F383693

General Info

Members Datasets Scaffolds Average Seq Length
280 156 256 216

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10002544|Ga0163161_100025448
Length 238
Sequence MYLWHSNCTQFRGKFFINTNHMATSQQIKTGYIDYVLTHDEQPKSVYSFVKKLKITESEFYQFYASFESIEKLIWADLTVETIDTIRQQEVWAQYSSRDRMLSFFYSYVEVLKKQRSFIVYSLKQHSAKFATPAVLSGVKPIFENFAEELVNEGVESGELADRKFLTKRYKDALWIQFAFIINFWVNDNSTGFEKTDEAIEKGINVTFDLFQRSPLDNLFEYGKFLSRNSRFTENMRK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
10 2818991437 Pedobacter terrae 518 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
15 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
16 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
17 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
18 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
19 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
20 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
21 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
22 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
23 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
24 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
25 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.86
Metatranscriptomes 3.57
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.36
Rhizosphere 85.36
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1934947 2162886007 Bacteria 6254
2 JGI24740J21852_10020519 3300001979 Bacteria 2302
3 JGI24739J22299_10016349 3300001989 Bacteria 2685
4 JGI24739J22299_10018936 3300001989 Bacteria 2469
5 JGI24737J22298_10002670 3300001990 Bacteria 6307
6 JGI24735J21928_10000003 3300002067 Bacteria 385983
7 JGI25164J39214_1001771 3300002772 Bacteria 4211
8 JGI25165J46597_1001086 3300003214 Bacteria 17365
9 rootH2_10040443 3300003320 Bacteria 19021
10 rootL2_10009030 3300003322 Bacteria 2713
11 rootH1_10001800 3300003323 Bacteria 72551
12 rootH1_10051067 3300003323 Bacteria 14425
13 rootH1_10090871 3300003323 Bacteria 7019
14 rootH1_10343311 3300003323 Bacteria 1060
15 Ga0055536_1000086 3300003781 Bacteria 80100
16 Ga0055530_10003772 3300003791 Bacteria 8359
17 Ga0065714_10002200 3300005288 Bacteria 145275
18 Ga0065714_10004295 3300005288 Bacteria 7367
19 Ga0065714_10004807 3300005288 Bacteria 7751
20 Ga0065714_10006252 3300005288 Bacteria 4876
21 Ga0065714_10100552 3300005288 Bacteria 1662
22 Ga0065704_10000464 3300005289 Bacteria 35359
23 Ga0065704_10078810 3300005289 Bacteria 4328
24 Ga0070658_10043335 3300005327 Bacteria 3635
25 Ga0070658_10194054 3300005327 Bacteria 1712
26 Ga0070658_10212837 3300005327 Bacteria 1633
27 Ga0070680_100004810 3300005336 Bacteria 10166
28 Ga0070680_100165459 3300005336 Bacteria 1859
29 Ga0070660_100012840 3300005339 Bacteria 5991
30 Ga0070660_100098675 3300005339 Bacteria 2312
31 Ga0070660_100453393 3300005339 Bacteria 1064
32 Ga0070660_100493152 3300005339 Bacteria 1019
33 Ga0070673_100327289 3300005364 Unclassified 1355
34 Ga0070659_100023730 3300005366 Bacteria 4697
35 Ga0070662_100000281 3300005457 Bacteria 30079
36 Ga0070662_100052680 3300005457 Bacteria 2943
37 Ga0070681_10067615 3300005458 Bacteria 3541
38 Ga0070681_10228461 3300005458 Bacteria 1775
39 Ga0070679_100066526 3300005530 Bacteria 3592
40 Ga0068853_100127433 3300005539 Bacteria 2275
41 Ga0068853_100138172 3300005539 Bacteria 2186
42 Ga0068853_100176194 3300005539 Bacteria 1937
43 Ga0068853_100650911 3300005539 Bacteria 1003
44 Ga0070665_100000178 3300005548 Bacteria 113002
45 Ga0068855_100031400 3300005563 Bacteria 6343
46 Ga0068855_100101627 3300005563 Bacteria 3309
47 Ga0068855_100188106 3300005563 Bacteria 2331
48 Ga0068855_100230872 3300005563 Bacteria 2072
49 Ga0068855_101203430 3300005563 Bacteria 788
50 Ga0068856_101384444 3300005614 Bacteria 718
51 Ga0068852_100704007 3300005616 Bacteria 1020
52 Ga0068866_10229321 3300005718 Bacteria 1125
53 Ga0068858_100046537 3300005842 Bacteria 4021
54 Ga0105240_10000294 3300009093 Bacteria 97108
