVFETPVTVIDGPDGPLAVWH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
19 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
23 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
24 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
34 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
46 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
54 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
55 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
56 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
57 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
58 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
59 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
60 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
61 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
62 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
63 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
64 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
65 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
66 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
67 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
70 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
71 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
72 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
95 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
96 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
97 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
103 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
104 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
105 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
106 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
107 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
108 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
109 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
110 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
111 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
112 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
113 2643221546 Microbacterium sp. Root53 Isolate Unclassified
114 2643221630 Microbacterium sp. Root322 Isolate Unclassified
115 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
116 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
117 2643221729 Bacillus sp. Root11 Isolate Unclassified
118 2643221730 Bacillus sp. Root131 Isolate Unclassified
119 2643221732 Bacillus sp. Root239 Isolate Unclassified
120 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
121 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
122 2684622632 Bacillus cereus 905 Isolate Unclassified
123 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
124 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
125 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
126 2721755523 Delftia sp. HK171 Isolate Unclassified
127 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
128 2738541295 Bacillus sp. OK085 Isolate Unclassified
129 2738541358 Bacillus sp. OV752 Isolate Unclassified
130 2738543006 Bacillus sp. OK077 Isolate Unclassified
131 2738543010 Bacillus sp. YR335 Isolate Unclassified
132 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
133 2773857759 Microbacterium sp. 1294 Isolate Unclassified
134 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
135 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
136 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
137 2818991441 Niallia circulans 3243 Isolate Rhizosphere
138 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
139 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
140 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
141 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
142 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
143 2842682962 Bacillus sp. R-72492 Isolate Unclassified
