F383441

General Info

Members Datasets Scaffolds Average Seq Length
280 170 268 239

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1001739|Ga0065165_100173914
Length 264
Sequence MSEVAEIIEGNQQDILLLCDHASNAVPGDIALGIAPELLDRHIAVDIGAGPLTRSLAARLEAPAILATVSRLVIDLHREPDHVGLIPHRSDGHWIPGNDQVDRAGRIARFHAPYHRLLARRIRAQRPRLILSIHSFTPRLEHGGTPRPWQVGILYNRDTRAARPAIDWLRAQGLETGDNEPYSGRLLNATLNRHAEANGIPSIAIEVRNDLIGDSGGVEHWAGTLAELARHLRNVIPAKAGISIDESGGGSHAIPAFAGMTNSL

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
8 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
9 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
12 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
107 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
108 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
109 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
110 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
151 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
152 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
153 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
160 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.36
Metatranscriptomes 0
Isolates 4.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.5
Nodule 0
Rhizoplane 1.43
Rhizosphere 55.36
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000672 3300002774 Bacteria 12562
2 JGI25165J46597_1000032 3300003214 Bacteria 294371
3 JGI25153J46596_10000017 3300003215 Bacteria 274325
4 JGI25153J46596_10007786 3300003215 Bacteria 5205
5 rootH1_10042889 3300003316 Bacteria 1378
6 rootH1_10042889 3300003323 Bacteria 1357
7 rootH2_10120440 3300003320 Bacteria 1313
8 rootH2_10146928 3300003320 Bacteria 1009
9 rootL2_10000144 3300003322 Bacteria 1801
10 Ga0055526_1009390 3300003771 Bacteria 4712
11 Ga0055537_1001041 3300003773 Bacteria 12442
12 Ga0055537_1004947 3300003773 Bacteria 3679
13 Ga0055524_1000199 3300003775 Bacteria 66009
14 Ga0055536_1001142 3300003781 Bacteria 16627
15 Ga0055536_1005028 3300003781 Bacteria 6569
16 Ga0055536_1025081 3300003781 Bacteria 1709
17 Ga0055534_1013647 3300003784 Bacteria 1553
18 Ga0055530_10000060 3300003791 Bacteria 95767
19 Ga0055530_10000095 3300003791 Bacteria 74707
20 Ga0055530_10016229 3300003791 Bacteria 2390
21 Ga0055530_10023116 3300003791 Bacteria 1793
22 Ga0055540_1003362 3300003792 Bacteria 7757
23 Ga0055531_10000049 3300003794 Bacteria 130662
24 Ga0055531_10000671 3300003794 Bacteria 29301
25 Ga0055531_10005302 3300003794 Bacteria 7566
26 Ga0055531_10015072 3300003794 Bacteria 3433
27 Ga0055531_10022602 3300003794 Bacteria 2390
28 Ga0055531_10022923 3300003794 Bacteria 2361
29 Ga0065165_1001739 3300005262 Bacteria 21750
30 Ga0065165_1008868 3300005262 Bacteria 4617
31 Ga0065165_1024167 3300005262 Bacteria 2047
32 Ga0065165_1033960 3300005262 Bacteria 1582
33 Ga0065704_10002515 3300005289 Bacteria 5085
34 Ga0065707_10115071 3300005295 Bacteria 2278
35 Ga0065707_10347026 3300005295 Bacteria 924
36 Ga0070683_100432337 3300005329 Bacteria 1256
37 Ga0070666_10000305 3300005335 Bacteria 31836
38 Ga0070669_100000013 3300005353 Bacteria 210577
39 Ga0070671_100000009 3300005355 Bacteria 206508
40 Ga0070671_100099436 3300005355 Bacteria 2440
41 Ga0070667_100000678 3300005367 Bacteria 33073
42 Ga0070667_100139972 3300005367 Bacteria 2118
43 Ga0070686_100216466 3300005544 Bacteria 1382
44 Ga0068857_100112065 3300005577 Bacteria 2453
45 Ga0068857_100209791 3300005577 Bacteria 1777
46 Ga0068859_100000202 3300005617 Bacteria 58573
47 Ga0068859_100057544 3300005617 Bacteria 3916
48 Ga0068864_100000188 3300005618 Bacteria 56337
49 Ga0068864_100005285 3300005618 Bacteria 10581
50 Ga0068861_100000474 3300005719 Bacteria 23369
51 Ga0068861_100087598 3300005719 Bacteria 2450
52 Ga0068863_100047572 3300005841 Bacteria 4068
53 Ga0068863_100055070 3300005841 Bacteria 3767
54 Ga0068858_100000688 3300005842 Bacteria 35297
55 Ga0068858_100008985 3300005842 Bacteria 9568
56 Ga0068858_100057446 3300005842 Bacteria 3596
57 Ga0068858_100171954 3300005842 Bacteria 2043