55 Ga0105240_10004547 3300009093 Bacteria 21059
56 Ga0105240_10019765 3300009093 Bacteria 8995
57 Ga0105240_10097507 3300009093 Bacteria 3582
58 Ga0105240_10197892 3300009093 Bacteria 2357
59 Ga0105240_10335140 3300009093 Bacteria 1720
60 Ga0105240_10757138 3300009093 Bacteria 1055
61 Ga0105240_11132815 3300009093 Bacteria 831
62 Ga0105243_10167427 3300009148 Bacteria 1900
63 Ga0105241_10011749 3300009174 Bacteria 6429
64 Ga0105241_10015216 3300009174 Bacteria 5635
65 Ga0105237_10000109 3300009545 Bacteria 115699
66 Ga0105237_10001397 3300009545 Bacteria 31884
67 Ga0105237_10073526 3300009545 Bacteria 3411
68 Ga0105238_10199767 3300009551 Bacteria 1975
69 Ga0105238_10233051 3300009551 Bacteria 1818
70 Ga0105249_10113459 3300009553 Bacteria 2564
71 Ga0105239_10000007 3300010375 Bacteria 385297
72 Ga0105239_10000015 3300010375 Bacteria 319892
73 Ga0105239_10003125 3300010375 Bacteria 20554
74 Ga0105239_10056810 3300010375 Bacteria 4293
75 Ga0157373_10000798 3300013100 Bacteria 24347
76 Ga0157373_10001887 3300013100 Bacteria 15902
77 Ga0157373_10008031 3300013100 Bacteria 7843
78 Ga0157373_10158022 3300013100 Bacteria 1595
79 Ga0157371_10000129 3300013102 Bacteria 115362
80 Ga0157371_10001226 3300013102 Bacteria 27268
81 Ga0157371_10003226 3300013102 Bacteria 14964
82 Ga0157371_10003240 3300013102 Bacteria 14938
83 Ga0157371_10003842 3300013102 Bacteria 13407
84 Ga0157371_10006187 3300013102 Bacteria 9925
85 Ga0157371_10007787 3300013102 Bacteria 8607
86 Ga0157371_10081172 3300013102 Bacteria 2296
87 Ga0157370_10007067 3300013104 Bacteria 12261
88 Ga0157370_10017332 3300013104 Bacteria 7269
89 Ga0157370_10072256 3300013104 Bacteria 3256
90 Ga0157370_10098932 3300013104 Bacteria 2734
91 Ga0157370_10156451 3300013104 Bacteria 2120
92 Ga0157370_10294871 3300013104 Bacteria 1498
93 Ga0157370_10334304 3300013104 Unclassified 1396
94 Ga0157370_10338845 3300013104 Bacteria 1386
95 Ga0157370_10369103 3300013104 Unclassified 1322
96 Ga0157370_10421073 3300013104 Bacteria 1229
97 Ga0157370_10428463 3300013104 Bacteria 1217
98 Ga0157369_10000005 3300013105 Bacteria 470816
99 Ga0157369_10005961 3300013105 Bacteria 14153
100 Ga0157369_10016481 3300013105 Bacteria 8311
101 Ga0157369_10056125 3300013105 Bacteria 4250
102 Ga0157369_10139875 3300013105 Bacteria 2562
103 Ga0157369_10168139 3300013105 Bacteria 2311
104 Ga0157369_10589221 3300013105 Unclassified 1148
105 Ga0157369_10712133 3300013105 Bacteria 1033
106 Ga0157374_10002993 3300013296 Bacteria 14140
107 Ga0163162_10000008 3300013306 Bacteria 316194
108 Ga0163162_10002023 3300013306 Bacteria 19071
109 Ga0163162_10014351 3300013306 Bacteria 7742
110 Ga0157372_10000030 3300013307 Bacteria 179925
111 Ga0157372_10001129 3300013307 Bacteria 28993
112 Ga0157372_10030981 3300013307 Bacteria 5855
113 Ga0157372_10063167 3300013307 Bacteria 4151
114 Ga0157372_10082064 3300013307 Bacteria 3649
115 Ga0157372_10086842 3300013307 Bacteria 3549
116 Ga0157372_10213917 3300013307 Bacteria 2234
117 Ga0157372_10649855 3300013307 Bacteria 1228
118 Ga0157375_10072242 3300013308 Bacteria 3466
119 Ga0163163_10621436 3300014325 Bacteria 1144
120 Ga0182008_10000327 3300014497 Bacteria 37610
121 Ga0182008_10000507 3300014497 Bacteria 29307
122 Ga0157377_10018787 3300014745 Bacteria 3599
123 Ga0157376_11294332 3300014969 Bacteria 759
124 Ga0182006_1000105 3300015261 Bacteria 91439
125 Ga0182006_1000213 3300015261 Bacteria 57181
126 Ga0182006_1005247 3300015261 Bacteria 6203
127 Ga0182007_10000023 3300015262 Bacteria 187131
128 Ga0183373_1003 3300015682 Bacteria 558813
129 Ga0163161_10000262 3300017792 Bacteria 46409
130 Ga0163161_10002237 3300017792 Bacteria 13926
131 Ga0163161_10002544 3300017792 Bacteria 13019
132 Ga0163161_10006416 3300017792 Bacteria 8144
133 Ga0163161_10119131 3300017792 Bacteria 1982
134 Ga0163161_10160323 3300017792 Bacteria 1715
135 Ga0197907_11145459 3300020069 Bacteria 828
136 Ga0206356_10892915 3300020070 Bacteria 1475
137 Ga0206349_1886207 3300020075 Bacteria 957
