F383145

General Info

Members Datasets Scaffolds Average Seq Length
279 225 558 185

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10360298|Ga0307513_103602982
Length 199
Sequence MLMRRLEFAALAAITLLCVTSAKAQGPYGIGRVATPAEIAGWNIDVGGDGSNLPSGIGSVSHGSEVFGQQCAACHGAKGEGGIGDRLVGGQGTLGTSKPVRTVGSYWPYAPTLFDYIRRAMPQNAPQSLGNDDVYAVSAYILSLNGLLPADATLDAKALTKIKMPNRNMFVGDPRPDVKNPECMTGCQGNNTNSGISKP

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
212 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
213 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
214 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
217 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
218 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
219 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
220 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
221 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
222 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
223 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
224 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
225 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.17
Nodule 1.08
Rhizoplane 6.45
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10360298 3300031456 Bacteria 1199
2 JGI25404J52841_10000396 3300003659 Bacteria 6017
3 JGI25404J52841_10002951 3300003659 Bacteria 3301
4 JGI25404J52841_10005232 3300003659 Bacteria 2677
5 JGI25404J52841_10015718 3300003659 Bacteria 1642
6 Ga0070658_10134236 3300005327 Bacteria 2064
7 Ga0070683_100022259 3300005329 Bacteria 5662
8 Ga0068869_100000485 3300005334 Bacteria 22024
9 Ga0070680_100002115 3300005336 Bacteria 14670
10 Ga0068868_100202137 3300005338 Bacteria 1657
11 Ga0070661_100604711 3300005344 Bacteria 887
12 Ga0070668_100075107 3300005347 Bacteria 2638
13 Ga0070669_100120415 3300005353 Bacteria 2001
14 Ga0070659_100172584 3300005366 Bacteria 1772
15 Ga0070667_100014512 3300005367 Bacteria 6510
16 Ga0070709_10018039 3300005434 Bacteria 4056
17 Ga0070709_10671707 3300005434 Bacteria 804
18 Ga0070714_100383101 3300005435 Bacteria 1326
19 Ga0070713_100003174 3300005436 Bacteria 10821
20 Ga0070711_100156197 3300005439 Bacteria 1725
21 Ga0070694_100175337 3300005444 Bacteria 1582
22 Ga0070708_100088909 3300005445 Bacteria 2810
23 Ga0070708_100874644 3300005445 Bacteria 844
24 Ga0070662_100007714 3300005457 Bacteria 6984
25 Ga0070707_101022458 3300005468 Bacteria 792
26 Ga0070698_100041564 3300005471 Bacteria 4719
27 Ga0070698_100242379 3300005471 Bacteria 1736
28 Ga0070699_100182294 3300005518 Bacteria 1864
29 Ga0070679_100304033 3300005530 Bacteria 1545
30 Ga0070684_100002850 3300005535 Bacteria 12851
31 Ga0070684_100009194 3300005535 Bacteria 7774
32 Ga0070697_100079382 3300005536 Bacteria 2702
33 Ga0070697_100514937 3300005536 Bacteria 1047
34 Ga0070697_100635291 3300005536 Bacteria 940
35 Ga0068853_100001194 3300005539 Bacteria 18523
36 Ga0068853_100085687 3300005539 Bacteria 2762
37 Ga0070695_100519946 3300005545 Bacteria 923
38 Ga0070696_100085736 3300005546 Bacteria 2236
39 Ga0068855_100055468 3300005563 Bacteria 4654
40 Ga0068855_100337007 3300005563 Bacteria 1664
41 Ga0068857_100052556 3300005577 Bacteria 3615
