F383104

General Info

Members Datasets Scaffolds Average Seq Length
279 173 256 168

Family's Representative Sequence

Representative Sequence 3300025299|Ga0209256_1003983|Ga0209256_10039832
Length 178
Sequence MPKLIKLIDGAAQSAENAFVNVADEDAIPEAGDVILSLTRFQAEGDALLSSNSRRVGVRIEPAEEVEALAYDLPRLSVVALAFPKYRDGRAYTSARLLRERFKYQGEIRAVGDVLQEQAGFMVRVGFDAFEPNDGATPEAWAKAANRFRHVYQRAVDARPIAADERAQAKAQAKEGAL

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2851153111 Caulobacter radicis 736 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
143 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
154 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
155 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
158 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
170 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
171 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.76
Metatranscriptomes 0
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.13
Nodule 0
Rhizoplane 3.23
Rhizosphere 52.33
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10038024 3300003215 Bacteria 1523
2 Ga0055537_1001890 3300003773 Bacteria 7519
3 Ga0055524_1020919 3300003775 Bacteria 2187
4 Ga0055524_1025148 3300003775 Bacteria 1871
5 Ga0055536_1002622 3300003781 Bacteria 10014
6 Ga0055536_1004003 3300003781 Bacteria 7698
7 Ga0055528_1014364 3300003790 Bacteria 2932
8 Ga0055530_10003041 3300003791 Bacteria 10011
9 Ga0055530_10004969 3300003791 Bacteria 6577
10 Ga0055531_10001970 3300003794 Bacteria 14316
11 Ga0055531_10006606 3300003794 Bacteria 6539
12 Ga0055531_10023440 3300003794 Bacteria 2315
13 Ga0065165_1031169 3300005262 Bacteria 1689
14 Ga0065165_1033908 3300005262 Bacteria 1584
15 Ga0065165_1057544 3300005262 Bacteria 1077
16 Ga0070658_10067935 3300005327 Bacteria 2913
17 Ga0070658_10402568 3300005327 Bacteria 1176
18 Ga0068869_100157309 3300005334 Bacteria 1767
19 Ga0070680_100026527 3300005336 Bacteria 4634
20 Ga0070691_10024488 3300005341 Bacteria 2805
21 Ga0070671_101055987 3300005355 Bacteria 713
22 Ga0070662_101037077 3300005457 Bacteria 703
23 Ga0070681_10324253 3300005458 Bacteria 1450
24 Ga0068867_100528225 3300005459 Bacteria 1019
25 Ga0070665_100210589 3300005548 Bacteria 1945
26 Ga0068855_100674987 3300005563 Bacteria 1108
27 Ga0068857_101303713 3300005577 Bacteria 705
28 Ga0068856_100365449 3300005614 Bacteria 1462
29 Ga0068856_100455252 3300005614 Bacteria 1301
30 Ga0068861_100435948 3300005719 Bacteria 1171
31 Ga0068863_100250098 3300005841 Bacteria 1712
32 Ga0075363_100102825 3300006048 Bacteria 1582
33 Ga0075363_100337055 3300006048 Bacteria 879
34 Ga0075362_10207459 3300006177 Bacteria 955
35 Ga0075362_10393137 3300006177 Bacteria 698
36 Ga0075369_10001685 3300006186 Bacteria 7632
37 Ga0075369_10173470 3300006186 Bacteria 991
38 Ga0075366_10051741 3300006195 Bacteria 2440
39 Ga0075366_10172713 3300006195 Bacteria 1312
40 Ga0075366_10185891 3300006195 Bacteria 1263
41 Ga0075366_10219012 3300006195 Bacteria 1160
42 Ga0075370_10086786 3300006353 Bacteria 1802
43 Ga0075370_10248198 3300006353 Bacteria 1055
44 Ga0105240_10024604 3300009093 Bacteria 7931
45 Ga0105240_10077997 3300009093 Bacteria 4080
46 Ga0105240_11061596 3300009093 Bacteria 864