138 Ga0206351_10036364 3300020077 Bacteria 1997
139 Ga0206352_10062413 3300020078 Bacteria 2617
140 Ga0206350_10696408 3300020080 Bacteria 2035
141 Ga0206354_11313514 3300020081 Bacteria 1366
142 Ga0206353_10254432 3300020082 Bacteria 1076
143 Ga0154015_1403502 3300020610 Bacteria 1993
144 Ga0224712_10025190 3300022467 Bacteria 2088
145 Ga0207427_100225 3300025231 Bacteria 48238
146 Ga0209437_100112 3300025233 Bacteria 214292
147 Ga0209437_100135 3300025233 Bacteria 176455
148 Ga0209233_1000126 3300025261 Bacteria 214298
149 Ga0209233_1025605 3300025261 Bacteria 1456
150 Ga0209676_1000001 3300025292 Bacteria 1852142
151 Ga0209050_1000408 3300025298 Bacteria 80140
152 Ga0207642_10449204 3300025899 Bacteria 781
153 Ga0207647_10000723 3300025904 Bacteria 25877
154 Ga0207705_10062839 3300025909 Unclassified 2682
155 Ga0207705_10085769 3300025909 Bacteria 2300
156 Ga0207654_10467472 3300025911 Bacteria 887
157 Ga0207707_10591851 3300025912 Bacteria 939
158 Ga0207695_10000142 3300025913 Bacteria 214715
159 Ga0207695_10003765 3300025913 Bacteria 21051
160 Ga0207695_10007954 3300025913 Bacteria 13375
161 Ga0207695_10225432 3300025913 Bacteria 1780
162 Ga0207671_10000110 3300025914 Bacteria 126480
163 Ga0207671_10001371 3300025914 Bacteria 28336
164 Ga0207671_10003911 3300025914 Bacteria 14518
165 Ga0207671_10006938 3300025914 Bacteria 9973
166 Ga0207657_10017612 3300025919 Bacteria 6844
167 Ga0207657_10413548 3300025919 Bacteria 1060
168 Ga0207652_10163949 3300025921 Bacteria 1993
169 Ga0207652_10311381 3300025921 Unclassified 1421
170 Ga0207694_10127184 3300025924 Bacteria 2040
171 Ga0207690_10014959 3300025932 Bacteria 4698
172 Ga0207690_10082964 3300025932 Bacteria 2243
173 Ga0207690_10147110 3300025932 Bacteria 1743
174 Ga0207706_10000138 3300025933 Bacteria 79643
175 Ga0207706_10183417 3300025933 Unclassified 1838
176 Ga0207709_10109323 3300025935 Bacteria 1845
177 Ga0207667_10007795 3300025949 Bacteria 12798
178 Ga0207667_10008443 3300025949 Bacteria 12232
179 Ga0207667_10455670 3300025949 Bacteria 1299
180 Ga0207667_10490306 3300025949 Bacteria 1247
181 Ga0207667_10630583 3300025949 Bacteria 1079
182 Ga0207703_10258935 3300026035 Bacteria 1572
183 Ga0207639_10072076 3300026041 Bacteria 2704
184 Ga0207639_10136814 3300026041 Bacteria 2036
185 Ga0207678_10050129 3300026067 Bacteria 3607
186 Ga0207698_10270620 3300026142 Unclassified 1566
187 Ga0268266_10000098 3300028379 Bacteria 182784
188 Ga0307517_10029960 3300028786 Bacteria 6401
189 Ga0307515_10009938 3300028794 Bacteria 18315
190 Ga0307515_10059052 3300028794 Bacteria 5507
191 Ga0307515_10594176 3300028794 Bacteria 717
192 Ga0307405_10000030 3300031731 Bacteria 99574
193 Ga0307407_10000023 3300031903 Bacteria 118352
194 Ga0307412_10000050 3300031911 Bacteria 151527
195 Ga0307416_100000049 3300032002 Bacteria 118358
196 Ga0307414_10000535 3300032004 Bacteria 19791
197 Ga0307414_10028718 3300032004 Bacteria 3611
198 Ga0316584_0243010 3300036712 Bacteria 1317
199 Ga0395899_0000034 3300037312 Bacteria 302623
200 Ga0395899_0000394 3300037312 Bacteria 51861
201 Ga0395899_0027412 3300037312 Bacteria 4296
202 Ga0395900_0052021 3300037418 Bacteria 4218
203 Ga0395900_0084508 3300037418 Bacteria 3261
204 Ga0395900_0151104 3300037418 Bacteria 2372
205 Ga0395898_0028898 3300037466 Bacteria 5556
206 Ga0395898_0609305 3300037466 Bacteria 1035
207 Ga0395898_0626149 3300037466 Bacteria 1018
208 Ga0395905_0238810 3300037471 Bacteria 1698
209 Ga0395905_0344472 3300037471 Bacteria 1382
210 Ga0395905_0413753 3300037471 Unclassified 1244
211 Ga0395901_0006605 3300038443 Bacteria 11718
212 Ga0466966_0033972 3300044684 Bacteria 3300
213 Ga0495605_0104821 3300046474 Bacteria 1296
214 Ga0495585_0000302 3300046492 Bacteria 49282
215 Ga0495585_0219462 3300046492 Bacteria 960
216 Ga0495596_0011796 3300046500 Bacteria 3753
217 Ga0495606_0000034 3300046507 Bacteria 247705
218 Ga0495606_0007439 3300046507 Bacteria 9798