144 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
145 2849139964 Bacillus sp. R-71875 Isolate Unclassified
146 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
147 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
148 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
149 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
150 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
151 2857581216 Bacillus sp. R-71922 Isolate Unclassified
152 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
153 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
154 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
155 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
156 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
157 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
158 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
159 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
160 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
161 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
162 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
163 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
164 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
165 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
166 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
167 2919069694 Microbacterium sp. 1154 Isolate Unclassified
168 2919395869 Microbacterium resistens 2980 Isolate Unclassified
169 2920879853 Kocuria salina CV6 Isolate Unclassified
170 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
171 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
172 2929004312 Priestia megaterium 1104 Isolate Unclassified
173 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
174 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
175 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
176 2938917290 Bacillus sp. CR71 Isolate Unclassified
177 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
178 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
179 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
180 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
181 2965761152 Bacillus sp. COPE52 Isolate Unclassified
182 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
183 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
184 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
185 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
186 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
187 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
188 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
189 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
190 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
191 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
192 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
193 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
194 8022792930 Bacillus sp. Xin Isolate Rhizosphere
195 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
196 8023438354 Bacillus sp. BH2 Isolate Unclassified
197 8023444577 Bacillus sp. BH32 Isolate Unclassified
198 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
199 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
200 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
201 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
202 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
203 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.65
Metatranscriptomes 5.69
Isolates 36.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 14.95
Nodule 1.07
Rhizoplane 7.83
Rhizosphere 40.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024872 3300001979 Bacteria 2025
2 SwRhRL2b_contig_2020809 2162886007 Bacteria 1710
3 JGI25154J39366_1001481 3300002738 Bacteria 8275
4 JGI25151J46595_10008159 3300003187 Bacteria 5064
5 JGI25151J46595_10010264 3300003187 Bacteria 4363