58 Ga0068860_100093856 3300005843 Bacteria 2860
59 Ga0068862_100005465 3300005844 Bacteria 10620
60 Ga0081539_10014967 3300005985 Bacteria 5685
61 Ga0068865_100295161 3300006881 Bacteria 1295
62 Ga0097620_100000202 3300006931 Bacteria 58573
63 Ga0097620_100057543 3300006931 Bacteria 3916
64 Ga0105245_10000918 3300009098 Bacteria 26787
65 Ga0105247_10000831 3300009101 Bacteria 23501
66 Ga0105243_10019992 3300009148 Bacteria 5077
67 Ga0105243_10542597 3300009148 Bacteria 1110
68 Ga0105243_10926375 3300009148 Bacteria 869
69 Ga0105248_10264922 3300009177 Bacteria 1934
70 Ga0105237_10028020 3300009545 Bacteria 5740
71 Ga0105238_10075210 3300009551 Bacteria 3369
72 Ga0105249_10066967 3300009553 Bacteria 3307
73 Ga0105249_11194917 3300009553 Bacteria 831
74 Ga0105239_10492516 3300010375 Bacteria 1393
75 Ga0157370_10389360 3300013104 Bacteria 1283
76 Ga0163162_10018534 3300013306 Bacteria 6821
77 Ga0163162_10050948 3300013306 Bacteria 4153
78 Ga0163162_10071043 3300013306 Bacteria 3533
79 Ga0163163_10155607 3300014325 Bacteria 2330
80 Ga0157379_10245297 3300014968 Bacteria 1625
81 Ga0157379_10389283 3300014968 Bacteria 1280
82 Ga0163161_10097956 3300017792 Bacteria 2179
83 Ga0209437_110447 3300025233 Bacteria 1418
84 Ga0207425_1000022 3300025245 Bacteria 355305
85 Ga0207425_1008356 3300025245 Bacteria 2655
86 Ga0209129_1002797 3300025258 Bacteria 8122
87 Ga0209233_1000066 3300025261 Bacteria 381218
88 Ga0209565_1000010 3300025263 Bacteria 687724
89 Ga0209565_1000099 3300025263 Bacteria 131080
90 Ga0209673_1001971 3300025273 Bacteria 16032
91 Ga0209675_1000025 3300025291 Bacteria 294102
92 Ga0209675_1010607 3300025291 Bacteria 3131
93 Ga0209676_1000276 3300025292 Bacteria 106867
94 Ga0209676_1000362 3300025292 Bacteria 85770
95 Ga0209676_1012889 3300025292 Bacteria 3250
96 Ga0209676_1015121 3300025292 Bacteria 2860
97 Ga0209676_1019141 3300025292 Bacteria 2364
98 Ga0209676_1027504 3300025292 Bacteria 1789
99 Ga0209676_1030743 3300025292 Bacteria 1637
100 Ga0209025_1000318 3300025294 Bacteria 107348
101 Ga0209564_1003178 3300025295 Bacteria 11543
102 Ga0209564_1004032 3300025295 Bacteria 9283
103 Ga0209564_1039773 3300025295 Bacteria 1287
104 Ga0209758_1000004 3300025297 Bacteria 1375322
105 Ga0209758_1009669 3300025297 Bacteria 5940
106 Ga0209758_1022215 3300025297 Bacteria 2922
107 Ga0209050_1000001 3300025298 Bacteria 3563507
108 Ga0209050_1000010 3300025298 Bacteria 980454
109 Ga0209050_1000728 3300025298 Bacteria 47923
110 Ga0209050_1001953 3300025298 Bacteria 19508
111 Ga0209050_1004955 3300025298 Bacteria 8676
112 Ga0209050_1027857 3300025298 Bacteria 1850
113 Ga0209050_1057028 3300025298 Bacteria 947
114 Ga0209256_1000034 3300025299 Bacteria 388475
115 Ga0209051_1000450 3300025303 Bacteria 54435
116 Ga0209257_1000009 3300025304 Bacteria 1205047
117 Ga0209257_1000487 3300025304 Bacteria 71315
118 Ga0209257_1000596 3300025304 Bacteria 59951
119 Ga0209257_1000695 3300025304 Bacteria 52248
120 Ga0209257_1000872 3300025304 Bacteria 42806
121 Ga0209257_1000921 3300025304 Bacteria 40974
122 Ga0209257_1001879 3300025304 Bacteria 22727
123 Ga0209257_1019073 3300025304 Bacteria 2602
124 Ga0207697_10001013 3300025315 Bacteria 15719
125 Ga0207710_10003272 3300025900 Bacteria 7238
126 Ga0207680_10000429 3300025903 Bacteria 19832
127 Ga0207671_10073154 3300025914 Bacteria 2560
128 Ga0207681_10000008 3300025923 Bacteria 414329
129 Ga0207694_10047452 3300025924 Bacteria 3322
130 Ga0207650_10012622 3300025925 Bacteria 5831
131 Ga0207687_10009216 3300025927 Bacteria 6458
132 Ga0207644_10000006 3300025931 Bacteria 408793
133 Ga0207644_10311465 3300025931 Bacteria 1271
134 Ga0207709_10441121 3300025935 Bacteria 1004
135 Ga0207711_10054184 3300025941 Bacteria 3441
136 Ga0207711_10109497 3300025941 Bacteria 2455
137 Ga0207712_10029836 3300025961 Bacteria 3662
138 Ga0207712_10575476 3300025961 Bacteria 971
139 Ga0207668_10000731 3300025972 Bacteria 20103
140 Ga0207658_10003035 3300025986 Bacteria 12000
141 Ga0207658_10005218 3300025986 Bacteria 8941