219 Ga0495606_0011466 3300046507 Bacteria 7229
220 Ga0495606_0235025 3300046507 Bacteria 1025
221 Ga0495610_0000462 3300046512 Bacteria 41998
222 Ga0495610_0000561 3300046512 Bacteria 37213
223 Ga0495616_0004481 3300046513 Bacteria 8790
224 Ga0495631_0007385 3300046518 Bacteria 5589
225 Ga0495632_0071349 3300046519 Bacteria 1669
226 Ga0495648_0027224 3300046524 Bacteria 3832
227 Ga0495642_0090534 3300046528 Bacteria 1295
228 Ga0495609_0002468 3300046538 Bacteria 11360
229 Ga0495668_0436696 3300046616 Bacteria 720
230 Ga0495611_0153203 3300046648 Bacteria 1076
231 Ga0495625_0013076 3300046660 Bacteria 6688
232 Ga0495625_0020906 3300046660 Bacteria 5045
233 Ga0495625_0220845 3300046660 Bacteria 1242
234 Ga0495683_0148901 3300047323 Bacteria 1091
235 Ga0495687_000233 3300047443 Bacteria 77056
236 Ga0495686_0000419 3300047472 Bacteria 66923
237 Ga0495686_0001285 3300047472 Bacteria 28340
238 Ga0495686_0023108 3300047472 Bacteria 4107
239 Ga0495686_0026813 3300047472 Bacteria 3769
240 Ga0495686_0289280 3300047472 Bacteria 908
241 Ga0496123_0042583 3300048926 Bacteria 3131
242 Ga0495678_008255 3300049459 Bacteria 5278
243 Ga0501033_0039543 3300049570 Bacteria 3523
244 Ga0501033_0198275 3300049570 Bacteria 1435
245 Ga0501034_0029626 3300049571 Bacteria 5566
246 Ga0501038_0198203 3300049574 Unclassified 1613
247 Ga0501070_0294922 3300049586 Unclassified 1322
248 Ga0501217_056778 3300049661 Unclassified 1036
249 Ga0501223_001895 3300049663 Bacteria 4711
250 Ga0501035_0387701 3300049822 Unclassified 1164
251 Ga0501044_0149148 3300049823 Bacteria 2322
252 Ga0500635_0065080 3300053080 Bacteria 1281
253 Ga0500651_0000146 3300053093 Bacteria 44767
254 Ga0500608_109341 3300053122 Bacteria 1269
255 Ga0500568_0100290 3300053139 Bacteria 1087
256 Ga0500573_0049361 3300053140 Bacteria 2422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0042583 Ga0496123_0042583_26_595 161
2 3300046616 Ga0495668_0436696 Ga0495668_0436696_21_608 181
3 3300009551 Ga0105238_10199767 Ga0105238_101997672 182
4 3300025924 Ga0207694_10127184 Ga0207694_101271842 182
5 3300025913 Ga0207695_10225432 Ga0207695_102254322 188
6 3300014497 Ga0182008_10000507 Ga0182008_1000050711 190
7 3300009093 Ga0105240_11132815 Ga0105240_111328152 191
8 3300025914 Ga0207671_10006938 Ga0207671_100069383 191
9 3300046648 Ga0495611_0153203 Ga0495611_0153203_154_807 192
10 3300053080 Ga0500635_0065080 Ga0500635_0065080_414_1073 194
11 3300005539 Ga0068853_100176194 Ga0068853_1001761941 196
12 3300026041 Ga0207639_10136814 Ga0207639_101368142 196
13 3300046513 Ga0495616_0004481 Ga0495616_0004481_7217_7870 196
14 3300046660 Ga0495625_0020906 Ga0495625_0020906_1959_2612 196
15 3300049459 Ga0495678_008255 Ga0495678_008255_4372_5025 196
16 3300046660 Ga0495625_0013076 Ga0495625_0013076_3078_3731 197
17 3300028794 Ga0307515_10009938 Ga0307515_100099382 199
18 3300053122 Ga0500608_109341 Ga0500608_109341_297_932 199
19 3300036712 Ga0316584_0243010 Ga0316584_0243010_275_931 200
20 3300046507 Ga0495606_0007439 Ga0495606_0007439_3825_4463 200
21 iso_pu_bacteria 2852623160 2852624923 200
22 iso_pu_bacteria 2884933994 2884936181 200
23 iso_pu_bacteria 2585427687 2586208683 201
24 iso_pu_bacteria 2599185184 2599479722 201
25 iso_pu_bacteria 2738541283 2738759136 201
26 iso_pu_bacteria 2738541302 2738853357 201
27 iso_pu_bacteria 2739367651 2739591172 201
28 iso_pu_bacteria 2739367656 2739615470 201
29 iso_pu_bacteria 2739367663 2739644695 201
30 iso_pu_bacteria 2775506987 2776615597 201
31 iso_pu_bacteria 2818991437 2819549061 201
32 iso_pu_bacteria 2842722452 2842723318 201
33 iso_pu_bacteria 2842909656 2842909811 201
34 iso_pu_bacteria 2849281842 2849285330 201
35 iso_pu_bacteria 2857627736 2857628684 201
36 iso_pu_bacteria 2902048731 2902052568 201
37 iso_pu_bacteria 2904445276 2904448161 201
38 iso_pu_bacteria 2919437846 2919437962 201
39 iso_pu_bacteria 2928078545 2928083722 201
40 iso_pu_bacteria 2928147474 2928152161 201
41 iso_pu_bacteria 2932082852 2932084725 201