6 JGI25151J46595_10023980 3300003187 Bacteria 2503
7 rootH2_10063282 3300003320 Bacteria 4080
8 Ga0055538_1000276 3300003751 Bacteria 26446
9 Ga0055538_1000423 3300003751 Bacteria 16344
10 Ga0055532_1000553 3300003758 Bacteria 15893
11 Ga0055536_1008284 3300003781 Bacteria 4493
12 Ga0055536_1044095 3300003781 Bacteria 1031
13 Ga0055541_1001371 3300003841 Bacteria 5302
14 Ga0065704_10072322 3300005289 Bacteria 8741
15 Ga0070667_100634101 3300005367 Bacteria 986
16 Ga0075364_10000038 3300006051 Bacteria 47063
17 Ga0075364_10028364 3300006051 Bacteria 3583
18 Ga0079104_1000027 3300006946 Bacteria 212641
19 Ga0105244_10011733 3300009036 Bacteria 5228
20 Ga0105244_10012643 3300009036 Bacteria 4977
21 Ga0105250_10000154 3300009092 Bacteria 59676
22 Ga0105250_10006907 3300009092 Bacteria 4918
23 Ga0105250_10079770 3300009092 Bacteria 1326
24 Ga0105243_10004169 3300009148 Bacteria 11463
25 Ga0105243_10004843 3300009148 Bacteria 10571
26 Ga0105243_10337971 3300009148 Bacteria 1378
27 Ga0157371_10004890 3300013102 Bacteria 11511
28 Ga0157371_10096920 3300013102 Bacteria 2090
29 Ga0157377_10229742 3300014745 Bacteria 1192
30 Ga0209784_100165 3300025224 Bacteria 57266
31 Ga0209784_100511 3300025224 Bacteria 14889
32 Ga0209147_100115 3300025229 Bacteria 143934
33 Ga0209147_101199 3300025229 Bacteria 10470
34 Ga0209147_107438 3300025229 Bacteria 1424
35 Ga0209258_101235 3300025242 Bacteria 9868
36 Ga0209646_1000041 3300025246 Bacteria 346024
37 Ga0209129_1022502 3300025258 Bacteria 1138
38 Ga0209673_1023070 3300025273 Bacteria 2129
39 Ga0209130_1000320 3300025284 Bacteria 56333
40 Ga0209130_1039652 3300025284 Bacteria 916
41 Ga0209676_1000533 3300025292 Bacteria 59159
42 Ga0209676_1001195 3300025292 Bacteria 27894
43 Ga0209676_1004040 3300025292 Bacteria 8444
44 Ga0209676_1024494 3300025292 Bacteria 1954
45 Ga0209025_1000433 3300025294 Bacteria 82715
46 Ga0209025_1002600 3300025294 Bacteria 18617
47 Ga0209025_1004630 3300025294 Bacteria 11765
48 Ga0209025_1004875 3300025294 Bacteria 11310
49 Ga0209025_1005145 3300025294 Bacteria 10849
50 Ga0209025_1005383 3300025294 Bacteria 10477
51 Ga0209025_1008020 3300025294 Bacteria 7690
52 Ga0209025_1008559 3300025294 Bacteria 7341
53 Ga0209025_1011034 3300025294 Bacteria 6025
54 Ga0209025_1016965 3300025294 Bacteria 4244
55 Ga0209025_1018928 3300025294 Bacteria 3865
56 Ga0209025_1055051 3300025294 Bacteria 1542
57 Ga0207696_1001753 3300025711 Bacteria 11225
58 Ga0207696_1003159 3300025711 Bacteria 7647
59 Ga0207696_1015032 3300025711 Bacteria 2634
60 Ga0207696_1040300 3300025711 Bacteria 1369
61 Ga0207655_1001115 3300025728 Bacteria 26233
62 Ga0207655_1004670 3300025728 Bacteria 9606
63 Ga0207713_1008463 3300025735 Bacteria 5922
64 Ga0207713_1022602 3300025735 Bacteria 2980
65 Ga0207644_10144737 3300025931 Bacteria 1834
66 Ga0207709_10000165 3300025935 Bacteria 90586
67 Ga0207709_10002957 3300025935 Bacteria 10361
68 Ga0209281_1000002 3300027111 Bacteria 1924012
69 Ga0237817_10085 3300030083 Bacteria 28556
70 Ga0237817_10266 3300030083 Bacteria 12287
71 Ga0307408_100498652 3300031548 Bacteria 1065
72 Ga0307406_10000511 3300031901 Bacteria 22340
73 Ga0307406_10012611 3300031901 Bacteria 4820
74 Ga0307406_10130079 3300031901 Bacteria 1766
75 Ga0307412_10075227 3300031911 Bacteria 2316
76 Ga0307409_100033296 3300031995 Bacteria 3748
77 Ga0307416_100096335 3300032002 Bacteria 2558
78 Ga0307416_100308055 3300032002 Bacteria 1578
79 Ga0307416_100319558 3300032002 Bacteria 1554
80 Ga0307414_10420692 3300032004 Bacteria 1165
81 Ga0395900_0000007 3300037418 Bacteria 488860
82 Ga0395898_0000011 3300037466 Bacteria 488860
83 Ga0395905_0000008 3300037471 Bacteria 488860
84 Ga0395901_0000048 3300038443 Bacteria 174069
85 Ga0237819_00268 3300038705 Bacteria 19033
86 Ga0237819_00560 3300038705 Bacteria 12512
87 Ga0451797_1205877 3300041453 Bacteria 3701
88 Ga0451853_0311974 3300041512 Bacteria 2876