142 Ga0207703_10000717 3300026035 Bacteria 32692
143 Ga0207703_10001382 3300026035 Bacteria 22160
144 Ga0207703_10030735 3300026035 Bacteria 4243
145 Ga0207703_10134217 3300026035 Bacteria 2141
146 Ga0207641_10040103 3300026088 Bacteria 3918
147 Ga0207676_10000184 3300026095 Bacteria 55154
148 Ga0207676_10002410 3300026095 Bacteria 13340
149 Ga0207675_100000016 3300026118 Bacteria 126353
150 Ga0207675_100006560 3300026118 Bacteria 11012
151 Ga0268266_10031727 3300028379 Bacteria 4489
152 Ga0268265_10000392 3300028380 Bacteria 46740
153 Ga0268264_10000310 3300028381 Bacteria 78142
154 Ga0268264_10195903 3300028381 Bacteria 1845
155 Ga0307513_10162970 3300031456 Bacteria 2119
156 Ga0307508_10008297 3300031616 Bacteria 9613
157 Ga0307412_10001326 3300031911 Bacteria 13846
158 Ga0307412_10006734 3300031911 Bacteria 6514
159 Ga0307414_10002401 3300032004 Bacteria 9801
160 Ga0307414_10010725 3300032004 Bacteria 5336
161 Ga0307414_10025059 3300032004 Bacteria 3813
162 Ga0307510_10055679 3300033180 Bacteria 4128
163 Ga0439439_0007224 3300041406 Bacteria 2592
164 Ga0439461_0000029 3300041410 Bacteria 18346
165 Ga0439461_0001913 3300041410 Bacteria 3284
166 Ga0439466_0075421 3300041411 Bacteria 1069
167 Ga0439465_0000372 3300041413 Bacteria 12866
168 Ga0451843_0058334 3300041509 Bacteria 877
169 Ga0439431_0001265 3300041997 Bacteria 5536
170 Ga0439445_0003216 3300042004 Bacteria 3660
171 Ga0439445_0010439 3300042004 Bacteria 2197
172 Ga0439432_000872 3300042006 Bacteria 11305
173 Ga0439457_018289 3300042014 Bacteria 1556
174 Ga0439462_0000375 3300042015 Bacteria 8567
175 Ga0439434_0000237 3300042435 Bacteria 15345
176 Ga0451577_0258406 3300042876 Bacteria 1577
177 Ga0495627_000579 3300046453 Bacteria 29423
178 Ga0495638_0000344 3300046460 Bacteria 58565
179 Ga0495638_0029884 3300046460 Bacteria 3513
180 Ga0495650_0001710 3300046471 Bacteria 20145
181 Ga0495596_0000430 3300046500 Bacteria 26887
182 Ga0495607_0101519 3300046501 Bacteria 1540
183 Ga0495583_0037857 3300046506 Bacteria 2284
184 Ga0495606_0055970 3300046507 Bacteria 2548
185 Ga0495610_0000018 3300046512 Bacteria 355044
186 Ga0495610_0001676 3300046512 Bacteria 19476
187 Ga0495616_0000521 3300046513 Bacteria 29127
188 Ga0495616_0125781 3300046513 Bacteria 1179
189 Ga0495620_0031017 3300046515 Bacteria 2453
190 Ga0495632_0001865 3300046519 Bacteria 16917
191 Ga0495643_0000007 3300046522 Bacteria 383435
192 Ga0495643_0075494 3300046522 Bacteria 1764
193 Ga0495668_0000001 3300046616 Bacteria 1013420
194 Ga0495668_0100033 3300046616 Bacteria 1586
195 Ga0495625_0001272 3300046660 Bacteria 31687
196 Ga0495625_0002664 3300046660 Bacteria 19010
197 Ga0495625_0239057 3300046660 Bacteria 1183
198 Ga0495670_0000004 3300046691 Bacteria 310086
199 Ga0495670_0080044 3300046691 Bacteria 1663
200 Ga0495677_0025158 3300047445 Bacteria 2159
201 Ga0495681_0000040 3300047470 Bacteria 119638
202 Ga0495681_0036002 3300047470 Bacteria 2453
203 Ga0495686_0115381 3300047472 Bacteria 1606
204 Ga0495615_0000112 3300048090 Bacteria 21734
205 Ga0496102_0345410 3300048905 Bacteria 1401
206 Ga0496106_0326437 3300048909 Bacteria 1232
207 Ga0496115_0000504 3300048918 Bacteria 30605
208 Ga0496121_0000347 3300048924 Bacteria 96608
209 Ga0496122_0000934 3300048925 Bacteria 53129
210 Ga0496122_0003206 3300048925 Bacteria 21770
211 Ga0496122_0089742 3300048925 Bacteria 2100
212 Ga0496122_0109590 3300048925 Bacteria 1817
213 Ga0496123_0000740 3300048926 Bacteria 52939
214 Ga0496123_0002110 3300048926 Bacteria 25520
215 Ga0496123_0048514 3300048926 Bacteria 2856
216 Ga0496123_0081808 3300048926 Bacteria 1960
217 Ga0496124_0001292 3300048927 Bacteria 38002
218 Ga0496124_0001741 3300048927 Bacteria 30480
219 Ga0496124_0027022 3300048927 Bacteria 5162
220 Ga0496124_0124907 3300048927 Bacteria 2051
221 Ga0496125_0148901 3300048928 Bacteria 1612
222 Ga0496126_0072226 3300048929 Bacteria 3070
223 Ga0496126_0136116 3300048929 Bacteria 2119
224 Ga0501031_0121532 3300049568 Bacteria 1706
225 Ga0501031_0243070 3300049568 Bacteria 1170
226 Ga0501032_0023440 3300049569 Bacteria 4263
