F383195

General Info

Members Datasets Scaffolds Average Seq Length
279 216 558 126

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_46141|Ga0400490_46141_37497_37985
Length 150
Sequence MPTFLLADVSIQENHAEEAAMSTVNLTKENFENIVQADGIVLVDFWADWCGPCKAFAPVFEKAAAAHEDIVFGKINTEEEPELAGAFQISAIPTLMAFRDGIGVFLQPGMMPGAALEDLIGQIRALDMEDVKKKMAEHEQSGASRSAQPN

Samples

Sample ID Description Type Environment
1 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
119 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
120 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
185 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
208 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
209 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
215 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
216 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.74
Metatranscriptomes 12.19
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 2.51
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400490_46141 3300038726 Bacteria 64156
2 Ga0007429J51699_1045671 3300003579 Bacteria 596
3 Ga0006780_1048832 3300003735 Bacteria 525
4 Ga0068869_100181117 3300005334 Bacteria 1652
5 Ga0068868_100642653 3300005338 Bacteria 944
6 Ga0070701_10259198 3300005438 Bacteria 1053
7 Ga0070663_100100103 3300005455 Bacteria 2162
8 Ga0070681_10477716 3300005458 Bacteria 1159
9 Ga0070685_10075952 3300005466 Bacteria 2003
10 Ga0070698_100018772 3300005471 Bacteria 7279
11 Ga0070679_100035141 3300005530 Bacteria 4971
12 Ga0070684_100414074 3300005535 Bacteria 1244
13 Ga0068853_100018181 3300005539 Bacteria 5815
14 Ga0070665_100020919 3300005548 Bacteria 6575
15 Ga0070665_100948739 3300005548 Bacteria 873
16 Ga0068855_100016631 3300005563 Bacteria 8843
17 Ga0068855_100326703 3300005563 Bacteria 1694
18 Ga0068857_100396932 3300005577 Bacteria 1283
19 Ga0068854_100002463 3300005578 Bacteria 11462
20 Ga0068856_100392521 3300005614 Bacteria 1407
21 Ga0068852_100112602 3300005616 Bacteria 2476
22 Ga0068864_100206886 3300005618 Bacteria 1805
23 Ga0068861_100367292 3300005719 Bacteria 1267
24 Ga0068870_10158488 3300005840 Bacteria 1340
25 Ga0070712_100730425 3300006175 Bacteria 846
26 Ga0068871_100233474 3300006358 Bacteria 1597
27 Ga0075430_100887185 3300006846 Bacteria 735
28 Ga0075431_100033664 3300006847 Bacteria 5280
29 Ga0075429_100227093 3300006880 Bacteria 1635
30 Ga0105240_10004864 3300009093 Bacteria 20223
31 Ga0105240_12528852 3300009093 Bacteria 531
32 Ga0105245_10178295 3300009098 Bacteria 2028
33 Ga0114129_11480501 3300009147 Bacteria 835
34 Ga0105243_11042586 3300009148 Bacteria 823
35 Ga0105241_10001785 3300009174 Bacteria 16342
36 Ga0105241_10497414 3300009174 Bacteria 1086
37 Ga0105242_10516871 3300009176 Bacteria 1138
38 Ga0105242_10580915 3300009176 Bacteria 1079
39 Ga0105237_10017315 3300009545 Bacteria 7472
40 Ga0105237_10517500 3300009545 Bacteria 1200
41 Ga0105238_10004973 3300009551 Bacteria 13143
42 Ga0105239_10010505 3300010375 Bacteria 10349
43 Ga0105239_10165554 3300010375 Bacteria 2472
44 Ga0105246_10525387 3300011119 Bacteria 1009
45 Ga0105246_11137233 3300011119 Bacteria 715
46 Ga0157378_11723384 3300013297 Bacteria 674
47 Ga0157375_11053389 3300013308 Bacteria 951
48 Ga0163163_12588390 3300014325 Bacteria 565
49 Ga0157380_11346837 3300014326 Bacteria 763
50 Ga0157379_12408619 3300014968 Bacteria 525
51 Ga0182006_1099270 3300015261 Bacteria 1036