42 Ga0068852_100088751 3300005616 Bacteria 2762
43 Ga0068866_10247029 3300005718 Bacteria 1090
44 Ga0068861_100082894 3300005719 Bacteria 2514
45 Ga0068851_10000516 3300005834 Bacteria 16919
46 Ga0068858_100096837 3300005842 Bacteria 2750
47 Ga0068860_100001705 3300005843 Bacteria 23470
48 Ga0068860_100069796 3300005843 Bacteria 3340
49 Ga0068862_100114630 3300005844 Bacteria 2369
50 Ga0081540_1000976 3300005983 Bacteria 25808
51 Ga0081540_1001709 3300005983 Bacteria 18581
52 Ga0081540_1002909 3300005983 Bacteria 13805
53 Ga0081540_1003388 3300005983 Bacteria 12637
54 Ga0081540_1019795 3300005983 Bacteria 4075
55 Ga0070717_10066530 3300006028 Bacteria 2997
56 Ga0070717_10230357 3300006028 Bacteria 1631
57 Ga0070712_100027070 3300006175 Bacteria 3825
58 Ga0075366_10118740 3300006195 Bacteria 1593
59 Ga0075433_10718306 3300006852 Bacteria 875
60 Ga0099794_10076391 3300007265 Bacteria 1646
61 Ga0099794_10081418 3300007265 Bacteria 1597
62 Ga0099794_10144604 3300007265 Bacteria 1205
63 Ga0099795_10025782 3300007788 Bacteria 1975
64 Ga0099795_10045556 3300007788 Bacteria 1577
65 Ga0105250_10009427 3300009092 Bacteria 4111
66 Ga0105250_10189843 3300009092 Unclassified 864
67 Ga0105240_10004989 3300009093 Bacteria 19936
68 Ga0105240_10997177 3300009093 Bacteria 896
69 Ga0114129_10885604 3300009147 Bacteria 1132
70 Ga0105243_10029550 3300009148 Bacteria 4215
71 Ga0105237_10004248 3300009545 Bacteria 16672
72 Ga0105237_10874927 3300009545 Bacteria 905
73 Ga0105238_10005783 3300009551 Bacteria 12239
74 Ga0105249_10024773 3300009553 Bacteria 5395
75 Ga0099796_10031950 3300010159 Bacteria 1721
76 Ga0099796_10035727 3300010159 Bacteria 1650
77 Ga0099796_10082954 3300010159 Bacteria 1178
78 Ga0099796_10271507 3300010159 Bacteria 710
79 Ga0105239_10004627 3300010375 Bacteria 16355
80 Ga0105239_10027657 3300010375 Bacteria 6239
81 Ga0157370_10090102 3300013104 Bacteria 2880
82 Ga0157369_10003609 3300013105 Bacteria 18390
83 Ga0157369_10185274 3300013105 Bacteria 2189
84 Ga0163162_10356306 3300013306 Bacteria 1596
85 Ga0157372_10410616 3300013307 Bacteria 1578
86 Ga0163163_10030350 3300014325 Bacteria 5208
87 Ga0157380_10182466 3300014326 Bacteria 1845
88 Ga0163161_10600088 3300017792 Bacteria 908
89 Ga0213872_10047793 3300021361 Bacteria 1945
90 Ga0213875_10084633 3300021388 Bacteria 1479
91 Ga0207656_10001070 3300025321 Bacteria 8955
92 Ga0207642_10119974 3300025899 Bacteria 1355
93 Ga0207699_10165613 3300025906 Bacteria 1475
94 Ga0207699_10302965 3300025906 Bacteria 1116
95 Ga0207705_10058486 3300025909 Bacteria 2781
96 Ga0207684_10721400 3300025910 Bacteria 846
97 Ga0207707_10002412 3300025912 Bacteria 16809
98 Ga0207695_10179999 3300025913 Bacteria 2035
99 Ga0207671_10056465 3300025914 Bacteria 2909
100 Ga0207693_10021537 3300025915 Bacteria 5121
101 Ga0207693_10061811 3300025915 Bacteria 2934
102 Ga0207660_10001368 3300025917 Bacteria 16343
103 Ga0207649_10106145 3300025920 Bacteria 1868
104 Ga0207652_10019423 3300025921 Bacteria 5589
105 Ga0207652_10235343 3300025921 Bacteria 1651
106 Ga0207681_10018603 3300025923 Bacteria 4379
107 Ga0207694_10017191 3300025924 Bacteria 5465
108 Ga0207650_10962521 3300025925 Bacteria 726