227 Ga0501032_0075163 3300049569 Bacteria 2250
228 Ga0501033_0005387 3300049570 Bacteria 10138
229 Ga0501033_0097832 3300049570 Bacteria 2143
230 Ga0501034_0015835 3300049571 Bacteria 7743
231 Ga0501034_0203124 3300049571 Bacteria 1939
232 Ga0501036_0026765 3300049572 Bacteria 4872
233 Ga0501037_0122035 3300049573 Bacteria 1873
234 Ga0501038_0041681 3300049574 Bacteria 4003
235 Ga0501039_0091041 3300049575 Bacteria 2377
236 Ga0501047_0063098 3300049581 Bacteria 3574
237 Ga0501047_0112166 3300049581 Bacteria 2609
238 Ga0501225_0091071 3300049705 Bacteria 883
239 Ga0501241_010816 3300049758 Bacteria 1657
240 Ga0501262_039373 3300049759 Bacteria 702
241 Ga0501264_001204 3300049761 Bacteria 2974
242 Ga0501035_0005118 3300049822 Bacteria 12415
243 Ga0501035_0055651 3300049822 Bacteria 3531
244 Ga0501044_0006703 3300049823 Bacteria 12701
245 Ga0501044_0201128 3300049823 Bacteria 1950
246 Ga0500643_001273 3300053087 Bacteria 14899
247 Ga0500643_007173 3300053087 Bacteria 4553
248 Ga0500566_0023489 3300053094 Bacteria 3620
249 Ga0500641_0035601 3300053096 Bacteria 1987
250 Ga0500562_062840 3300053108 Bacteria 998
251 Ga0500592_005654 3300053116 Bacteria 1989
252 Ga0500595_014639 3300053119 Bacteria 2971
253 Ga0500658_0000355 3300053134 Bacteria 20221
254 Ga0500658_0001058 3300053134 Bacteria 11275
255 Ga0500559_0007717 3300053136 Bacteria 4750
256 Ga0500559_0157297 3300053136 Bacteria 1067
257 Ga0500559_0162295 3300053136 Bacteria 1050
258 Ga0500559_0197938 3300053136 Bacteria 947
259 Ga0500568_0002416 3300053139 Bacteria 11013
260 Ga0500568_0006805 3300053139 Bacteria 5697
261 Ga0500568_0120456 3300053139 Bacteria 978
262 Ga0500577_0086707 3300053142 Bacteria 1258
263 Ga0500604_0021147 3300053151 Bacteria 1837
264 Ga0500624_000007 3300053157 Bacteria 184487
265 Ga0500624_000249 3300053157 Bacteria 18976
266 Ga0500627_0000991 3300053158 Bacteria 7713
267 Ga0500636_0057444 3300053177 Bacteria 2277
268 Ga0500636_0077035 3300053177 Bacteria 1927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049705 Ga0501225_0091071 Ga0501225_0091071_65_781 185
2 3300049761 Ga0501264_001204 Ga0501264_001204_804_1520 185
3 3300025961 Ga0207712_10575476 Ga0207712_105754761 198
4 3300025292 Ga0209676_1027504 Ga0209676_10275042 204
5 3300049568 Ga0501031_0121532 Ga0501031_0121532_922_1653 205
6 3300049569 Ga0501032_0075163 Ga0501032_0075163_286_1017 205
7 3300049570 Ga0501033_0097832 Ga0501033_0097832_188_919 205
8 3300049571 Ga0501034_0015835 Ga0501034_0015835_5600_6331 205
9 3300049573 Ga0501037_0122035 Ga0501037_0122035_901_1632 205
10 3300049581 Ga0501047_0112166 Ga0501047_0112166_1754_2485 205
11 3300049822 Ga0501035_0055651 Ga0501035_0055651_1014_1745 205
12 3300049823 Ga0501044_0201128 Ga0501044_0201128_223_954 205
13 3300009148 Ga0105243_10542597 Ga0105243_105425972 208
14 3300009177 Ga0105248_10264922 Ga0105248_102649222 208
15 3300049569 Ga0501032_0023440 Ga0501032_0023440_2591_3322 208
16 3300049570 Ga0501033_0005387 Ga0501033_0005387_7073_7804 208
17 3300049571 Ga0501034_0203124 Ga0501034_0203124_1187_1918 208
18 3300049572 Ga0501036_0026765 Ga0501036_0026765_1914_2645 208
19 3300049574 Ga0501038_0041681 Ga0501038_0041681_1285_2016 208
20 3300049575 Ga0501039_0091041 Ga0501039_0091041_1236_1967 208
21 3300049581 Ga0501047_0063098 Ga0501047_0063098_1646_2377 208
22 3300049822 Ga0501035_0005118 Ga0501035_0005118_1249_1980 208
23 3300049823 Ga0501044_0006703 Ga0501044_0006703_4331_5062 208
24 3300049568 Ga0501031_0243070 Ga0501031_0243070_222_953 209
25 3300049759 Ga0501262_039373 Ga0501262_039373_29_682 209
26 3300053177 Ga0500636_0057444 Ga0500636_0057444_39_692 209
27 3300014968 Ga0157379_10245297 Ga0157379_102452972 211
28 3300005719 Ga0068861_100000474 Ga0068861_10000047414 217
29 3300026118 Ga0207675_100000016 Ga0207675_10000001674 217
30 3300003320 rootH2_10146928 rootH2_101469281 218
31 3300048909 Ga0496106_0326437 Ga0496106_0326437_111_800 220
32 3300053136 Ga0500559_0157297 Ga0500559_0157297_40_747 224
33 3300003322 rootL2_10000144 rootL2_100001441 227