47 Ga0157373_10582678 3300013100 Bacteria 813
48 Ga0157370_10186319 3300013104 Bacteria 1927
49 Ga0157369_10550356 3300013105 Bacteria 1193
50 Ga0182006_1074257 3300015261 Bacteria 1253
51 Ga0209148_1029880 3300025254 Bacteria 820
52 Ga0209565_1000466 3300025263 Bacteria 30502
53 Ga0209455_1026447 3300025272 Bacteria 1040
54 Ga0209673_1000722 3300025273 Bacteria 45860
55 Ga0209676_1000067 3300025292 Bacteria 315576
56 Ga0209676_1000379 3300025292 Bacteria 81751
57 Ga0209564_1033223 3300025295 Bacteria 1538
58 Ga0209758_1003007 3300025297 Bacteria 16137
59 Ga0209758_1005171 3300025297 Bacteria 10264
60 Ga0209050_1000154 3300025298 Bacteria 159160
61 Ga0209050_1000449 3300025298 Bacteria 74643
62 Ga0209050_1015693 3300025298 Bacteria 3159
63 Ga0209256_1001877 3300025299 Bacteria 19375
64 Ga0209256_1003983 3300025299 Bacteria 9695
65 Ga0209256_1010502 3300025299 Bacteria 3863
66 Ga0209257_1000066 3300025304 Bacteria 344166
67 Ga0209257_1000203 3300025304 Bacteria 146148
68 Ga0209257_1000966 3300025304 Bacteria 39401
69 Ga0209257_1010055 3300025304 Bacteria 4895
70 Ga0207705_10111683 3300025909 Bacteria 2020
71 Ga0207695_10783776 3300025913 Bacteria 833
72 Ga0207660_10077458 3300025917 Bacteria 2434
73 Ga0207649_10182304 3300025920 Bacteria 1470
74 Ga0207681_11525542 3300025923 Bacteria 560
75 Ga0207667_10939724 3300025949 Bacteria 855
76 Ga0207678_10335714 3300026067 Bacteria 1302
77 Ga0207702_10178850 3300026078 Bacteria 1952
78 Ga0207702_10816908 3300026078 Bacteria 922
79 Ga0207648_11377676 3300026089 Bacteria 663
80 Ga0207675_100530240 3300026118 Bacteria 1175
81 Ga0268266_10086680 3300028379 Bacteria 2738
82 Ga0307517_10149397 3300028786 Bacteria 1609
83 Ga0307515_10026487 3300028794 Bacteria 9977
84 Ga0307515_10139358 3300028794 Bacteria 2612
85 Ga0307515_10323787 3300028794 Bacteria 1205
86 Ga0265327_10000394 3300031251 Bacteria 81965
87 Ga0307513_10041492 3300031456 Bacteria 5078
88 Ga0307405_10937560 3300031731 Bacteria 735
89 Ga0307413_10371271 3300031824 Bacteria 1111
90 Ga0307412_10854773 3300031911 Bacteria 794
91 Ga0307414_10076931 3300032004 Bacteria 2427
92 Ga0373947_0080052 3300035725 Bacteria 2020
93 Ga0395900_0044298 3300037418 Bacteria 4585
94 Ga0395900_1416037 3300037418 Bacteria 608
95 Ga0395898_0761260 3300037466 Bacteria 909
96 Ga0395905_0075530 3300037471 Bacteria 3159
97 Ga0395905_0459540 3300037471 Bacteria 1171
98 Ga0395905_0577009 3300037471 Bacteria 1026
99 Ga0395901_1349675 3300038443 Bacteria 673
100 Ga0439436_0075287 3300041404 Bacteria 940
101 Ga0451791_1915529 3300041451 Bacteria 586
102 Ga0451853_0416643 3300041512 Bacteria 4269
103 Ga0439445_0029574 3300042004 Bacteria 1417
104 Ga0450891_016542 3300042129 Bacteria 705
105 Ga0439446_0018177 3300042156 Bacteria 1967
106 Ga0439435_0007978 3300042436 Bacteria 2445
107 Ga0439459_0003990 3300042438 Bacteria 2364
108 Ga0466967_1312804 3300045976 Bacteria 721
109 Ga0495627_002025 3300046453 Bacteria 10424
110 Ga0495638_0000109 3300046460 Bacteria 131610
111 Ga0495638_0001122 3300046460 Bacteria 25994
112 Ga0495638_0001193 3300046460 Bacteria 24877
113 Ga0495638_0005052 3300046460 Bacteria 9895
114 Ga0495638_0031759 3300046460 Bacteria 3390