89 Ga0466972_0064877 3300044658 Bacteria 1747
90 Ga0466970_0000001 3300044765 Bacteria 252791
91 Ga0466970_0214291 3300044765 Bacteria 1074
92 Ga0466957_0217214 3300044842 Bacteria 1261
93 Ga0466967_0000891 3300045976 Bacteria 15947
94 Ga0495627_003310 3300046453 Bacteria 7190
95 Ga0495590_0107593 3300046457 Bacteria 994
96 Ga0495633_0001925 3300046558 Bacteria 15120
97 Ga0495660_0087671 3300046810 Bacteria 1623
98 Ga0495683_0135025 3300047323 Bacteria 1160
99 Ga0496100_0007583 3300048903 Bacteria 5998
100 Ga0496101_0140780 3300048904 Bacteria 1838
101 Ga0496102_0345245 3300048905 Bacteria 1401
102 Ga0496103_0013591 3300048906 Bacteria 4829
103 Ga0496104_0122153 3300048907 Bacteria 2500
104 Ga0496104_0581144 3300048907 Bacteria 1031
105 Ga0496105_0001127 3300048908 Bacteria 18616
106 Ga0496106_0006249 3300048909 Bacteria 8817
107 Ga0496107_0000352 3300048910 Bacteria 25045
108 Ga0496109_0005408 3300048912 Bacteria 10680
109 Ga0496110_0000317 3300048913 Bacteria 31945
110 Ga0496110_0119807 3300048913 Bacteria 2370
111 Ga0496110_0555103 3300048913 Bacteria 1044
112 Ga0496111_0004205 3300048914 Bacteria 9065
113 Ga0496111_0010788 3300048914 Bacteria 6142
114 Ga0496111_0055943 3300048914 Bacteria 2853
115 Ga0496112_0024824 3300048915 Bacteria 5749
116 Ga0496113_0104838 3300048916 Bacteria 2194
117 Ga0496116_0061213 3300048919 Bacteria 2438
118 Ga0496117_0000618 3300048920 Bacteria 57549
119 Ga0496117_0127130 3300048920 Bacteria 1553
120 Ga0496118_0035835 3300048921 Bacteria 4020
121 Ga0496119_0005454 3300048922 Bacteria 12183
122 Ga0496121_0143751 3300048924 Bacteria 1766
123 Ga0496121_0291841 3300048924 Bacteria 1111
124 Ga0496122_0005949 3300048925 Bacteria 14281
125 Ga0496122_0038561 3300048925 Bacteria 3825
126 Ga0496122_0049333 3300048925 Bacteria 3225
127 Ga0496122_0055321 3300048925 Bacteria 2970
128 Ga0496122_0065937 3300048925 Bacteria 2620
129 Ga0496122_0127234 3300048925 Bacteria 1628
130 Ga0496123_0025494 3300048926 Bacteria 4456
131 Ga0496123_0036557 3300048926 Bacteria 3481
132 Ga0496123_0157560 3300048926 Bacteria 1215
133 Ga0496124_0000094 3300048927 Bacteria 189147
134 Ga0496124_0038218 3300048927 Bacteria 4169
135 Ga0496124_0120485 3300048927 Bacteria 2097
136 Ga0496124_0136332 3300048927 Bacteria 1943
137 Ga0496124_0139011 3300048927 Bacteria 1919
138 Ga0496125_0000519 3300048928 Bacteria 66983
139 Ga0496125_0035510 3300048928 Bacteria 4370
140 Ga0496125_0052108 3300048928 Bacteria 3367
141 Ga0496125_0066773 3300048928 Bacteria 2839
142 Ga0496125_0211429 3300048928 Bacteria 1259
143 Ga0496126_0000053 3300048929 Bacteria 311989
144 Ga0496126_0009022 3300048929 Bacteria 10665
145 Ga0496126_0142701 3300048929 Bacteria 2060
146 Ga0496126_0155513 3300048929 Bacteria 1957
147 Ga0496126_0183321 3300048929 Bacteria 1777
148 Ga0501305_003959 3300049161 Bacteria 1711
149 Ga0501312_000742 3300049528 Bacteria 2828
150 Ga0501312_006268 3300049528 Bacteria 1478
151 Ga0501315_002674 3300049531 Bacteria 1706
152 Ga0501316_002226 3300049532 Bacteria 1772
153 Ga0501316_025681 3300049532 Bacteria 767
154 Ga0501317_000510 3300049533 Bacteria 2786
155 Ga0501321_000165 3300049537 Bacteria 3615
156 Ga0501335_001142 3300049551 Bacteria 1978
157 Ga0501335_001348 3300049551 Bacteria 1873
158 Ga0501335_009851 3300049551 Bacteria 916
159 Ga0501336_000706 3300049552 Bacteria 1776
160 Ga0501336_011937 3300049552 Bacteria 712
161 Ga0501337_000833 3300049553 Bacteria 1645
162 Ga0501338_00411 3300049554 Bacteria 1895
163 Ga0501338_04632 3300049554 Bacteria 837
164 Ga0501033_0081761 3300049570 Bacteria 2369
165 Ga0501034_0001541 3300049571 Bacteria 30258
166 Ga0501034_0050819 3300049571 Bacteria 4180
167 Ga0501034_0582330 3300049571 Bacteria 1026
168 Ga0501038_0247302 3300049574 Bacteria 1414
169 Ga0501040_0252580 3300049576 Bacteria 1258
170 Ga0501211_008863 3300049658 Bacteria 984
171 Ga0501216_035731 3300049660 Bacteria 935