34 iso_pu_bacteria 2643221560 2643821653 228
35 iso_pu_bacteria 2643221563 2643835802 228
36 iso_pu_bacteria 2643221608 2644056728 228
37 iso_pu_bacteria 2852653556 2852655409 228
38 iso_pu_bacteria 2852680915 2852681766 228
39 iso_pu_bacteria 3000865235 3000866225 228
40 iso_pu_bacteria 2599185359 2600226304 229
41 iso_pu_bacteria 2818991466 2819712651 229
42 iso_pu_bacteria 2879163058 2879164524 229
43 iso_pu_bacteria 2928526807 2928527248 229
44 iso_pu_bacteria 2928968154 2928969268 229
45 3300005289 Ga0065704_10002515 Ga0065704_100025153 230
46 3300005295 Ga0065707_10115071 Ga0065707_101150713 230
47 3300005335 Ga0070666_10000305 Ga0070666_1000030511 230
48 3300005353 Ga0070669_100000013 Ga0070669_100000013202 230
49 3300005355 Ga0070671_100000009 Ga0070671_10000000921 230
50 3300005367 Ga0070667_100139972 Ga0070667_1001399722 230
51 3300005544 Ga0070686_100216466 Ga0070686_1002164661 230
52 3300005617 Ga0068859_100000202 Ga0068859_1000002027 230
53 3300005618 Ga0068864_100005285 Ga0068864_10000528510 230
54 3300005719 Ga0068861_100087598 Ga0068861_1000875982 230
55 3300005841 Ga0068863_100047572 Ga0068863_1000475722 230
56 3300005842 Ga0068858_100057446 Ga0068858_1000574462 230
57 3300005844 Ga0068862_100005465 Ga0068862_1000054652 230
58 3300006931 Ga0097620_100000202 Ga0097620_10000020253 230
59 3300009101 Ga0105247_10000831 Ga0105247_1000083110 230
60 3300009553 Ga0105249_10066967 Ga0105249_100669673 230
61 3300010375 Ga0105239_10492516 Ga0105239_104925161 230
62 3300013306 Ga0163162_10018534 Ga0163162_100185345 230
63 3300014325 Ga0163163_10155607 Ga0163163_101556072 230
64 3300025315 Ga0207697_10001013 Ga0207697_1000101312 230
65 3300025900 Ga0207710_10003272 Ga0207710_100032722 230
66 3300025903 Ga0207680_10000429 Ga0207680_100004297 230
67 3300025923 Ga0207681_10000008 Ga0207681_1000000831 230
68 3300025925 Ga0207650_10012622 Ga0207650_100126223 230
69 3300025931 Ga0207644_10000006 Ga0207644_1000000621 230
70 3300025961 Ga0207712_10029836 Ga0207712_100298363 230
71 3300025972 Ga0207668_10000731 Ga0207668_100007312 230
72 3300025986 Ga0207658_10005218 Ga0207658_100052182 230
73 3300026035 Ga0207703_10030735 Ga0207703_100307355 230
74 3300026095 Ga0207676_10002410 Ga0207676_100024102 230
75 3300026118 Ga0207675_100006560 Ga0207675_1000065603 230
76 3300028380 Ga0268265_10000392 Ga0268265_1000039221 230
77 3300028381 Ga0268264_10000310 Ga0268264_1000031060 230
78 3300041509 Ga0451843_0058334 Ga0451843_0058334_43_765 230
79 3300042876 Ga0451577_0258406 Ga0451577_0258406_352_1059 230
80 3300046460 Ga0495638_0029884 Ga0495638_0029884_2201_2917 230
81 3300046500 Ga0495596_0000430 Ga0495596_0000430_16333_17058 230
82 3300046512 Ga0495610_0001676 Ga0495610_0001676_2351_3070 230
83 3300046513 Ga0495616_0125781 Ga0495616_0125781_278_1000 230
84 3300046522 Ga0495643_0000007 Ga0495643_0000007_70200_70919 230
85 3300048090 Ga0495615_0000112 Ga0495615_0000112_20603_21325 230
86 3300048925 Ga0496122_0000934 Ga0496122_0000934_45454_46176 230
87 3300048925 Ga0496122_0003206 Ga0496122_0003206_20627_21349 230
88 3300048926 Ga0496123_0000740 Ga0496123_0000740_6852_7574 230
89 3300048926 Ga0496123_0002110 Ga0496123_0002110_4146_4868 230
90 3300048927 Ga0496124_0124907 Ga0496124_0124907_492_1214 230
91 3300053087 Ga0500643_007173 Ga0500643_007173_3191_3922 230
92 3300053139 Ga0500568_0120456 Ga0500568_0120456_141_857 230
93 3300053151 Ga0500604_0021147 Ga0500604_0021147_573_1289 230
94 3300053157 Ga0500624_000007 Ga0500624_000007_28669_29385 230
95 3300053157 Ga0500624_000249 Ga0500624_000249_18173_18904 230
96 iso_pu_bacteria 2643221622 2644126645 230
97 3300003781 Ga0055536_1001142 Ga0055536_100114213 231
98 3300003781 Ga0055536_1005028 Ga0055536_10050282 231
99 3300003781 Ga0055536_1025081 Ga0055536_10250812 231
100 3300003784 Ga0055534_1013647 Ga0055534_10136472 231
101 3300003791 Ga0055530_10000095 Ga0055530_1000009510 231
102 3300003794 Ga0055531_10000671 Ga0055531_1000067117 231
103 3300003794 Ga0055531_10005302 Ga0055531_100053024 231