115 Ga0495638_0131225 3300046460 Bacteria 1471
116 Ga0495650_0000020 3300046471 Bacteria 533839
117 Ga0495650_0046848 3300046471 Bacteria 1812
118 Ga0495650_0244916 3300046471 Bacteria 611
119 Ga0495607_0161530 3300046501 Bacteria 1138
120 Ga0495583_0000001 3300046506 Bacteria 811973
121 Ga0495606_0022286 3300046507 Bacteria 4617
122 Ga0495610_0000218 3300046512 Bacteria 61777
123 Ga0495610_0002807 3300046512 Bacteria 14223
124 Ga0495610_0003224 3300046512 Bacteria 12907
125 Ga0495610_0250419 3300046512 Bacteria 702
126 Ga0495616_0001067 3300046513 Bacteria 19477
127 Ga0495616_0105075 3300046513 Bacteria 1319
128 Ga0495620_0125304 3300046515 Bacteria 1010
129 Ga0495631_0011245 3300046518 Bacteria 4406
130 Ga0495632_0002715 3300046519 Bacteria 13155
131 Ga0495637_0013209 3300046520 Bacteria 3926
132 Ga0495637_0045554 3300046520 Bacteria 1860
133 Ga0495637_0083472 3300046520 Bacteria 1270
134 Ga0495643_0031859 3300046522 Bacteria 2931
135 Ga0495648_0000075 3300046524 Bacteria 129579
136 Ga0495648_0263568 3300046524 Bacteria 825
137 Ga0495652_0660525 3300046529 Bacteria 707
138 Ga0495654_0000139 3300046530 Bacteria 75903
139 Ga0495654_0156671 3300046530 Bacteria 1003
140 Ga0495654_0203821 3300046530 Bacteria 845
141 Ga0495609_0050970 3300046538 Bacteria 1844
142 Ga0495597_0101026 3300046542 Bacteria 1216
143 Ga0495633_0198272 3300046558 Bacteria 922
144 Ga0495668_0000042 3300046616 Bacteria 229361
145 Ga0495668_0015614 3300046616 Bacteria 4430
146 Ga0495668_0018659 3300046616 Bacteria 4009
147 Ga0495668_0031580 3300046616 Bacteria 2984
148 Ga0495668_0074411 3300046616 Bacteria 1865
149 Ga0495668_0137866 3300046616 Bacteria 1335
150 Ga0495668_0405090 3300046616 Bacteria 750
151 Ga0495668_0554426 3300046616 Bacteria 634
152 Ga0495625_0000165 3300046660 Bacteria 102988
153 Ga0495625_0002840 3300046660 Bacteria 18199
154 Ga0495625_0020407 3300046660 Bacteria 5116
155 Ga0495625_0020928 3300046660 Bacteria 5042
156 Ga0495625_0026723 3300046660 Bacteria 4354
157 Ga0495625_0088733 3300046660 Bacteria 2141
158 Ga0495625_0279520 3300046660 Bacteria 1074
159 Ga0495670_0172866 3300046691 Bacteria 1138
160 Ga0495671_0116688 3300046692 Bacteria 1303
161 Ga0495671_0206099 3300046692 Bacteria 953
162 Ga0495589_0003796 3300046794 Bacteria 8127
163 Ga0495660_0024954 3300046810 Bacteria 3399
164 Ga0495660_0253562 3300046810 Bacteria 815
165 Ga0495672_0001176 3300047320 Bacteria 26541
166 Ga0495673_0000139 3300047469 Bacteria 130652
167 Ga0495673_0000305 3300047469 Bacteria 65300
168 Ga0495673_0001209 3300047469 Bacteria 21505
169 Ga0495681_0177096 3300047470 Bacteria 878
170 Ga0495686_0000870 3300047472 Bacteria 38471
171 Ga0495686_0004871 3300047472 Bacteria 10826
172 Ga0495686_0006911 3300047472 Bacteria 8585
173 Ga0495686_0016070 3300047472 Bacteria 5087
174 Ga0495686_0032210 3300047472 Bacteria 3394
175 Ga0495686_0033861 3300047472 Bacteria 3294
176 Ga0496101_0366875 3300048904 Bacteria 1132
177 Ga0496106_0069223 3300048909 Bacteria 2693
178 Ga0496107_0000050 3300048910 Bacteria 63795
179 Ga0496114_0446920 3300048917 Bacteria 1145
180 Ga0496115_0018435 3300048918 Bacteria 5359
181 Ga0496115_0133534 3300048918 Bacteria 2046