42 iso_pu_bacteria 2945997725 2946000123 201
43 iso_pu_bacteria 2954016120 2954017041 201
44 iso_pu_bacteria 2977232053 2977233949 201
45 3300013307 Ga0157372_10001129 Ga0157372_100011292 203
46 3300046507 Ga0495606_0011466 Ga0495606_0011466_1959_2606 203
47 3300049661 Ga0501217_056778 Ga0501217_056778_343_1026 203
48 3300049663 Ga0501223_001895 Ga0501223_001895_347_994 203
49 3300005288 Ga0065714_10006252 Ga0065714_100062523 204
50 3300025261 Ga0209233_1025605 Ga0209233_10256052 204
51 3300028794 Ga0307515_10594176 Ga0307515_105941761 204
52 3300037312 Ga0395899_0000034 Ga0395899_0000034_81465_82115 204
53 2162886007 SwRhRL2b_contig_1934947 SwRhRL2b_0394.00003470 205
54 3300001979 JGI24740J21852_10020519 JGI24740J21852_100205193 205
55 3300001989 JGI24739J22299_10016349 JGI24739J22299_100163492 205
56 3300001989 JGI24739J22299_10018936 JGI24739J22299_100189362 205
57 3300001990 JGI24737J22298_10002670 JGI24737J22298_100026706 205
58 3300002067 JGI24735J21928_10000003 JGI24735J21928_1000000342 205
59 3300002772 JGI25164J39214_1001771 JGI25164J39214_10017713 205
60 3300003214 JGI25165J46597_1001086 JGI25165J46597_10010869 205
61 3300003320 rootH2_10040443 rootH2_100404437 205
62 3300003322 rootL2_10009030 rootL2_100090302 205
63 3300003323 rootH1_10001800 rootH1_1000180016 205
64 3300003323 rootH1_10051067 rootH1_100510679 205
65 3300003323 rootH1_10090871 rootH1_100908716 205
66 3300003323 rootH1_10343311 rootH1_103433112 205
67 3300003781 Ga0055536_1000086 Ga0055536_100008675 205
68 3300003791 Ga0055530_10003772 Ga0055530_100037725 205
69 3300005288 Ga0065714_10002200 Ga0065714_1000220060 205
70 3300005288 Ga0065714_10004295 Ga0065714_100042956 205
71 3300005288 Ga0065714_10004807 Ga0065714_100048072 205
72 3300005288 Ga0065714_10100552 Ga0065714_101005522 205
73 3300005289 Ga0065704_10000464 Ga0065704_1000046411 205
74 3300005289 Ga0065704_10078810 Ga0065704_100788104 205
75 3300005327 Ga0070658_10043335 Ga0070658_100433353 205
76 3300005327 Ga0070658_10194054 Ga0070658_101940542 205
77 3300005327 Ga0070658_10212837 Ga0070658_102128371 205
78 3300005336 Ga0070680_100004810 Ga0070680_1000048102 205
79 3300005336 Ga0070680_100165459 Ga0070680_1001654591 205
80 3300005339 Ga0070660_100012840 Ga0070660_1000128403 205
81 3300005339 Ga0070660_100098675 Ga0070660_1000986753 205
82 3300005339 Ga0070660_100453393 Ga0070660_1004533932 205
83 3300005339 Ga0070660_100493152 Ga0070660_1004931522 205
84 3300005364 Ga0070673_100327289 Ga0070673_1003272891 205
85 3300005366 Ga0070659_100023730 Ga0070659_1000237306 205
86 3300005457 Ga0070662_100000281 Ga0070662_10000028114 205
87 3300005457 Ga0070662_100052680 Ga0070662_1000526803 205
88 3300005458 Ga0070681_10067615 Ga0070681_100676152 205
89 3300005458 Ga0070681_10228461 Ga0070681_102284612 205
90 3300005530 Ga0070679_100066526 Ga0070679_1000665265 205
91 3300005539 Ga0068853_100127433 Ga0068853_1001274332 205
92 3300005539 Ga0068853_100138172 Ga0068853_1001381722 205
93 3300005539 Ga0068853_100650911 Ga0068853_1006509111 205
94 3300005548 Ga0070665_100000178 Ga0070665_10000017815 205
95 3300005563 Ga0068855_100031400 Ga0068855_1000314004 205
96 3300005563 Ga0068855_100101627 Ga0068855_1001016273 205
97 3300005563 Ga0068855_100188106 Ga0068855_1001881061 205
98 3300005563 Ga0068855_100230872 Ga0068855_1002308722 205
99 3300005563 Ga0068855_101203430 Ga0068855_1012034302 205
100 3300005614 Ga0068856_101384444 Ga0068856_1013844441 205
101 3300005616 Ga0068852_100704007 Ga0068852_1007040072 205
102 3300005718 Ga0068866_10229321 Ga0068866_102293212 205
103 3300005842 Ga0068858_100046537 Ga0068858_1000465373 205
104 3300009093 Ga0105240_10000294 Ga0105240_1000029414 205
105 3300009093 Ga0105240_10004547 Ga0105240_100045478 205
106 3300009093 Ga0105240_10019765 Ga0105240_100197655 205
107 3300009093 Ga0105240_10097507 Ga0105240_100975075 205
108 3300009093 Ga0105240_10197892 Ga0105240_101978923 205
109 3300009093 Ga0105240_10335140 Ga0105240_103351403 205