109 Ga0207700_10004190 3300025928 Bacteria 8464
110 Ga0207706_10011510 3300025933 Bacteria 8058
111 Ga0207709_10043796 3300025935 Bacteria 2700
112 Ga0207689_10000572 3300025942 Bacteria 35176
113 Ga0207661_10000611 3300025944 Bacteria 22884
114 Ga0207661_10017797 3300025944 Bacteria 5266
115 Ga0207667_10044592 3300025949 Bacteria 4698
116 Ga0207667_10714613 3300025949 Bacteria 1004
117 Ga0207712_10011646 3300025961 Bacteria 5606
118 Ga0207668_10001282 3300025972 Bacteria 14975
119 Ga0207677_10085133 3300026023 Bacteria 2281
120 Ga0207703_10331140 3300026035 Bacteria 1397
121 Ga0207639_10003682 3300026041 Bacteria 10302
122 Ga0207708_10156220 3300026075 Bacteria 1799
123 Ga0207674_10018041 3300026116 Bacteria 7686
124 Ga0207675_100008342 3300026118 Bacteria 9760
125 Ga0207698_10057282 3300026142 Bacteria 3014
126 Ga0209588_1099973 3300027671 Bacteria 934
127 Ga0268265_10001129 3300028380 Bacteria 23587
128 Ga0268264_10000020 3300028381 Bacteria 483593
129 Ga0268264_10014546 3300028381 Bacteria 6465
130 Ga0265334_10044862 3300028573 Bacteria 1714
131 Ga0307517_10152224 3300028786 Bacteria 1583
132 Ga0265330_10008602 3300031235 Bacteria 4904
133 Ga0265330_10035500 3300031235 Bacteria 2224
134 Ga0265332_10010183 3300031238 Bacteria 4185
135 Ga0265325_10014082 3300031241 Bacteria 4532
136 Ga0265340_10022224 3300031247 Bacteria 3244
137 Ga0265339_10049920 3300031249 Bacteria 2289
138 Ga0265316_10068584 3300031344 Bacteria 2739
139 Ga0265316_10402158 3300031344 Bacteria 986
140 Ga0307513_10120897 3300031456 Bacteria 2587
141 Ga0307509_10337971 3300031507 Bacteria 1234
142 Ga0265313_10040437 3300031595 Bacteria 2305
143 Ga0265314_10003656 3300031711 Bacteria 14771
144 Ga0265342_10006981 3300031712 Bacteria 8344
145 Ga0316215_1003232 3300033544 Bacteria 1548
146 Ga0373923_0006264 3300035111 Bacteria 4100
147 Ga0373936_0084986 3300035113 Bacteria 1321
148 Ga0373945_0171221 3300035116 Bacteria 890
149 Ga0373953_0002376 3300035117 Bacteria 5682
150 Ga0373954_0000361 3300035118 Bacteria 16793
151 Ga0373956_0000661 3300035119 Bacteria 14184
152 Ga0373957_0002092 3300035120 Bacteria 5601
153 Ga0373955_0000251 3300035172 Bacteria 22333
154 Ga0373927_0090626 3300035695 Bacteria 1986
155 Ga0373927_0143644 3300035695 Bacteria 1562
156 Ga0373927_0265863 3300035695 Bacteria 1128
157 Ga0373933_0000886 3300035724 Bacteria 18310
158 Ga0373947_0692296 3300035725 Bacteria 695
159 Ga0373937_0012818 3300036401 Bacteria 7382
160 Ga0395900_0500920 3300037418 Bacteria 1165
161 Ga0395898_0041422 3300037466 Bacteria 4549
162 Ga0436364_0530630 3300037853 Bacteria 1993
163 Ga0436364_0873230 3300037853 Bacteria 2035
164 Ga0436364_1430648 3300037853 Bacteria 950
165 Ga0395901_1322116 3300038443 Bacteria 682
166 Ga0436365_0547714 3300039437 Unclassified 600
167 Ga0436360_0311118 3300039438 Bacteria 804
168 Ga0436361_0142641 3300039447 Bacteria 2306
169 Ga0451789_0436801 3300041443 Bacteria 815
170 Ga0466969_0053388 3300044656 Bacteria 1983
171 Ga0466966_0001605 3300044684 Bacteria 14549
172 Ga0466966_0326030 3300044684 Bacteria 923
173 Ga0466961_0000016 3300044693 Bacteria 111421
174 Ga0466968_0125185 3300044735 Bacteria 1166
175 Ga0466970_0279335 3300044765 Bacteria 939