104 3300005295 Ga0065707_10347026 Ga0065707_103470261 231
105 3300005355 Ga0070671_100099436 Ga0070671_1000994364 231
106 3300005367 Ga0070667_100000678 Ga0070667_10000067812 231
107 3300005841 Ga0068863_100055070 Ga0068863_1000550702 231
108 3300005843 Ga0068860_100093856 Ga0068860_1000938561 231
109 3300005985 Ga0081539_10014967 Ga0081539_100149673 231
110 3300009553 Ga0105249_11194917 Ga0105249_111949171 231
111 3300025291 Ga0209675_1000025 Ga0209675_100002570 231
112 3300025292 Ga0209676_1000276 Ga0209676_100027617 231
113 3300025292 Ga0209676_1000362 Ga0209676_100036210 231
114 3300025292 Ga0209676_1012889 Ga0209676_10128893 231
115 3300025292 Ga0209676_1019141 Ga0209676_10191413 231
116 3300025298 Ga0209050_1000728 Ga0209050_100072834 231
117 3300025298 Ga0209050_1001953 Ga0209050_100195318 231
118 3300025298 Ga0209050_1027857 Ga0209050_10278572 231
119 3300025304 Ga0209257_1000487 Ga0209257_100048760 231
120 3300025304 Ga0209257_1000596 Ga0209257_100059648 231
121 3300025304 Ga0209257_1000695 Ga0209257_10006957 231
122 3300025931 Ga0207644_10311465 Ga0207644_103114651 231
123 3300025986 Ga0207658_10003035 Ga0207658_1000303510 231
124 3300026088 Ga0207641_10040103 Ga0207641_100401032 231
125 3300028381 Ga0268264_10195903 Ga0268264_101959033 231
126 3300031911 Ga0307412_10006734 Ga0307412_100067344 231
127 3300032004 Ga0307414_10002401 Ga0307414_100024012 231
128 3300032004 Ga0307414_10010725 Ga0307414_100107253 231
129 3300032004 Ga0307414_10025059 Ga0307414_100250593 231
130 3300046453 Ga0495627_000579 Ga0495627_000579_19788_20516 231
131 3300046471 Ga0495650_0001710 Ga0495650_0001710_18909_19637 231
132 3300046501 Ga0495607_0101519 Ga0495607_0101519_90_821 231
133 3300046507 Ga0495606_0055970 Ga0495606_0055970_896_1627 231
134 3300046512 Ga0495610_0000018 Ga0495610_0000018_190550_191278 231
135 3300046515 Ga0495620_0031017 Ga0495620_0031017_95_823 231
136 3300046519 Ga0495632_0001865 Ga0495632_0001865_13861_14598 231
137 3300046522 Ga0495643_0075494 Ga0495643_0075494_585_1316 231
138 3300047470 Ga0495681_0000040 Ga0495681_0000040_8908_9636 231
139 3300048929 Ga0496126_0136116 Ga0496126_0136116_724_1452 231
140 3300053096 Ga0500641_0035601 Ga0500641_0035601_830_1537 231
141 3300053116 Ga0500592_005654 Ga0500592_005654_528_1259 231
142 3300053142 Ga0500577_0086707 Ga0500577_0086707_271_996 231
143 iso_pu_bacteria 8054302542 8054302606 231
144 3300003316 rootH1_10042889 rootH1_100428892 232
145 3300003773 Ga0055537_1001041 Ga0055537_10010412 232
146 3300005262 Ga0065165_1024167 Ga0065165_10241672 232
147 3300005577 Ga0068857_100209791 Ga0068857_1002097912 232
148 3300005617 Ga0068859_100057544 Ga0068859_1000575442 232
149 3300005842 Ga0068858_100171954 Ga0068858_1001719542 232
150 3300006881 Ga0068865_100295161 Ga0068865_1002951612 232
151 3300006931 Ga0097620_100057543 Ga0097620_1000575434 232
152 3300009148 Ga0105243_10926375 Ga0105243_109263751 232
153 3300013306 Ga0163162_10071043 Ga0163162_100710432 232
154 3300017792 Ga0163161_10097956 Ga0163161_100979562 232
155 3300025263 Ga0209565_1000099 Ga0209565_1000099107 232
156 3300025295 Ga0209564_1004032 Ga0209564_10040329 232
157 3300025935 Ga0207709_10441121 Ga0207709_104411212 232
158 3300025941 Ga0207711_10109497 Ga0207711_101094972 232
159 3300026035 Ga0207703_10134217 Ga0207703_101342172 232
160 3300028379 Ga0268266_10031727 Ga0268266_100317273 232
161 3300046513 Ga0495616_0000521 Ga0495616_0000521_16359_17108 232
162 3300053136 Ga0500559_0162295 Ga0500559_0162295_210_938 232
163 3300053158 Ga0500627_0000991 Ga0500627_0000991_2883_3632 232
164 3300053177 Ga0500636_0077035 Ga0500636_0077035_592_1335 232
165 3300002774 JGI25150J39212_1000672 JGI25150J39212_10006725 233
166 3300003214 JGI25165J46597_1000032 JGI25165J46597_100003249 233
167 3300003215 JGI25153J46596_10000017 JGI25153J46596_10000017227 233
168 3300003215 JGI25153J46596_10007786 JGI25153J46596_100077862 233
169 3300003320 rootH2_10120440 rootH2_101204402 233
170 3300003771 Ga0055526_1009390 Ga0055526_10093901 233