52 Ga0182007_10003336 3300015262 Bacteria 7597
53 Ga0182005_1010339 3300015265 Bacteria 2688
54 Ga0197907_10267518 3300020069 Bacteria 1532
55 Ga0206356_10144214 3300020070 Bacteria 527
56 Ga0206356_11468343 3300020070 Bacteria 1678
57 Ga0206355_1129898 3300020076 Bacteria 1038
58 Ga0206352_10739235 3300020078 Bacteria 552
59 Ga0206350_10811626 3300020080 Bacteria 545
60 Ga0206350_11390653 3300020080 Bacteria 536
61 Ga0206353_10292718 3300020082 Bacteria 624
62 Ga0206353_11938117 3300020082 Bacteria 1637
63 Ga0213876_10050142 3300021384 Bacteria 2206
64 Ga0224712_10042751 3300022467 Bacteria 1719
65 Ga0224712_10633693 3300022467 Bacteria 523
66 Ga0207642_10496407 3300025899 Bacteria 747
67 Ga0207647_10006883 3300025904 Bacteria 8242
68 Ga0207707_10418463 3300025912 Bacteria 1149
69 Ga0207695_10011229 3300025913 Bacteria 10862
70 Ga0207695_10028509 3300025913 Bacteria 6189
71 Ga0207671_10001223 3300025914 Bacteria 30415
72 Ga0207652_10008782 3300025921 Bacteria 8136
73 Ga0207694_10004866 3300025924 Bacteria 10429
74 Ga0207687_10242173 3300025927 Bacteria 1430
75 Ga0207689_10263663 3300025942 Bacteria 1426
76 Ga0207667_10048223 3300025949 Bacteria 4505
77 Ga0207712_10269420 3300025961 Bacteria 1384
78 Ga0207640_10018919 3300025981 Bacteria 4057
79 Ga0207703_10681129 3300026035 Bacteria 977
80 Ga0207678_10087273 3300026067 Bacteria 2666
81 Ga0207702_10482140 3300026078 Bacteria 1207
82 Ga0207702_10721128 3300026078 Bacteria 983
83 Ga0207702_11531211 3300026078 Bacteria 660
84 Ga0207641_10023081 3300026088 Bacteria 5126
85 Ga0207648_10463598 3300026089 Bacteria 1155
86 Ga0207676_10394429 3300026095 Bacteria 1292
87 Ga0207675_100090293 3300026118 Bacteria 2880
88 Ga0207675_100176032 3300026118 Bacteria 2047
89 Ga0207698_10028994 3300026142 Bacteria 3957
90 Ga0207698_11878062 3300026142 Bacteria 614
91 Ga0268266_10015595 3300028379 Bacteria 6512
92 Ga0268264_11230885 3300028381 Bacteria 758
93 Ga0265337_1005943 3300028556 Bacteria 4770
94 Ga0265323_10096310 3300028653 Bacteria 983
95 Ga0265330_10004235 3300031235 Bacteria 7316
96 Ga0265332_10081286 3300031238 Bacteria 1374
97 Ga0265320_10025444 3300031240 Bacteria 3110
98 Ga0265340_10000094 3300031247 Bacteria 41873
99 Ga0265339_10056770 3300031249 Bacteria 2119
100 Ga0265339_10117465 3300031249 Bacteria 1370
101 Ga0265316_10024946 3300031344 Bacteria 4998
102 Ga0265316_10179291 3300031344 Bacteria 1578
103 Ga0307513_10533608 3300031456 Bacteria 887
104 Ga0307509_10000429 3300031507 Bacteria 70665
105 Ga0307509_10170302 3300031507 Bacteria 2058
106 Ga0307509_10184529 3300031507 Bacteria 1946
107 Ga0307408_102207861 3300031548 Bacteria 532
108 Ga0307508_10504395 3300031616 Bacteria 805
109 Ga0316579_10366749 3300031691 Bacteria 696
110 Ga0265314_10000086 3300031711 Bacteria 139471
111 Ga0265314_10071532 3300031711 Bacteria 2320
112 Ga0265342_10000485 3300031712 Bacteria 43063
113 Ga0316576_10034543 3300031727 Bacteria 3604
114 Ga0316578_10006341 3300031728 Bacteria 5831
115 Ga0307409_100890867 3300031995 Bacteria 903
116 Ga0307415_100922152 3300032126 Bacteria 807
117 Ga0307415_101063529 3300032126 Bacteria 756
118 Ga0316593_10087696 3300032168 Bacteria 1093
119 Ga0316593_10095800 3300032168 Bacteria 1048
120 Ga0316592_1022233 3300033524 Bacteria 1355
121 Ga0316592_1042820 3300033524 Bacteria 1004
122 Ga0316592_1130911 3300033524 Bacteria 585
123 Ga0316586_1033462 3300033527 Bacteria 887
124 Ga0316586_1034250 3300033527 Bacteria 878