176 Ga0466959_0001842 3300045049 Bacteria 13313
177 Ga0466959_0053980 3300045049 Bacteria 2937
178 Ga0495592_0001115 3300046454 Bacteria 18689
179 Ga0495629_0000356 3300046459 Bacteria 38962
180 Ga0495638_0295176 3300046460 Bacteria 875
181 Ga0495651_0013671 3300046462 Bacteria 6272
182 Ga0495653_0001366 3300046463 Bacteria 18943
183 Ga0495584_0039456 3300046491 Bacteria 2385
184 Ga0495583_0242115 3300046506 Bacteria 725
185 Ga0495608_0003215 3300046511 Bacteria 11698
186 Ga0495618_0019725 3300046514 Bacteria 4149
187 Ga0495628_0025587 3300046516 Bacteria 4821
188 Ga0495631_0159053 3300046518 Bacteria 969
189 Ga0495643_0116866 3300046522 Bacteria 1351
190 Ga0495648_0000822 3300046524 Bacteria 32752
191 Ga0495648_0258389 3300046524 Bacteria 837
192 Ga0495663_0129939 3300046525 Bacteria 849
193 Ga0495652_0004066 3300046529 Bacteria 14134
194 Ga0495665_0090490 3300046531 Bacteria 1608
195 Ga0495640_0002055 3300046533 Bacteria 16055
196 Ga0495645_0041247 3300046543 Bacteria 3365
197 Ga0495667_0019143 3300046559 Bacteria 4619
198 Ga0495634_0018693 3300046642 Bacteria 4930
199 Ga0495635_0002282 3300046663 Bacteria 13039
200 Ga0495659_0026560 3300046664 Bacteria 1991
201 Ga0495661_0209803 3300046665 Bacteria 1015
202 Ga0495657_0007275 3300046675 Bacteria 8568
203 Ga0495599_0001267 3300046678 Bacteria 14348
204 Ga0495623_0007281 3300046679 Bacteria 7181
205 Ga0495646_0001051 3300046680 Bacteria 15983
206 Ga0495613_0032586 3300046689 Bacteria 3872
207 Ga0495670_0177358 3300046691 Bacteria 1124
208 Ga0495671_0109167 3300046692 Bacteria 1351
209 Ga0495600_0001804 3300046809 Bacteria 11977
210 Ga0495581_0028630 3300047315 Bacteria 3230
211 Ga0495581_0370911 3300047315 Bacteria 835
212 Ga0495604_0002555 3300047317 Bacteria 14548
213 Ga0495674_0013119 3300047319 Bacteria 7793
214 Ga0495680_0016083 3300047322 Bacteria 6432
215 Ga0495675_0007607 3300047444 Bacteria 6681
216 Ga0495677_0113503 3300047445 Bacteria 1031
217 Ga0495685_025800 3300047447 Bacteria 2023
218 Ga0495681_0156376 3300047470 Bacteria 953
219 Ga0495684_0001827 3300047471 Bacteria 17110
220 Ga0495593_0001339 3300047673 Bacteria 14402
221 Ga0495602_0041771 3300048088 Bacteria 4185
222 Ga0495602_0770594 3300048088 Bacteria 648
223 Ga0495615_0038234 3300048090 Bacteria 1186
224 Ga0496100_0064401 3300048903 Bacteria 2426
225 Ga0496101_0610648 3300048904 Bacteria 862
226 Ga0496102_0140305 3300048905 Bacteria 2266
227 Ga0496102_0392309 3300048905 Bacteria 1306
228 Ga0496104_0014904 3300048907 Bacteria 7028
229 Ga0496105_0023356 3300048908 Bacteria 5013
230 Ga0496106_0770962 3300048909 Bacteria 764
231 Ga0496108_0004452 3300048911 Bacteria 11279
232 Ga0496108_0637737 3300048911 Bacteria 927
233 Ga0496109_0027022 3300048912 Bacteria 5120
234 Ga0496110_0001209 3300048913 Bacteria 18367
235 Ga0496111_0011097 3300048914 Bacteria 6063
236 Ga0496112_0071075 3300048915 Bacteria 3439
237 Ga0496113_0002811 3300048916 Bacteria 10241
238 Ga0496114_0381133 3300048917 Bacteria 1248
239 Ga0496115_0069314 3300048918 Bacteria 2856
240 Ga0496115_0733725 3300048918 Bacteria 774
241 Ga0496118_0366443 3300048921 Bacteria 762
242 Ga0496121_0056481 3300048924 Bacteria 3261
243 Ga0496121_0096407 3300048924 Bacteria 2295