171 3300003773 Ga0055537_1004947 Ga0055537_10049474 233
172 3300003775 Ga0055524_1000199 Ga0055524_10001998 233
173 3300003791 Ga0055530_10000060 Ga0055530_1000006020 233
174 3300003791 Ga0055530_10016229 Ga0055530_100162291 233
175 3300003791 Ga0055530_10023116 Ga0055530_100231162 233
176 3300003792 Ga0055540_1003362 Ga0055540_10033622 233
177 3300003794 Ga0055531_10000049 Ga0055531_1000004972 233
178 3300003794 Ga0055531_10015072 Ga0055531_100150722 233
179 3300003794 Ga0055531_10022602 Ga0055531_100226021 233
180 3300003794 Ga0055531_10022923 Ga0055531_100229231 233
181 3300005262 Ga0065165_1001739 Ga0065165_100173914 233
182 3300005262 Ga0065165_1008868 Ga0065165_10088682 233
183 3300005262 Ga0065165_1033960 Ga0065165_10339603 233
184 3300005329 Ga0070683_100432337 Ga0070683_1004323372 233
185 3300005577 Ga0068857_100112065 Ga0068857_1001120653 233
186 3300005618 Ga0068864_100000188 Ga0068864_10000018846 233
187 3300005842 Ga0068858_100000688 Ga0068858_1000006883 233
188 3300005842 Ga0068858_100008985 Ga0068858_1000089852 233
189 3300009098 Ga0105245_10000918 Ga0105245_1000091814 233
190 3300009148 Ga0105243_10019992 Ga0105243_100199922 233
191 3300009545 Ga0105237_10028020 Ga0105237_100280202 233
192 3300009551 Ga0105238_10075210 Ga0105238_100752102 233
193 3300013104 Ga0157370_10389360 Ga0157370_103893602 233
194 3300013306 Ga0163162_10050948 Ga0163162_100509483 233
195 3300014968 Ga0157379_10389283 Ga0157379_103892832 233
196 3300025233 Ga0209437_110447 Ga0209437_1104471 233
197 3300025245 Ga0207425_1000022 Ga0207425_1000022275 233
198 3300025245 Ga0207425_1008356 Ga0207425_10083562 233
199 3300025258 Ga0209129_1002797 Ga0209129_10027975 233
200 3300025261 Ga0209233_1000066 Ga0209233_100006651 233
201 3300025263 Ga0209565_1000010 Ga0209565_1000010231 233
202 3300025273 Ga0209673_1001971 Ga0209673_100197110 233
203 3300025291 Ga0209675_1010607 Ga0209675_10106073 233
204 3300025292 Ga0209676_1015121 Ga0209676_10151211 233
205 3300025292 Ga0209676_1030743 Ga0209676_10307431 233
206 3300025294 Ga0209025_1000318 Ga0209025_100031883 233
207 3300025295 Ga0209564_1003178 Ga0209564_10031782 233
208 3300025295 Ga0209564_1039773 Ga0209564_10397732 233
209 3300025297 Ga0209758_1000004 Ga0209758_1000004902 233
210 3300025297 Ga0209758_1009669 Ga0209758_10096696 233
211 3300025297 Ga0209758_1022215 Ga0209758_10222154 233
212 3300025298 Ga0209050_1000001 Ga0209050_10000012902 233
213 3300025298 Ga0209050_1000010 Ga0209050_1000010529 233
214 3300025298 Ga0209050_1004955 Ga0209050_10049556 233
215 3300025298 Ga0209050_1057028 Ga0209050_10570281 233
216 3300025299 Ga0209256_1000034 Ga0209256_100003487 233
217 3300025303 Ga0209051_1000450 Ga0209051_100045039 233
218 3300025304 Ga0209257_1000009 Ga0209257_1000009587 233
219 3300025304 Ga0209257_1000872 Ga0209257_10008725 233
220 3300025304 Ga0209257_1000921 Ga0209257_10009215 233
221 3300025304 Ga0209257_1001879 Ga0209257_10018795 233
222 3300025304 Ga0209257_1019073 Ga0209257_10190733 233
223 3300025914 Ga0207671_10073154 Ga0207671_100731542 233
224 3300025924 Ga0207694_10047452 Ga0207694_100474523 233
225 3300025927 Ga0207687_10009216 Ga0207687_100092164 233
226 3300025941 Ga0207711_10054184 Ga0207711_100541842 233
227 3300026035 Ga0207703_10000717 Ga0207703_1000071733 233
228 3300026035 Ga0207703_10001382 Ga0207703_1000138214 233
229 3300026095 Ga0207676_10000184 Ga0207676_1000018457 233
230 3300031456 Ga0307513_10162970 Ga0307513_101629702 233
231 3300031616 Ga0307508_10008297 Ga0307508_100082976 233
232 3300031911 Ga0307412_10001326 Ga0307412_100013268 233
233 3300033180 Ga0307510_10055679 Ga0307510_100556792 233
234 3300041406 Ga0439439_0007224 Ga0439439_0007224_437_1171 233
235 3300041410 Ga0439461_0000029 Ga0439461_0000029_3022_3756 233
236 3300041410 Ga0439461_0001913 Ga0439461_0001913_453_1187 233
237 3300041411 Ga0439466_0075421 Ga0439466_0075421_320_1054 233
238 3300041413 Ga0439465_0000372 Ga0439465_0000372_7465_8199 233
239 3300041997 Ga0439431_0001265 Ga0439431_0001265_263_997 233