125 Ga0316588_1015613 3300033528 Bacteria 1674
126 Ga0316588_1022167 3300033528 Bacteria 1450
127 Ga0316588_1026239 3300033528 Bacteria 1348
128 Ga0316588_1038328 3300033528 Bacteria 1142
129 Ga0316588_1047578 3300033528 Unclassified 1036
130 Ga0316588_1065521 3300033528 Bacteria 889
131 Ga0316588_1095816 3300033528 Bacteria 741
132 Ga0316588_1134231 3300033528 Bacteria 630
133 Ga0316588_1177797 3300033528 Bacteria 552
134 Ga0316588_1204786 3300033528 Bacteria 517
135 Ga0316587_1006275 3300033529 Bacteria 1811
136 Ga0316596_1062940 3300033541 Bacteria 990
137 Ga0316596_1164540 3300033541 Bacteria 611
138 Ga0316596_1185596 3300033541 Bacteria 576
139 Ga0373950_0000034 3300034818 Bacteria 143669
140 Ga0373926_0008847 3300035083 Bacteria 3354
141 Ga0373926_0011477 3300035083 Bacteria 2980
142 Ga0373944_0028802 3300035089 Bacteria 1655
143 Ga0373923_0230142 3300035111 Bacteria 863
144 Ga0373936_0024942 3300035113 Bacteria 2336
145 Ga0373941_0005560 3300035115 Bacteria 2973
146 Ga0373945_0005768 3300035116 Bacteria 3973
147 Ga0373953_0308461 3300035117 Bacteria 691
148 Ga0373954_0468661 3300035118 Bacteria 624
149 Ga0373943_0249426 3300035170 Bacteria 996
150 Ga0373924_0169671 3300035410 Bacteria 959
151 Ga0373935_0036322 3300035692 Bacteria 3079
152 Ga0373927_0009707 3300035695 Bacteria 6453
153 Ga0373933_0938042 3300035724 Bacteria 570
154 Ga0373947_0701169 3300035725 Bacteria 691
155 Ga0316582_0066234 3300036647 Bacteria 2328
156 Ga0373925_0015285 3300037068 Bacteria 5550
157 Ga0373925_0631446 3300037068 Bacteria 882
158 Ga0400491_09909 3300038727 Bacteria 3396
159 Ga0400486_18691 3300038742 Bacteria 2310
160 Ga0400489_88336 3300039093 Bacteria 1564
161 Ga0436365_0505469 3300039437 Bacteria 2067
162 Ga0436363_0486645 3300039450 Bacteria 666
163 Ga0451849_0427461 3300041505 Bacteria 504
164 Ga0439448_0020607 3300042005 Bacteria 2042
165 Ga0439455_0057631 3300042012 Bacteria 1025
166 Ga0450903_000198 3300042138 Bacteria 13325
167 Ga0439458_0003541 3300042157 Bacteria 3644
168 Ga0466969_0136732 3300044656 Bacteria 1134
169 Ga0466961_0538909 3300044693 Bacteria 703
170 Ga0466971_0050174 3300044719 Bacteria 1878
171 Ga0466970_0072529 3300044765 Bacteria 1852
172 Ga0466960_0762445 3300044901 Bacteria 584
173 Ga0466959_0200937 3300045049 Bacteria 1388
174 Ga0466958_0937449 3300045836 Bacteria 565
175 Ga0495592_0105043 3300046454 Bacteria 2007
176 Ga0495603_0117204 3300046455 Bacteria 1552
177 Ga0495651_0000834 3300046462 Bacteria 23983
178 Ga0495580_0000780 3300046472 Bacteria 27419
179 Ga0495582_0018378 3300046473 Bacteria 3824
180 Ga0495596_0254620 3300046500 Bacteria 681
181 Ga0495608_0682366 3300046511 Bacteria 612
182 Ga0495628_0007780 3300046516 Bacteria 9239
183 Ga0495630_0147783 3300046517 Bacteria 1788
184 Ga0495630_0650343 3300046517 Bacteria 807
185 Ga0495630_0730742 3300046517 Bacteria 757
186 Ga0495652_0002071 3300046529 Bacteria 21204
187 Ga0495586_0004233 3300046535 Bacteria 7682
188 Ga0495645_0469936 3300046543 Bacteria 790
189 Ga0495667_0170454 3300046559 Bacteria 1399
190 Ga0495667_0396366 3300046559 Bacteria 870
191 Ga0495635_0983808 3300046663 Bacteria 537
192 Ga0495647_0001167 3300046681 Bacteria 8076
193 Ga0495658_0023702 3300046683 Bacteria 3261
194 Ga0495613_0855936 3300046689 Bacteria 591
195 Ga0495670_0752267 3300046691 Bacteria 532
196 Ga0495589_0512420 3300046794 Bacteria 547
197 Ga0495600_0004773 3300046809 Bacteria 8133