110 3300009093 Ga0105240_10757138 Ga0105240_107571381 205
111 3300009148 Ga0105243_10167427 Ga0105243_101674271 205
112 3300009174 Ga0105241_10011749 Ga0105241_100117497 205
113 3300009174 Ga0105241_10015216 Ga0105241_100152164 205
114 3300009545 Ga0105237_10000109 Ga0105237_100001095 205
115 3300009545 Ga0105237_10001397 Ga0105237_1000139721 205
116 3300009545 Ga0105237_10073526 Ga0105237_100735264 205
117 3300009551 Ga0105238_10233051 Ga0105238_102330511 205
118 3300009553 Ga0105249_10113459 Ga0105249_101134591 205
119 3300010375 Ga0105239_10000007 Ga0105239_10000007281 205
120 3300010375 Ga0105239_10000015 Ga0105239_10000015121 205
121 3300010375 Ga0105239_10003125 Ga0105239_1000312517 205
122 3300010375 Ga0105239_10056810 Ga0105239_100568103 205
123 3300013100 Ga0157373_10000798 Ga0157373_1000079817 205
124 3300013100 Ga0157373_10001887 Ga0157373_100018872 205
125 3300013100 Ga0157373_10008031 Ga0157373_100080315 205
126 3300013100 Ga0157373_10158022 Ga0157373_101580222 205
127 3300013102 Ga0157371_10000129 Ga0157371_1000012946 205
128 3300013102 Ga0157371_10001226 Ga0157371_1000122619 205
129 3300013102 Ga0157371_10003226 Ga0157371_100032268 205
130 3300013102 Ga0157371_10003240 Ga0157371_1000324012 205
131 3300013102 Ga0157371_10003842 Ga0157371_100038428 205
132 3300013102 Ga0157371_10006187 Ga0157371_100061872 205
133 3300013102 Ga0157371_10007787 Ga0157371_100077873 205
134 3300013102 Ga0157371_10081172 Ga0157371_100811721 205
135 3300013104 Ga0157370_10007067 Ga0157370_100070677 205
136 3300013104 Ga0157370_10017332 Ga0157370_100173321 205
137 3300013104 Ga0157370_10072256 Ga0157370_100722562 205
138 3300013104 Ga0157370_10098932 Ga0157370_100989322 205
139 3300013104 Ga0157370_10156451 Ga0157370_101564513 205
140 3300013104 Ga0157370_10294871 Ga0157370_102948712 205
141 3300013104 Ga0157370_10334304 Ga0157370_103343042 205
142 3300013104 Ga0157370_10338845 Ga0157370_103388452 205
143 3300013104 Ga0157370_10369103 Ga0157370_103691031 205
144 3300013104 Ga0157370_10421073 Ga0157370_104210732 205
145 3300013104 Ga0157370_10428463 Ga0157370_104284632 205
146 3300013105 Ga0157369_10000005 Ga0157369_10000005316 205
147 3300013105 Ga0157369_10005961 Ga0157369_100059619 205
148 3300013105 Ga0157369_10016481 Ga0157369_100164814 205
149 3300013105 Ga0157369_10056125 Ga0157369_100561255 205
150 3300013105 Ga0157369_10139875 Ga0157369_101398752 205
151 3300013105 Ga0157369_10168139 Ga0157369_101681393 205
152 3300013105 Ga0157369_10589221 Ga0157369_105892212 205
153 3300013105 Ga0157369_10712133 Ga0157369_107121331 205
154 3300013296 Ga0157374_10002993 Ga0157374_100029937 205
155 3300013306 Ga0163162_10000008 Ga0163162_10000008187 205
156 3300013306 Ga0163162_10002023 Ga0163162_1000202319 205
157 3300013306 Ga0163162_10014351 Ga0163162_100143514 205
158 3300013307 Ga0157372_10000030 Ga0157372_10000030154 205
159 3300013307 Ga0157372_10030981 Ga0157372_100309813 205
160 3300013307 Ga0157372_10063167 Ga0157372_100631674 205
161 3300013307 Ga0157372_10082064 Ga0157372_100820644 205
162 3300013307 Ga0157372_10086842 Ga0157372_100868422 205
163 3300013307 Ga0157372_10213917 Ga0157372_102139172 205
164 3300013307 Ga0157372_10649855 Ga0157372_106498551 205
165 3300013308 Ga0157375_10072242 Ga0157375_100722423 205
166 3300014325 Ga0163163_10621436 Ga0163163_106214362 205
167 3300014497 Ga0182008_10000327 Ga0182008_1000032728 205
168 3300014745 Ga0157377_10018787 Ga0157377_100187871 205
169 3300014969 Ga0157376_11294332 Ga0157376_112943321 205
170 3300015261 Ga0182006_1000105 Ga0182006_100010573 205
171 3300015261 Ga0182006_1000213 Ga0182006_100021314 205
172 3300015261 Ga0182006_1005247 Ga0182006_10052471 205
173 3300015262 Ga0182007_10000023 Ga0182007_10000023140 205
174 3300015682 Ga0183373_1003 Ga0183373_1003244 205
175 3300017792 Ga0163161_10000262 Ga0163161_1000026225 205
176 3300017792 Ga0163161_10002237 Ga0163161_100022375 205