182 Ga0496115_0143039 3300048918 Bacteria 1973
183 Ga0496115_0253088 3300048918 Bacteria 1450
184 Ga0496121_0019233 3300048924 Bacteria 6840
185 Ga0496121_0110474 3300048924 Bacteria 2098
186 Ga0496121_0582942 3300048924 Bacteria 693
187 Ga0496124_0015996 3300048927 Bacteria 7160
188 Ga0496125_0012540 3300048928 Bacteria 8407
189 Ga0496126_0009455 3300048929 Bacteria 10345
190 Ga0496126_0107843 3300048929 Bacteria 2429
191 Ga0495678_001134 3300049459 Bacteria 22127
192 Ga0501034_0118066 3300049571 Bacteria 2640
193 Ga0501034_0712178 3300049571 Bacteria 902
194 Ga0501043_0440831 3300049579 Bacteria 980
195 Ga0501047_0029700 3300049581 Bacteria 5270
196 Ga0501047_0101781 3300049581 Bacteria 2752
197 Ga0501047_0493105 3300049581 Bacteria 1052
198 Ga0501047_0809005 3300049581 Bacteria 752
199 Ga0501048_0033502 3300049582 Bacteria 3711
200 Ga0501048_0757854 3300049582 Bacteria 697
201 Ga0501238_006083 3300049671 Bacteria 1547
202 Ga0501248_012254 3300049678 Bacteria 786
203 Ga0501044_0221897 3300049823 Bacteria 1841
204 Ga0501044_0409038 3300049823 Bacteria 1268
205 nmdc:mga03683_152075_c1 3300050489 Bacteria 1045
206 nmdc:mga03n38_567457_c1 3300050490 Bacteria 643
207 nmdc:mga0k408_68244_c1 3300050493 Bacteria 2074
208 nmdc:mga0k408_95086_c1 3300050493 Bacteria 1753
209 nmdc:mga0k408_95448_c1 3300050493 Bacteria 1750
210 nmdc:mga07m45_237388_c1 3300050496 Bacteria 1061
211 nmdc:mga07m45_64379_c2 3300050496 Bacteria 1516
212 nmdc:mga07m45_76366_c1 3300050496 Bacteria 1910
213 nmdc:mga0sz30_3042_c1 3300050516 Bacteria 6003
214 Ga0500578_0000023 3300053086 Bacteria 153470
215 Ga0500643_000423 3300053087 Bacteria 32227
216 Ga0500643_028141 3300053087 Bacteria 1740
217 Ga0500643_041618 3300053087 Bacteria 1348
218 Ga0500643_057503 3300053087 Bacteria 1097
219 Ga0500644_0000005 3300053088 Bacteria 164966
220 Ga0500646_0112148 3300053090 Bacteria 868
221 Ga0500641_0000558 3300053096 Bacteria 13473
222 Ga0500555_032260 3300053103 Bacteria 1481
223 Ga0500556_0001541 3300053104 Bacteria 9422
224 Ga0500556_0015121 3300053104 Bacteria 2373
225 Ga0500556_0019048 3300053104 Bacteria 2176
226 Ga0500556_0076290 3300053104 Bacteria 1260
227 Ga0500562_000242 3300053108 Bacteria 14220
228 Ga0500562_010071 3300053108 Bacteria 2392
229 Ga0500562_011937 3300053108 Bacteria 2205
230 Ga0500594_0000078 3300053118 Bacteria 30653
231 Ga0500595_003780 3300053119 Bacteria 6967
232 Ga0500608_000013 3300053122 Bacteria 86291
233 Ga0500608_032928 3300053122 Bacteria 2465
234 Ga0500618_000195 3300053125 Bacteria 49434
235 Ga0500658_0002785 3300053134 Bacteria 6708
236 Ga0500559_0000024 3300053136 Bacteria 126300
237 Ga0500559_0010593 3300053136 Bacteria 3953
238 Ga0500564_000100 3300053138 Bacteria 22073
239 Ga0500577_0001328 3300053142 Bacteria 6333
240 Ga0500588_0054851 3300053146 Bacteria 1257
241 Ga0500616_0029837 3300053153 Bacteria 2998
242 Ga0500616_0071650 3300053153 Bacteria 1764
243 Ga0500622_0002724 3300053156 Bacteria 12478
244 Ga0500622_0003809 3300053156 Bacteria 9825
245 Ga0500622_0007061 3300053156 Bacteria 6421
246 Ga0500622_0007316 3300053156 Bacteria 6286
247 Ga0500622_0007734 3300053156 Bacteria 6067
248 Ga0500627_0005963 3300053158 Bacteria 4097