198 Ga0495581_0331155 3300047315 Bacteria 889
199 Ga0495604_0030099 3300047317 Bacteria 4315
200 Ga0495674_1234933 3300047319 Bacteria 563
201 Ga0495676_0040690 3300047321 Bacteria 3833
202 Ga0495677_0289665 3300047445 Bacteria 643
203 Ga0495615_0156592 3300048090 Bacteria 681
204 Ga0496102_0494600 3300048905 Bacteria 1145
205 Ga0496102_0853045 3300048905 Bacteria 833
206 Ga0496108_0227221 3300048911 Bacteria 1622
207 Ga0496109_0152596 3300048912 Bacteria 2163
208 Ga0496110_0120139 3300048913 Bacteria 2367
209 Ga0496110_0614803 3300048913 Bacteria 985
210 Ga0496114_0005667 3300048917 Bacteria 9792
211 Ga0501299_003699 3300049522 Bacteria 2238
212 Ga0501032_0901190 3300049569 Bacteria 557
213 Ga0501034_0000081 3300049571 Bacteria 170682
214 Ga0501036_0070104 3300049572 Bacteria 2964
215 Ga0501036_0170976 3300049572 Bacteria 1831
216 Ga0501036_0476529 3300049572 Bacteria 1039
217 Ga0501037_0846028 3300049573 Bacteria 602
218 Ga0501038_0093238 3300049574 Bacteria 2520
219 Ga0501042_0210333 3300049578 Bacteria 1403
220 Ga0501046_0003780 3300049580 Bacteria 13860
221 Ga0501047_0000001 3300049581 Bacteria 658799
222 Ga0501047_1445996 3300049581 Bacteria 503
223 Ga0501048_0000510 3300049582 Bacteria 27219
224 Ga0501069_0040790 3300049585 Bacteria 2565
225 Ga0501070_0000004 3300049586 Bacteria 254956
226 Ga0501070_0021879 3300049586 Bacteria 5356
227 Ga0501070_0389459 3300049586 Bacteria 1128
228 Ga0501070_0635343 3300049586 Bacteria 849
229 Ga0501071_0201836 3300049587 Bacteria 1494
230 Ga0501072_0000020 3300049588 Bacteria 156058
231 Ga0501072_1244440 3300049588 Bacteria 578
232 Ga0501072_1361471 3300049588 Bacteria 549
233 Ga0501073_0005045 3300049589 Bacteria 9896
234 Ga0501073_0024847 3300049589 Bacteria 4300
235 Ga0501074_0002141 3300049590 Bacteria 13658
236 Ga0501074_0266205 3300049590 Bacteria 1218
237 Ga0501202_072007 3300049652 Bacteria 798
238 Ga0501216_000892 3300049660 Bacteria 3783
239 Ga0501227_001765 3300049665 Bacteria 4802
240 Ga0501230_001971 3300049667 Bacteria 2555
241 Ga0501233_002929 3300049668 Bacteria 3045
242 Ga0501235_040162 3300049669 Bacteria 1069
243 Ga0501225_0002666 3300049705 Bacteria 5480
244 Ga0501079_0000389 3300049741 Bacteria 28316
245 Ga0501079_0234115 3300049741 Bacteria 1435
246 Ga0501079_1661730 3300049741 Bacteria 502
247 Ga0501080_0004242 3300049742 Bacteria 12716
248 Ga0501080_0022128 3300049742 Bacteria 5890
249 Ga0501081_0045723 3300049743 Bacteria 3006
250 Ga0501081_0753940 3300049743 Bacteria 732
251 Ga0501083_0000967 3300049744 Bacteria 19021
252 Ga0501083_0006291 3300049744 Bacteria 8420
253 Ga0501035_0866572 3300049822 Bacteria 717
254 Ga0501044_1404502 3300049823 Bacteria 564
255 nmdc:mga03n38_92611_c1 3300050490 Bacteria 1442
256 nmdc:mga06z11_70347_c1 3300050494 Bacteria 1850
257 nmdc:mga04h51_9655_c1 3300050495 Bacteria 2625
258 nmdc:mga05p37_1070031_c1 3300050507 Bacteria 848
259 nmdc:mga09592_325700_c1 3300050508 Bacteria 1331
260 nmdc:mga0qj67_824066_c1 3300050509 Bacteria 734
261 nmdc:mga06r32_189724_c1 3300050510 Bacteria 2043
262 Ga0500635_0012602 3300053080 Bacteria 2433
263 Ga0500647_0300313 3300053091 Bacteria 687
264 Ga0500566_0009668 3300053094 Bacteria 5698
265 Ga0500566_0129778 3300053094 Bacteria 1350
266 Ga0500575_123068 3300053112 Bacteria 903
267 Ga0500614_002052 3300053123 Bacteria 4603
268 Ga0500585_065703 3300053144 Bacteria 1308
269 Ga0500590_240403 3300053148 Bacteria 729