244 Ga0496121_0104404 3300048924 Bacteria 2178
245 Ga0496126_0017849 3300048929 Bacteria 7060
246 Ga0496126_0208937 3300048929 Bacteria 1644
247 Ga0495682_0088539 3300049460 Bacteria 1112
248 Ga0501047_0130511 3300049581 Bacteria 2393
249 nmdc:mga03683_341463_c1 3300050489 Bacteria 707
250 nmdc:mga0k408_53492_c1 3300050493 Bacteria 2340
251 nmdc:mga0a205_666358_c1 3300050515 Bacteria 891
252 Ga0495655_0033406 3300053083 Bacteria 1266
253 Ga0495595_0000753 3300053084 Bacteria 12271
254 Ga0495619_0001813 3300053085 Bacteria 14212
255 Ga0500647_0009609 3300053091 Bacteria 4249
256 Ga0500566_0000077 3300053094 Bacteria 48099
257 Ga0500640_001409 3300053095 Bacteria 7269
258 Ga0500572_000932 3300053111 Bacteria 8962
259 Ga0500614_001050 3300053123 Bacteria 6876
260 Ga0500658_0119671 3300053134 Bacteria 1166
261 Ga0500559_0009135 3300053136 Bacteria 4306
262 Ga0500559_0061012 3300053136 Bacteria 1681
263 Ga0500590_083256 3300053148 Bacteria 1568
264 Ga0500603_001163 3300053150 Bacteria 6130
265 Ga0500630_000158 3300053159 Bacteria 24806
266 Ga0500638_093864 3300053162 Bacteria 1409
267 Ga0500639_000171 3300053163 Bacteria 31550
268 Ga0500639_157457 3300053163 Bacteria 1038
269 Ga0500637_0041461 3300053178 Bacteria 2602
270 Ga0500596_000666 3300053735 Bacteria 6645
271 Ga0500601_005449 3300053737 Bacteria 1393
272 2509152113 2508501128 Bacteria 8613869
273 2513888295 2513237141 Bacteria 8496279
274 2824705610 2824704595 Bacteria 9667483
275 2824756339 2824753945 Bacteria 9787441
276 2824764023 2824763712 Bacteria 9792355
277 2904720393 2904711408 Bacteria 9771557
278 8006993978 8006984368 Bacteria 9651211
279 8056683619 8056681323 Bacteria 8472857
280 Ga0307513_10360298
281 JGI25404J52841_10000396
282 JGI25404J52841_10002951
283 JGI25404J52841_10005232
284 JGI25404J52841_10015718
285 Ga0070658_10134236
286 Ga0070683_100022259
287 Ga0068869_100000485
288 Ga0070680_100002115
289 Ga0068868_100202137
290 Ga0070661_100604711
291 Ga0070668_100075107
292 Ga0070669_100120415
293 Ga0070659_100172584
294 Ga0070667_100014512
295 Ga0070709_10018039
296 Ga0070709_10671707
297 Ga0070714_100383101
298 Ga0070713_100003174
299 Ga0070711_100156197
300 Ga0070694_100175337
301 Ga0070708_100088909
302 Ga0070708_100874644
303 Ga0070662_100007714
304 Ga0070707_101022458
305 Ga0070698_100041564
306 Ga0070698_100242379
307 Ga0070699_100182294
308 Ga0070679_100304033
309 Ga0070684_100002850
310 Ga0070684_100009194
311 Ga0070697_100079382
312 Ga0070697_100514937
313 Ga0070697_100635291
314 Ga0068853_100001194
315 Ga0068853_100085687
316 Ga0070695_100519946
317 Ga0070696_100085736
318 Ga0068855_100055468
319 Ga0068855_100337007
320 Ga0068857_100052556
321 Ga0068852_100088751
322 Ga0068866_10247029
323 Ga0068861_100082894
324 Ga0068851_10000516
325 Ga0068858_100096837
326 Ga0068860_100001705
327 Ga0068860_100069796
328 Ga0068862_100114630
329 Ga0081540_1000976
330 Ga0081540_1001709
331 Ga0081540_1002909
332 Ga0081540_1003388
333 Ga0081540_1019795
334 Ga0070717_10066530
335 Ga0070717_10230357
336 Ga0070712_100027070
337 Ga0075366_10118740
338 Ga0075433_10718306
339 Ga0099794_10076391
340 Ga0099794_10081418
341 Ga0099794_10144604
342 Ga0099795_10025782