177 3300017792 Ga0163161_10002544 Ga0163161_100025448 205
178 3300017792 Ga0163161_10006416 Ga0163161_100064168 205
179 3300017792 Ga0163161_10119131 Ga0163161_101191312 205
180 3300017792 Ga0163161_10160323 Ga0163161_101603232 205
181 3300020069 Ga0197907_11145459 Ga0197907_111454592 205
182 3300020070 Ga0206356_10892915 Ga0206356_108929152 205
183 3300020075 Ga0206349_1886207 Ga0206349_18862072 205
184 3300020077 Ga0206351_10036364 Ga0206351_100363642 205
185 3300020078 Ga0206352_10062413 Ga0206352_100624132 205
186 3300020080 Ga0206350_10696408 Ga0206350_106964082 205
187 3300020081 Ga0206354_11313514 Ga0206354_113135142 205
188 3300020082 Ga0206353_10254432 Ga0206353_102544322 205
189 3300020610 Ga0154015_1403502 Ga0154015_14035022 205
190 3300022467 Ga0224712_10025190 Ga0224712_100251902 205
191 3300025231 Ga0207427_100225 Ga0207427_10022521 205
192 3300025233 Ga0209437_100112 Ga0209437_10011239 205
193 3300025233 Ga0209437_100135 Ga0209437_100135139 205
194 3300025261 Ga0209233_1000126 Ga0209233_1000126142 205
195 3300025292 Ga0209676_1000001 Ga0209676_1000001263 205
196 3300025298 Ga0209050_1000408 Ga0209050_100040873 205
197 3300025899 Ga0207642_10449204 Ga0207642_104492041 205
198 3300025904 Ga0207647_10000723 Ga0207647_1000072317 205
199 3300025909 Ga0207705_10062839 Ga0207705_100628392 205
200 3300025909 Ga0207705_10085769 Ga0207705_100857692 205
201 3300025911 Ga0207654_10467472 Ga0207654_104674721 205
202 3300025912 Ga0207707_10591851 Ga0207707_105918511 205
203 3300025913 Ga0207695_10000142 Ga0207695_10000142130 205
204 3300025913 Ga0207695_10003765 Ga0207695_100037654 205
205 3300025913 Ga0207695_10007954 Ga0207695_100079548 205
206 3300025914 Ga0207671_10000110 Ga0207671_10000110111 205
207 3300025914 Ga0207671_10001371 Ga0207671_1000137111 205
208 3300025914 Ga0207671_10003911 Ga0207671_1000391112 205
209 3300025919 Ga0207657_10017612 Ga0207657_100176126 205
210 3300025919 Ga0207657_10413548 Ga0207657_104135482 205
211 3300025921 Ga0207652_10163949 Ga0207652_101639491 205
212 3300025921 Ga0207652_10311381 Ga0207652_103113812 205
213 3300025932 Ga0207690_10014959 Ga0207690_100149596 205
214 3300025932 Ga0207690_10082964 Ga0207690_100829643 205
215 3300025932 Ga0207690_10147110 Ga0207690_101471102 205
216 3300025933 Ga0207706_10000138 Ga0207706_1000013833 205
217 3300025933 Ga0207706_10183417 Ga0207706_101834173 205
218 3300025935 Ga0207709_10109323 Ga0207709_101093233 205
219 3300025949 Ga0207667_10007795 Ga0207667_100077954 205
220 3300025949 Ga0207667_10008443 Ga0207667_100084439 205
221 3300025949 Ga0207667_10455670 Ga0207667_104556702 205
222 3300025949 Ga0207667_10490306 Ga0207667_104903061 205
223 3300025949 Ga0207667_10630583 Ga0207667_106305831 205
224 3300026035 Ga0207703_10258935 Ga0207703_102589353 205
225 3300026041 Ga0207639_10072076 Ga0207639_100720762 205
226 3300026067 Ga0207678_10050129 Ga0207678_100501293 205
227 3300026142 Ga0207698_10270620 Ga0207698_102706201 205
228 3300028379 Ga0268266_10000098 Ga0268266_1000009861 205
229 3300028786 Ga0307517_10029960 Ga0307517_100299603 205
230 3300028794 Ga0307515_10059052 Ga0307515_100590525 205
231 3300031731 Ga0307405_10000030 Ga0307405_1000003022 205
232 3300031903 Ga0307407_10000023 Ga0307407_1000002399 205
233 3300031911 Ga0307412_10000050 Ga0307412_1000005018 205
234 3300032002 Ga0307416_100000049 Ga0307416_10000004912 205
235 3300032004 Ga0307414_10000535 Ga0307414_100005353 205
236 3300032004 Ga0307414_10028718 Ga0307414_100287184 205
237 3300037312 Ga0395899_0000394 Ga0395899_0000394_29528_30190 205
238 3300037312 Ga0395899_0027412 Ga0395899_0027412_132_791 205
239 3300037418 Ga0395900_0052021 Ga0395900_0052021_10_663 205
240 3300037418 Ga0395900_0084508 Ga0395900_0084508_596_1249 205
241 3300037418 Ga0395900_0151104 Ga0395900_0151104_327_986 205
242 3300037466 Ga0395898_0028898 Ga0395898_0028898_4644_5297 205
243 3300037466 Ga0395898_0609305 Ga0395898_0609305_30_683 205
244 3300037466 Ga0395898_0626149 Ga0395898_0626149_274_933 205