270 Ga0500603_004555 3300053150 Bacteria 2968
271 Ga0500603_018388 3300053150 Bacteria 1683
272 Ga0500636_0180281 3300053177 Bacteria 1135
273 Ga0500637_0134284 3300053178 Bacteria 1434
274 Ga0501084_0000014 3300054114 Bacteria 172170
275 Ga0501082_0008504 3300060353 Bacteria 8848
276 Ga0501082_0025588 3300060353 Bacteria 5085
277 2984578077 2984576629 Bacteria 4248407
278 2990257591 2990256926 Bacteria 4252839
279 8004214890 8004212874 Bacteria 2861420
280 Ga0400490_46141
281 Ga0007429J51699_1045671
282 Ga0006780_1048832
283 Ga0068869_100181117
284 Ga0068868_100642653
285 Ga0070701_10259198
286 Ga0070663_100100103
287 Ga0070681_10477716
288 Ga0070685_10075952
289 Ga0070698_100018772
290 Ga0070679_100035141
291 Ga0070684_100414074
292 Ga0068853_100018181
293 Ga0070665_100020919
294 Ga0070665_100948739
295 Ga0068855_100016631
296 Ga0068855_100326703
297 Ga0068857_100396932
298 Ga0068854_100002463
299 Ga0068856_100392521
300 Ga0068852_100112602
301 Ga0068864_100206886
302 Ga0068861_100367292
303 Ga0068870_10158488
304 Ga0070712_100730425
305 Ga0068871_100233474
306 Ga0075430_100887185
307 Ga0075431_100033664
308 Ga0075429_100227093
309 Ga0105240_10004864
310 Ga0105240_12528852
311 Ga0105245_10178295
312 Ga0114129_11480501
313 Ga0105243_11042586
314 Ga0105241_10001785
315 Ga0105241_10497414
316 Ga0105242_10516871
317 Ga0105242_10580915
318 Ga0105237_10017315
319 Ga0105237_10517500
320 Ga0105238_10004973
321 Ga0105239_10010505
322 Ga0105239_10165554
323 Ga0105246_10525387
324 Ga0105246_11137233
325 Ga0157378_11723384
326 Ga0157375_11053389
327 Ga0163163_12588390
328 Ga0157380_11346837
329 Ga0157379_12408619
330 Ga0182006_1099270
331 Ga0182007_10003336
332 Ga0182005_1010339
333 Ga0197907_10267518
334 Ga0206356_10144214
335 Ga0206356_11468343
336 Ga0206355_1129898
337 Ga0206352_10739235
338 Ga0206350_10811626
339 Ga0206350_11390653
340 Ga0206353_10292718
341 Ga0206353_11938117
342 Ga0213876_10050142
343 Ga0224712_10042751
344 Ga0224712_10633693
345 Ga0207642_10496407
346 Ga0207647_10006883
347 Ga0207707_10418463
348 Ga0207695_10011229
349 Ga0207695_10028509
350 Ga0207671_10001223
351 Ga0207652_10008782
352 Ga0207694_10004866
353 Ga0207687_10242173
354 Ga0207689_10263663
355 Ga0207667_10048223
356 Ga0207712_10269420
357 Ga0207640_10018919
358 Ga0207703_10681129
359 Ga0207678_10087273
360 Ga0207702_10482140
361 Ga0207702_10721128
362 Ga0207702_11531211
363 Ga0207641_10023081
364 Ga0207648_10463598
365 Ga0207676_10394429
366 Ga0207675_100090293
367 Ga0207675_100176032
368 Ga0207698_10028994
369 Ga0207698_11878062
370 Ga0268266_10015595
371 Ga0268264_11230885
372 Ga0265337_1005943
373 Ga0265323_10096310
374 Ga0265330_10004235
375 Ga0265332_10081286
376 Ga0265320_10025444
377 Ga0265340_10000094
378 Ga0265339_10056770
379 Ga0265339_10117465
380 Ga0265316_10024946
381 Ga0265316_10179291
382 Ga0307513_10533608
383 Ga0307509_10000429
384 Ga0307509_10170302
385 Ga0307509_10184529
386 Ga0307408_102207861
387 Ga0307508_10504395
388 Ga0316579_10366749
389 Ga0265314_10000086
390 Ga0265314_10071532
391 Ga0265342_10000485
392 Ga0316576_10034543
393 Ga0316578_10006341
394 Ga0307409_100890867
395 Ga0307415_100922152
396 Ga0307415_101063529
397 Ga0316593_10087696
398 Ga0316593_10095800
399 Ga0316592_1022233
400 Ga0316592_1042820
401 Ga0316592_1130911
402 Ga0316586_1033462
403 Ga0316586_1034250
404 Ga0316588_1015613
405 Ga0316588_1022167
406 Ga0316588_1026239