343 Ga0099795_10045556
344 Ga0105250_10009427
345 Ga0105250_10189843
346 Ga0105240_10004989
347 Ga0105240_10997177
348 Ga0114129_10885604
349 Ga0105243_10029550
350 Ga0105237_10004248
351 Ga0105237_10874927
352 Ga0105238_10005783
353 Ga0105249_10024773
354 Ga0099796_10031950
355 Ga0099796_10035727
356 Ga0099796_10082954
357 Ga0099796_10271507
358 Ga0105239_10004627
359 Ga0105239_10027657
360 Ga0157370_10090102
361 Ga0157369_10003609
362 Ga0157369_10185274
363 Ga0163162_10356306
364 Ga0157372_10410616
365 Ga0163163_10030350
366 Ga0157380_10182466
367 Ga0163161_10600088
368 Ga0213872_10047793
369 Ga0213875_10084633
370 Ga0207656_10001070
371 Ga0207642_10119974
372 Ga0207699_10165613
373 Ga0207699_10302965
374 Ga0207705_10058486
375 Ga0207684_10721400
376 Ga0207707_10002412
377 Ga0207695_10179999
378 Ga0207671_10056465
379 Ga0207693_10021537
380 Ga0207693_10061811
381 Ga0207660_10001368
382 Ga0207649_10106145
383 Ga0207652_10019423
384 Ga0207652_10235343
385 Ga0207681_10018603
386 Ga0207694_10017191
387 Ga0207650_10962521
388 Ga0207700_10004190
389 Ga0207706_10011510
390 Ga0207709_10043796
391 Ga0207689_10000572
392 Ga0207661_10000611
393 Ga0207661_10017797
394 Ga0207667_10044592
395 Ga0207667_10714613
396 Ga0207712_10011646
397 Ga0207668_10001282
398 Ga0207677_10085133
399 Ga0207703_10331140
400 Ga0207639_10003682
401 Ga0207708_10156220
402 Ga0207674_10018041
403 Ga0207675_100008342
404 Ga0207698_10057282
405 Ga0209588_1099973
406 Ga0268265_10001129
407 Ga0268264_10000020
408 Ga0268264_10014546
409 Ga0265334_10044862
410 Ga0307517_10152224
411 Ga0265330_10008602
412 Ga0265330_10035500
413 Ga0265332_10010183
414 Ga0265325_10014082
415 Ga0265340_10022224
416 Ga0265339_10049920
417 Ga0265316_10068584
418 Ga0265316_10402158
419 Ga0307513_10120897
420 Ga0307509_10337971
421 Ga0265313_10040437
422 Ga0265314_10003656
423 Ga0265342_10006981
424 Ga0316215_1003232
425 Ga0373923_0006264
426 Ga0373936_0084986
427 Ga0373945_0171221
428 Ga0373953_0002376
429 Ga0373954_0000361
430 Ga0373956_0000661
431 Ga0373957_0002092
432 Ga0373955_0000251
433 Ga0373927_0090626
434 Ga0373927_0143644
435 Ga0373927_0265863
436 Ga0373933_0000886
437 Ga0373947_0692296
438 Ga0373937_0012818
439 Ga0395900_0500920
440 Ga0395898_0041422
441 Ga0436364_0530630
442 Ga0436364_0873230
443 Ga0436364_1430648
444 Ga0395901_1322116
445 Ga0436365_0547714
446 Ga0436360_0311118
447 Ga0436361_0142641
448 Ga0451789_0436801
449 Ga0466969_0053388
450 Ga0466966_0001605
451 Ga0466966_0326030
452 Ga0466961_0000016
453 Ga0466968_0125185
454 Ga0466970_0279335
455 Ga0466959_0001842
456 Ga0466959_0053980
457 Ga0495592_0001115
458 Ga0495629_0000356
459 Ga0495638_0295176
460 Ga0495651_0013671
461 Ga0495653_0001366
462 Ga0495584_0039456
463 Ga0495583_0242115
464 Ga0495608_0003215
465 Ga0495618_0019725
466 Ga0495628_0025587
467 Ga0495631_0159053
468 Ga0495643_0116866
469 Ga0495648_0000822
470 Ga0495648_0258389
471 Ga0495663_0129939
472 Ga0495652_0004066
473 Ga0495665_0090490
474 Ga0495640_0002055
475 Ga0495645_0041247
476 Ga0495667_0019143
477 Ga0495634_0018693
478 Ga0495635_0002282
479 Ga0495659_0026560
480 Ga0495661_0209803
481 Ga0495657_0007275
482 Ga0495599_0001267
483 Ga0495623_0007281