245 3300037471 Ga0395905_0238810 Ga0395905_0238810_671_1330 205
246 3300037471 Ga0395905_0344472 Ga0395905_0344472_607_1260 205
247 3300037471 Ga0395905_0413753 Ga0395905_0413753_76_729 205
248 3300038443 Ga0395901_0006605 Ga0395901_0006605_6579_7232 205
249 3300044684 Ga0466966_0033972 Ga0466966_0033972_279_941 205
250 3300046474 Ga0495605_0104821 Ga0495605_0104821_196_858 205
251 3300046492 Ga0495585_0000302 Ga0495585_0000302_37165_37818 205
252 3300046492 Ga0495585_0219462 Ga0495585_0219462_147_806 205
253 3300046500 Ga0495596_0011796 Ga0495596_0011796_2602_3261 205
254 3300046507 Ga0495606_0000034 Ga0495606_0000034_95765_96418 205
255 3300046507 Ga0495606_0235025 Ga0495606_0235025_295_948 205
256 3300046512 Ga0495610_0000462 Ga0495610_0000462_13308_13961 205
257 3300046512 Ga0495610_0000561 Ga0495610_0000561_13178_13831 205
258 3300046518 Ga0495631_0007385 Ga0495631_0007385_53_712 205
259 3300046519 Ga0495632_0071349 Ga0495632_0071349_240_899 205
260 3300046524 Ga0495648_0027224 Ga0495648_0027224_1018_1671 205
261 3300046528 Ga0495642_0090534 Ga0495642_0090534_125_790 205
262 3300046538 Ga0495609_0002468 Ga0495609_0002468_5174_5827 205
263 3300046660 Ga0495625_0220845 Ga0495625_0220845_224_883 205
264 3300047323 Ga0495683_0148901 Ga0495683_0148901_285_944 205
265 3300047443 Ga0495687_000233 Ga0495687_000233_20134_20793 205
266 3300047472 Ga0495686_0000419 Ga0495686_0000419_25283_25936 205
267 3300047472 Ga0495686_0001285 Ga0495686_0001285_18470_19129 205
268 3300047472 Ga0495686_0023108 Ga0495686_0023108_298_951 205
269 3300047472 Ga0495686_0026813 Ga0495686_0026813_1859_2512 205
270 3300047472 Ga0495686_0289280 Ga0495686_0289280_73_726 205
271 3300049570 Ga0501033_0039543 Ga0501033_0039543_1333_1986 205
272 3300049570 Ga0501033_0198275 Ga0501033_0198275_161_814 205
273 3300049571 Ga0501034_0029626 Ga0501034_0029626_987_1640 205
274 3300049574 Ga0501038_0198203 Ga0501038_0198203_312_965 205
275 3300049586 Ga0501070_0294922 Ga0501070_0294922_265_918 205
276 3300049822 Ga0501035_0387701 Ga0501035_0387701_89_742 205
277 3300049823 Ga0501044_0149148 Ga0501044_0149148_1318_1971 205
278 3300053093 Ga0500651_0000146 Ga0500651_0000146_33251_33904 205
279 3300053139 Ga0500568_0100290 Ga0500568_0100290_91_744 205
280 3300053140 Ga0500573_0049361 Ga0500573_0049361_1262_1918 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17931

TetR_C_23

Tetracyclin repressor-like, C-terminal domain

100

226

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jnp-assembly1.cif.gz_B mtrr bound to the rpoh operator from neisseria gonorrhoeae 0.6969 37 182
3c07-assembly1.cif.gz_A crystal structure of a tetr family transcriptional regulator from streptomyces coelicolor a3(2) 0.6359 2 193
5gpc-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.6306 4 175
3ni7-assembly1.cif.gz_A crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.6294 4 174
3lwj-assembly1.cif.gz_A-2 crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution 0.6256 4 178
ID Description Score Start End Superfamily
3f0cA02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.6514 44 177 1.10.357.10
5gpcA02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.6479 41 175 1.10.357.10
af_I1LY75_91_272_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.6309 4 172 1.10.357.10
3f0cA02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.6253 44 177 1.10.357.10
3whcE02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.6145 36 175 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A519XAU2-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8809 1 176
AF-A0A519VWJ4-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8784 1 158
AF-A0A7T9I7F0-F1-model_v4 deleted 0.8528 42 195
AF-A0A7Y4QCL4-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8527 2 145
AF-A0A359MJF6-F1-model_v4 deleted 0.847 34 184

Feature Viewer

pLDDT pTM Quality
83.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map