407 Ga0316588_1038328
408 Ga0316588_1047578
409 Ga0316588_1065521
410 Ga0316588_1095816
411 Ga0316588_1134231
412 Ga0316588_1177797
413 Ga0316588_1204786
414 Ga0316587_1006275
415 Ga0316596_1062940
416 Ga0316596_1164540
417 Ga0316596_1185596
418 Ga0373950_0000034
419 Ga0373926_0008847
420 Ga0373926_0011477
421 Ga0373944_0028802
422 Ga0373923_0230142
423 Ga0373936_0024942
424 Ga0373941_0005560
425 Ga0373945_0005768
426 Ga0373953_0308461
427 Ga0373954_0468661
428 Ga0373943_0249426
429 Ga0373924_0169671
430 Ga0373935_0036322
431 Ga0373927_0009707
432 Ga0373933_0938042
433 Ga0373947_0701169
434 Ga0316582_0066234
435 Ga0373925_0015285
436 Ga0373925_0631446
437 Ga0400491_09909
438 Ga0400486_18691
439 Ga0400489_88336
440 Ga0436365_0505469
441 Ga0436363_0486645
442 Ga0451849_0427461
443 Ga0439448_0020607
444 Ga0439455_0057631
445 Ga0450903_000198
446 Ga0439458_0003541
447 Ga0466969_0136732
448 Ga0466961_0538909
449 Ga0466971_0050174
450 Ga0466970_0072529
451 Ga0466960_0762445
452 Ga0466959_0200937
453 Ga0466958_0937449
454 Ga0495592_0105043
455 Ga0495603_0117204
456 Ga0495651_0000834
457 Ga0495580_0000780
458 Ga0495582_0018378
459 Ga0495596_0254620
460 Ga0495608_0682366
461 Ga0495628_0007780
462 Ga0495630_0147783
463 Ga0495630_0650343
464 Ga0495630_0730742
465 Ga0495652_0002071
466 Ga0495586_0004233
467 Ga0495645_0469936
468 Ga0495667_0170454
469 Ga0495667_0396366
470 Ga0495635_0983808
471 Ga0495647_0001167
472 Ga0495658_0023702
473 Ga0495613_0855936
474 Ga0495670_0752267
475 Ga0495589_0512420
476 Ga0495600_0004773
477 Ga0495581_0331155
478 Ga0495604_0030099
479 Ga0495674_1234933
480 Ga0495676_0040690
481 Ga0495677_0289665
482 Ga0495615_0156592
483 Ga0496102_0494600
484 Ga0496102_0853045
485 Ga0496108_0227221
486 Ga0496109_0152596
487 Ga0496110_0120139
488 Ga0496110_0614803
489 Ga0496114_0005667
490 Ga0501299_003699
491 Ga0501032_0901190
492 Ga0501034_0000081
493 Ga0501036_0070104
494 Ga0501036_0170976
495 Ga0501036_0476529
496 Ga0501037_0846028
497 Ga0501038_0093238
498 Ga0501042_0210333
499 Ga0501046_0003780
500 Ga0501047_0000001
501 Ga0501047_1445996
502 Ga0501048_0000510
503 Ga0501069_0040790
504 Ga0501070_0000004
505 Ga0501070_0021879
506 Ga0501070_0389459
507 Ga0501070_0635343
508 Ga0501071_0201836
509 Ga0501072_0000020
510 Ga0501072_1244440
511 Ga0501072_1361471
512 Ga0501073_0005045
513 Ga0501073_0024847
514 Ga0501074_0002141
515 Ga0501074_0266205
516 Ga0501202_072007
517 Ga0501216_000892
518 Ga0501227_001765
519 Ga0501230_001971
520 Ga0501233_002929
521 Ga0501235_040162
522 Ga0501225_0002666
523 Ga0501079_0000389
524 Ga0501079_0234115
525 Ga0501079_1661730
526 Ga0501080_0004242
527 Ga0501080_0022128
528 Ga0501081_0045723
529 Ga0501081_0753940
530 Ga0501083_0000967
531 Ga0501083_0006291
532 Ga0501035_0866572
533 Ga0501044_1404502
534 nmdc:mga03n38_92611_c1
535 nmdc:mga06z11_70347_c1
536 nmdc:mga04h51_9655_c1
537 nmdc:mga05p37_1070031_c1
538 nmdc:mga09592_325700_c1
539 nmdc:mga0qj67_824066_c1
540 nmdc:mga06r32_189724_c1
541 Ga0500635_0012602
542 Ga0500647_0300313
543 Ga0500566_0009668
544 Ga0500566_0129778
545 Ga0500575_123068
546 Ga0500614_002052
547 Ga0500585_065703
548 Ga0500590_240403
549 Ga0500603_004555
550 Ga0500603_018388
551 Ga0500636_0180281
552 Ga0500637_0134284
553 Ga0501084_0000014
554 Ga0501082_0008504
555 Ga0501082_0025588
556 2984578077
557 2990257591
558 8004214890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