484 Ga0495646_0001051
485 Ga0495613_0032586
486 Ga0495670_0177358
487 Ga0495671_0109167
488 Ga0495600_0001804
489 Ga0495581_0028630
490 Ga0495581_0370911
491 Ga0495604_0002555
492 Ga0495674_0013119
493 Ga0495680_0016083
494 Ga0495675_0007607
495 Ga0495677_0113503
496 Ga0495685_025800
497 Ga0495681_0156376
498 Ga0495684_0001827
499 Ga0495593_0001339
500 Ga0495602_0041771
501 Ga0495602_0770594
502 Ga0495615_0038234
503 Ga0496100_0064401
504 Ga0496101_0610648
505 Ga0496102_0140305
506 Ga0496102_0392309
507 Ga0496104_0014904
508 Ga0496105_0023356
509 Ga0496106_0770962
510 Ga0496108_0004452
511 Ga0496108_0637737
512 Ga0496109_0027022
513 Ga0496110_0001209
514 Ga0496111_0011097
515 Ga0496112_0071075
516 Ga0496113_0002811
517 Ga0496114_0381133
518 Ga0496115_0069314
519 Ga0496115_0733725
520 Ga0496118_0366443
521 Ga0496121_0056481
522 Ga0496121_0096407
523 Ga0496121_0104404
524 Ga0496126_0017849
525 Ga0496126_0208937
526 Ga0495682_0088539
527 Ga0501047_0130511
528 nmdc:mga03683_341463_c1
529 nmdc:mga0k408_53492_c1
530 nmdc:mga0a205_666358_c1
531 Ga0495655_0033406
532 Ga0495595_0000753
533 Ga0495619_0001813
534 Ga0500647_0009609
535 Ga0500566_0000077
536 Ga0500640_001409
537 Ga0500572_000932
538 Ga0500614_001050
539 Ga0500658_0119671
540 Ga0500559_0009135
541 Ga0500559_0061012
542 Ga0500590_083256
543 Ga0500603_001163
544 Ga0500630_000158
545 Ga0500638_093864
546 Ga0500639_000171
547 Ga0500639_157457
548 Ga0500637_0041461
549 Ga0500596_000666
550 Ga0500601_005449
551 2509152113
552 2513888295
553 2824705610
554 2824756339
555 2824764023
556 2904720393
557 8006993978
558 8056683619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

60

145

0.88

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

58

141

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.6137 29 187
2c8s-assembly1.cif.gz_A cytochrome cl from methylobacterium extorquens 0.6107 60 144
4wqd-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant 0.599 59 143
4wq7-assembly1.cif.gz_A "thiosulfate dehydrogenase (tsda) from allochromatium vinosum - ""as isolated"" form" 0.5987 59 143
5lo9-assembly1.cif.gz_A "thiosulfate dehydrogenase (tsdba) from marichromatium purpuratum - ""as isolated"" form" 0.5964 59 141
ID Description Score Start End Superfamily
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6992 35 170 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6905 35 170 1.10.760.10
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6321 59 146 1.10.760.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6107 60 144 1.10.760.10
1mg2H00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6094 60 144 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A6N8LVX5-F1-model_v4 C-type cytochrome 0.7162 47 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E8E3H5-F1-model_v4 Cytochrome c domain-containing protein 0.7132 47 175 GO:0009055
GO:0020037
GO:0046872
AF-A0A2D7GEF4-F1-model_v4 Cytochrome C 0.7071 46 174 GO:0009055
GO:0020037
GO:0046872
AF-A0A382K3I9-F1-model_v4 Cytochrome c domain-containing protein 0.7029 53 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E3ZVD0-F1-model_v4 Cytochrome C 0.6996 46 174 GO:0009055
GO:0020037
GO:0046872

Map