240 3300042004 Ga0439445_0003216 Ga0439445_0003216_602_1336 233
241 3300042004 Ga0439445_0010439 Ga0439445_0010439_1055_1789 233
242 3300042006 Ga0439432_000872 Ga0439432_000872_987_1721 233
243 3300042014 Ga0439457_018289 Ga0439457_018289_292_1026 233
244 3300042015 Ga0439462_0000375 Ga0439462_0000375_6816_7550 233
245 3300042435 Ga0439434_0000237 Ga0439434_0000237_14431_15165 233
246 3300046460 Ga0495638_0000344 Ga0495638_0000344_756_1490 233
247 3300046506 Ga0495583_0037857 Ga0495583_0037857_1223_1954 233
248 3300046616 Ga0495668_0000001 Ga0495668_0000001_809433_810191 233
249 3300046616 Ga0495668_0100033 Ga0495668_0100033_219_950 233
250 3300046660 Ga0495625_0001272 Ga0495625_0001272_2426_3184 233
251 3300046660 Ga0495625_0002664 Ga0495625_0002664_405_1136 233
252 3300046660 Ga0495625_0239057 Ga0495625_0239057_348_1079 233
253 3300046691 Ga0495670_0000004 Ga0495670_0000004_229972_230706 233
254 3300046691 Ga0495670_0080044 Ga0495670_0080044_411_1145 233
255 3300047445 Ga0495677_0025158 Ga0495677_0025158_1098_1829 233
256 3300047470 Ga0495681_0036002 Ga0495681_0036002_281_1015 233
257 3300047472 Ga0495686_0115381 Ga0495686_0115381_371_1105 233
258 3300048905 Ga0496102_0345410 Ga0496102_0345410_184_885 233
259 3300048918 Ga0496115_0000504 Ga0496115_0000504_11870_12577 233
260 3300048924 Ga0496121_0000347 Ga0496121_0000347_42450_43181 233
261 3300048925 Ga0496122_0089742 Ga0496122_0089742_1309_2040 233
262 3300048925 Ga0496122_0109590 Ga0496122_0109590_202_933 233
263 3300048926 Ga0496123_0048514 Ga0496123_0048514_1919_2650 233
264 3300048926 Ga0496123_0081808 Ga0496123_0081808_414_1145 233
265 3300048927 Ga0496124_0001292 Ga0496124_0001292_1283_2014 233
266 3300048927 Ga0496124_0001741 Ga0496124_0001741_23870_24601 233
267 3300048927 Ga0496124_0027022 Ga0496124_0027022_181_912 233
268 3300048928 Ga0496125_0148901 Ga0496125_0148901_741_1472 233
269 3300048929 Ga0496126_0072226 Ga0496126_0072226_1145_1876 233
270 3300049758 Ga0501241_010816 Ga0501241_010816_637_1371 233
271 3300053087 Ga0500643_001273 Ga0500643_001273_13687_14418 233
272 3300053094 Ga0500566_0023489 Ga0500566_0023489_427_1161 233
273 3300053108 Ga0500562_062840 Ga0500562_062840_144_878 233
274 3300053119 Ga0500595_014639 Ga0500595_014639_1456_2190 233
275 3300053134 Ga0500658_0000355 Ga0500658_0000355_17775_18509 233
276 3300053134 Ga0500658_0001058 Ga0500658_0001058_1812_2546 233
277 3300053136 Ga0500559_0007717 Ga0500559_0007717_2516_3250 233
278 3300053136 Ga0500559_0197938 Ga0500559_0197938_211_915 233
279 3300053139 Ga0500568_0002416 Ga0500568_0002416_8878_9636 233
280 3300053139 Ga0500568_0006805 Ga0500568_0006805_430_1164 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

13

213

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.9072 2 232
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8961 2 232
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8834 2 232
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8724 2 232
4zb7-assembly1.cif.gz_A phanerochaete chrysosporium ure2p6 in apo form. 0.7786 148 185
ID Description Score Start End Superfamily
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8827 4 232 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8645 4 232 3.40.630.40
af_A0A286Y8C0_82_329_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8201 114 132 3.40.50.980
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7761 104 135 3.30.420.10
af_Q9Y7Q2_1_228_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.7431 148 186 1.20.1050.130
ID Description Score Start End GO Terms
AF-A0A7W7K1R4-F1-model_v4 Putative N-formylglutamate amidohydrolase 0.9797 4 231 GO:0016787
AF-A0A258SHA1-F1-model_v4 N-formylglutamate amidohydrolase 0.9754 4 231 GO:0016787
AF-A0A7W0HYD9-F1-model_v4 N-formylglutamate amidohydrolase 0.9727 1 231 GO:0016787
AF-A0A285R091-F1-model_v4 Predicted N-formylglutamate amidohydrolase 0.9699 4 231 GO:0016787
AF-A0A0E9MMP6-F1-model_v4 Putative N-formylglutamate amidohydrolase 0.968 1 231 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map