22

122

0.91

PF13098

Thioredoxin_2

Thioredoxin-like domain

34

120

0.88

PF14595

Thioredoxin_9

Thioredoxin

4

124

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tco-assembly3.cif.gz_C crystallographic and spectroscopic characterization of sulfolobus solfataricus trxa1 provide insights into the determinants of thioredoxin fold stability 0.9699 3 102
2ynx-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last archaea common ancestor (laca) from the precambrian period 0.9688 2 102
3ul3-assembly2.cif.gz_A structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery 0.9675 19 102
4ba7-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period 0.9674 2 102
3hhv-assembly1.cif.gz_A-2 the crystal structure of the thioredoxin a2 from sulfolobus solfataricus 0.9662 2 103
ID Description Score Start End Superfamily
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9842 2 107 3.40.30.10
3tcoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9699 3 102 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9664 20 102 3.40.30.10
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 2 107 3.40.30.10
af_I1JGA5_424_522_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9634 19 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1H2D0A3-F1-model_v4 Thioredoxin 0.9995 1 118 GO:0005829
GO:0015035
AF-A0A3T1APQ2-F1-model_v4 Thioredoxin 0.9985 1 121 GO:0005829
GO:0015035
AF-A0A7W5AJP1-F1-model_v4 Thioredoxin 0.9984 1 121 GO:0005829
GO:0015035
AF-A0A5D3F672-F1-model_v4 Thioredoxin 0.998 1 116 GO:0005829
GO:0015035
AF-A0A1H9RHH5-F1-model_v4 Thioredoxin 0.9979 1 115 GO:0005829
GO:0015035

Map