172 Ga0501233_006127 3300049668 Bacteria 2251
173 Ga0501234_023706 3300049707 Bacteria 983
174 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
175 nmdc:mga00v17_85961_c1 3300050491 Bacteria 1970
176 nmdc:mga0yw44_28400_c1 3300050492 Bacteria 3217
177 Ga0500573_0162711 3300053140 Bacteria 1213
178 Ga0500616_0000093 3300053153 Bacteria 183114
179 2511172269 2510917026 Bacteria 7046020
180 2511176906 2510917027 Bacteria 5287437
181 2512639187 2512564013 Bacteria 6286191
182 2553394419 2551306519 Bacteria 5465154
183 2555229430 2554235227 Bacteria 3637389
184 2585255768 2582581304 Bacteria 5831370
185 2587862373 2585428094 Bacteria 3604039
186 2599720601 2599185236 Bacteria 6875203
187 2600199544 2599185353 Bacteria 2219443
188 2600402437 2600254943 Bacteria 2613887
189 2643734652 2643221542 Bacteria 3563959
190 2643752428 2643221546 Bacteria 2910897
191 2644172812 2643221630 Bacteria 3601215
192 2644498363 2643221689 Bacteria 6042950
193 2644679076 2643221724 Bacteria 3593515
194 2644707316 2643221729 Bacteria 6621700
195 2644714273 2643221730 Bacteria 6523787
196 2644725901 2643221732 Bacteria 5756404
197 2655034225 2654587600 Bacteria 3911798
198 2672338461 2671180330 Bacteria 5521719
199 2685153061 2684622632 Bacteria 5380049
200 2698320123 2695420987 Bacteria 6152737
201 2705996986 2703719227 Bacteria 5631989
202 2721508207 2718218445 Bacteria 5113413
203 2722886156 2721755523 Bacteria 6430384
204 2730228573 2728369380 Bacteria 3620317
205 2738815243 2738541295 Bacteria 5730091
206 2739157162 2738541358 Bacteria 5932299
207 2739209088 2738543006 Bacteria 5904091
208 2739231817 2738543010 Bacteria 5583595
209 2774381225 2773857758 Bacteria 3592392
210 2774383292 2773857759 Bacteria 2963774
211 2791215616 2788500588 Bacteria 4584915
212 2816865606 2816332186 Bacteria 5331395
213 2817508566 2816332305 Bacteria 2697803
214 2819569738 2818991441 Bacteria 5062707
215 2819582439 2818991443 Bacteria 6598732
216 2819627186 2818991451 Bacteria 4697364
217 2819628012 2818991451 Bacteria 4697364
218 2821116601 2821111986 Bacteria 6894338
219 2839143884 2839138175 Bacteria 6549354
220 2840882495 2840878972 Bacteria 5483153
221 2842686433 2842682962 Bacteria 5589973
222 2848554004 2848551377 Bacteria 3720646
223 2849143306 2849139964 Bacteria 5613304
224 2852666094 2852663356 Bacteria 4090475
225 2852679625 2852677369 Bacteria 3768884
226 2854683681 2854681122 Bacteria 4548679
227 2857468686 2857465823 Bacteria 6772595
228 2857480477 2857479173 Bacteria 2469263
229 2857583402 2857581216 Bacteria 5522813
230 2857595662 2857591370 Bacteria 6569758
231 2857633698 2857632687 Bacteria 2448521
232 2857724486 2857723135 Bacteria 4217853
233 2864999916 2864997549 Bacteria 5139696
234 2870801980 2870801768 Bacteria 2710986
235 2870806369 2870804320 Bacteria 2552467
236 2881647127 2881644220 Bacteria 5302661
237 2885532355 2885526491 Bacteria 7164189
238 2893685148 2893684298 Bacteria 2897960
239 2904167883 2904162308 Bacteria 7086713
240 2904609296 2904606771 Bacteria 4684500
241 2904756161 2904755435 Bacteria 7986759
242 2908680365 2908678064 Bacteria 3482747
243 2915598084 2915597211 Bacteria 6475886
244 2915612759 2915606848 Bacteria 6032732
245 2919072678 2919069694 Bacteria 3622919
246 2919397124 2919395869 Bacteria 3704152
247 2920882731 2920879853 Bacteria 4216831
248 2928144109 2928142448 Bacteria 5288925
249 2928512875 2928510474 Bacteria 4815308
250 2929007099 2929004312 Bacteria 5678476
251 2929189603 2929183550 Bacteria 6377511
252 2929238777 2929233124 Bacteria 5948380
253 2932399472 2932398195 Bacteria 3847976
254 2938922989 2938917290 Bacteria 5914775
255 2939595790 2939593269 Bacteria 4798695
256 2947431861 2947426588 Bacteria 5357194
257 2960380008 2960375949 Bacteria 5361395
258 2964378455 2964375228 Bacteria 4909004
259 2965766395 2965761152 Bacteria 5806513
260 2974296216 2974294766 Bacteria 3767688
261 2974327549 2974324384 Bacteria 3750535
262 2977253474 2977251589 Bacteria 2952848
263 2978970260 2978969890 Bacteria 5400756
264 2979088773 2979083700 Bacteria 5894929
265 2984587286 2984587000 Bacteria 5263363
266 2989774690 2989771324 Bacteria 5605128
267 3001891894 3001889506 Bacteria 2975194
268 3006973533 3006969106 Bacteria 4739423
269 8004183364 8004182704 Bacteria 3391155
270 8004213109 8004212874 Bacteria 2861420
271 8022626572 8022621104 Bacteria 5241040
272 8022795926 8022792930 Bacteria 5693794
273 8022952970 8022948649 Bacteria 5366783
274 8023441206 8023438354 Bacteria 5779374
275 8023448763 8023444577 Bacteria 5661597
276 8046354785 8046352972 Bacteria 3613806
277 8054464506 8054460903 Bacteria 4872905
278 8055039112 8055037949 Bacteria 3337834
279 8055536794 8055531788 Bacteria 5249694
280 8055638036 8055632911 Bacteria 5283357
281 8057734933 8057733483 Bacteria 6578323
282 JGI24740J21852_10024872
283 SwRhRL2b_contig_2020809
284 JGI25154J39366_1001481
285 JGI25151J46595_10008159
286 JGI25151J46595_10010264
287 JGI25151J46595_10023980
288 rootH2_10063282
289 Ga0055538_1000276
290 Ga0055538_1000423
291 Ga0055532_1000553
292 Ga0055536_1008284
293 Ga0055536_1044095
294 Ga0055541_1001371
295 Ga0065704_10072322
296 Ga0070667_100634101
297 Ga0075364_10000038
298 Ga0075364_10028364
299 Ga0079104_1000027
300 Ga0105244_10011733
301 Ga0105244_10012643
302 Ga0105250_10000154
303 Ga0105250_10006907
304 Ga0105250_10079770
305 Ga0105243_10004169
306 Ga0105243_10004843
307 Ga0105243_10337971
308 Ga0157371_10004890
309 Ga0157371_10096920
310 Ga0157377_10229742
311 Ga0209784_100165
312 Ga0209784_100511
313 Ga0209147_100115
314 Ga0209147_101199
315 Ga0209147_107438
316 Ga0209258_101235
317 Ga0209646_1000041
318 Ga0209129_1022502
319 Ga0209673_1023070
320 Ga0209130_1000320
321 Ga0209130_1039652
322 Ga0209676_1000533
323 Ga0209676_1001195
324 Ga0209676_1004040
325 Ga0209676_1024494
326 Ga0209025_1000433
327 Ga0209025_1002600
328 Ga0209025_1004630
329 Ga0209025_1004875
330 Ga0209025_1005145
331 Ga0209025_1005383
332 Ga0209025_1008020
333 Ga0209025_1008559
334 Ga0209025_1011034
335 Ga0209025_1016965
336 Ga0209025_1018928
337 Ga0209025_1055051
338 Ga0207696_1001753
339 Ga0207696_1003159
340 Ga0207696_1015032
341 Ga0207696_1040300
342 Ga0207655_1001115
343 Ga0207655_1004670
344 Ga0207713_1008463
345 Ga0207713_1022602
346 Ga0207644_10144737
347 Ga0207709_10000165
348 Ga0207709_10002957
349 Ga0209281_1000002
350 Ga0237817_10085
351 Ga0237817_10266
352 Ga0307408_100498652
353 Ga0307406_10000511
354 Ga0307406_10012611
355 Ga0307406_10130079
356 Ga0307412_10075227
357 Ga0307409_100033296
358 Ga0307416_100096335
359 Ga0307416_100308055
360 Ga0307416_100319558
361 Ga0307414_10420692
362 Ga0395900_0000007
363 Ga0395898_0000011
364 Ga0395905_0000008
365 Ga0395901_0000048
366 Ga0237819_00268
367 Ga0237819_00560
368 Ga0451797_1205877
369 Ga0451853_0311974
370 Ga0466972_0064877
371 Ga0466970_0000001
372 Ga0466970_0214291
373 Ga0466957_0217214
374 Ga0466967_0000891
375 Ga0495627_003310
376 Ga0495590_0107593
377 Ga0495633_0001925
378 Ga0495660_0087671
379 Ga0495683_0135025
380 Ga0496100_0007583
381 Ga0496101_0140780
382 Ga0496102_0345245
383 Ga0496103_0013591
384 Ga0496104_0122153
385 Ga0496104_0581144
386 Ga0496105_0001127
387 Ga0496106_0006249
388 Ga0496107_0000352
389 Ga0496109_0005408
390 Ga0496110_0000317
391 Ga0496110_0119807
392 Ga0496110_0555103
393 Ga0496111_0004205
394 Ga0496111_0010788
395 Ga0496111_0055943
396 Ga0496112_0024824
397 Ga0496113_0104838
398 Ga0496116_0061213
399 Ga0496117_0000618
400 Ga0496117_0127130
401 Ga0496118_0035835
402 Ga0496119_0005454
403 Ga0496121_0143751
404 Ga0496121_0291841
405 Ga0496122_0005949
406 Ga0496122_0038561
407 Ga0496122_0049333
408 Ga0496122_0055321
409 Ga0496122_0065937
410 Ga0496122_0127234
411 Ga0496123_0025494
412 Ga0496123_0036557
413 Ga0496123_0157560
414 Ga0496124_0000094
415 Ga0496124_0038218
416 Ga0496124_0120485
417 Ga0496124_0136332
418 Ga0496124_0139011
419 Ga0496125_0000519
420 Ga0496125_0035510
421 Ga0496125_0052108
422 Ga0496125_0066773
423 Ga0496125_0211429
424 Ga0496126_0000053
425 Ga0496126_0009022
426 Ga0496126_0142701
427 Ga0496126_0155513
428 Ga0496126_0183321
429 Ga0501305_003959
430 Ga0501312_000742
431 Ga0501312_006268
432 Ga0501315_002674
433 Ga0501316_002226
434 Ga0501316_025681
435 Ga0501317_000510
436 Ga0501321_000165
437 Ga0501335_001142
438 Ga0501335_001348
439 Ga0501335_009851
440 Ga0501336_000706
441 Ga0501336_011937
442 Ga0501337_000833
443 Ga0501338_00411
444 Ga0501338_04632
445 Ga0501033_0081761
446 Ga0501034_0001541
447 Ga0501034_0050819
448 Ga0501034_0582330
449 Ga0501038_0247302
450 Ga0501040_0252580
451 Ga0501211_008863
452 Ga0501216_035731
453 Ga0501233_006127
454 Ga0501234_023706
455 nmdc:mga00v17_14_c1
456 nmdc:mga00v17_85961_c1
457 nmdc:mga0yw44_28400_c1
458 Ga0500573_0162711
459 Ga0500616_0000093
460 2511172269
461 2511176906
462 2512639187
463 2553394419
464 2555229430
465 2585255768
466 2587862373
467 2599720601
468 2600199544
469 2600402437
470 2643734652
471 2643752428
472 2644172812
473 2644498363
474 2644679076
475 2644707316
476 2644714273
477 2644725901
478 2655034225
479 2672338461
480 2685153061
481 2698320123
482 2705996986
483 2721508207
484 2722886156
485 2730228573
486 2738815243
487 2739157162
488 2739209088
489 2739231817
490 2774381225
491 2774383292
492 2791215616
493 2816865606
494 2817508566
495 2819569738
496 2819582439
497 2819627186
498 2819628012
499 2821116601
500 2839143884
501 2840882495
502 2842686433
503 2848554004
504 2849143306
505 2852666094
506 2852679625
507 2854683681
508 2857468686
509 2857480477
510 2857583402
511 2857595662
512 2857633698
513 2857724486
514 2864999916
515 2870801980
516 2870806369
517 2881647127
518 2885532355
519 2893685148
520 2904167883
521 2904609296
522 2904756161
523 2908680365
524 2915598084
525 2915612759
526 2919072678
527 2919397124
528 2920882731
529 2928144109
530 2928512875
531 2929007099
532 2929189603
533 2929238777
534 2932399472
535 2938922989
536 2939595790
537 2947431861
538 2960380008
539 2964378455
540 2965766395
541 2974296216
542 2974327549
543 2977253474
544 2978970260
545 2979088773
546 2984587286
547 2989774690
548 3001891894
549 3006973533
550 8004183364
551 8004213109
552 8022626572
553 8022795926
554 8022952970
555 8023441206
556 8023448763
557 8046354785
558 8054464506
559 8055039112
560 8055536794
561 8055638036
562 8057734933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

187

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.9384 1 248
5b58-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.9327 1 250
4g1u-assembly1.cif.gz_D x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9276 2 252
5b58-assembly1.cif.gz_D inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.924 1 250
5b58-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.922 1 250
ID Description Score Start End Superfamily
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.981 1 252 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9727 3 249 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 1 244 3.40.50.300
af_P07821_3_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9651 2 249 3.40.50.300
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 1 235 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A140NR22-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9964 1 251 GO:0005524
GO:0006826
GO:0016887
AF-A0A838BKH2-F1-model_v4 ABC transporter ATP-binding protein 0.9954 1 252 GO:0005524
GO:0006826
GO:0016887
AF-A0A140NR22-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9925 1 251 GO:0005524
GO:0006826
GO:0016887
AF-I0T951-F1-model_v4 deleted 0.9894 3 250
AF-W6K447-F1-model_v4 Putative iron-siderophore ABC transporter (ATP-binding protein) 0.9891 1 252 GO:0005524
GO:0006826
GO:0016887

Map