249 Ga0500633_0053480 3300053160 Bacteria 1401
250 Ga0500633_0200053 3300053160 Bacteria 748
251 Ga0500611_017912 3300053727 Bacteria 1298
252 Ga0500645_000594 3300053730 Bacteria 23306
253 Ga0500645_000819 3300053730 Bacteria 18532
254 Ga0500645_002964 3300053730 Bacteria 7200
255 Ga0500645_009486 3300053730 Bacteria 3267
256 Ga0500609_000114 3300053731 Bacteria 10626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0405090 Ga0495668_0405090_293_730 145
2 3300009093 Ga0105240_10024604 Ga0105240_100246048 155
3 3300013100 Ga0157373_10582678 Ga0157373_105826782 155
4 3300013104 Ga0157370_10186319 Ga0157370_101863192 155
5 3300037466 Ga0395898_0761260 Ga0395898_0761260_16_483 155
6 3300049582 Ga0501048_0757854 Ga0501048_0757854_103_570 155
7 3300047472 Ga0495686_0033861 Ga0495686_0033861_2747_3265 161
8 iso_pu_bacteria 2510917020 2511123106 162
9 iso_pu_bacteria 2582581279 2585146073 162
10 iso_pu_bacteria 2582581280 2585150581 162
11 iso_pu_bacteria 2582581293 2585198099 162
12 iso_pu_bacteria 2585428106 2587916051 162
13 iso_pu_bacteria 2643221545 2643751008 162
14 iso_pu_bacteria 2643221552 2643782734 162
15 iso_pu_bacteria 2643221584 2643928043 162
16 iso_pu_bacteria 2643221640 2644224424 162
17 iso_pu_bacteria 2643221642 2644234639 162
18 iso_pu_bacteria 2643221691 2644510976 162
19 iso_pu_bacteria 2818991435 2819539791 162
20 iso_pu_bacteria 2818991454 2819648930 162
21 iso_pu_bacteria 2849573788 2849576980 162
22 iso_pu_bacteria 2857504554 2857507382 162
23 iso_pu_bacteria 2884960567 2884962803 162
24 iso_pu_bacteria 2898329390 2898329712 162
25 iso_pu_bacteria 2928531327 2928532685 162
26 3300041404 Ga0439436_0075287 Ga0439436_0075287_103_609 165
27 3300049571 Ga0501034_0118066 Ga0501034_0118066_921_1421 165
28 3300049571 Ga0501034_0712178 Ga0501034_0712178_300_797 165
29 3300049678 Ga0501248_012254 Ga0501248_012254_132_629 165
30 3300003775 Ga0055524_1025148 Ga0055524_10251482 166
31 3300003781 Ga0055536_1002622 Ga0055536_10026224 166
32 3300003791 Ga0055530_10003041 Ga0055530_100030414 166
33 3300003794 Ga0055531_10001970 Ga0055531_1000197015 166
34 3300003794 Ga0055531_10023440 Ga0055531_100234402 166
35 3300005262 Ga0065165_1031169 Ga0065165_10311692 166
36 3300005262 Ga0065165_1033908 Ga0065165_10339082 166
37 3300005262 Ga0065165_1057544 Ga0065165_10575441 166
38 3300005327 Ga0070658_10067935 Ga0070658_100679352 166
39 3300005327 Ga0070658_10402568 Ga0070658_104025682 166
40 3300005334 Ga0068869_100157309 Ga0068869_1001573092 166
41 3300005336 Ga0070680_100026527 Ga0070680_1000265272 166
42 3300005355 Ga0070671_101055987 Ga0070671_1010559871 166
43 3300005457 Ga0070662_101037077 Ga0070662_1010370772 166
44 3300005458 Ga0070681_10324253 Ga0070681_103242532 166
45 3300005459 Ga0068867_100528225 Ga0068867_1005282252 166
46 3300005548 Ga0070665_100210589 Ga0070665_1002105892 166
47 3300005563 Ga0068855_100674987 Ga0068855_1006749872 166
48 3300005577 Ga0068857_101303713 Ga0068857_1013037131 166
49 3300005614 Ga0068856_100365449 Ga0068856_1003654493 166
50 3300005614 Ga0068856_100455252 Ga0068856_1004552522 166
51 3300005719 Ga0068861_100435948 Ga0068861_1004359482 166
52 3300005841 Ga0068863_100250098 Ga0068863_1002500982 166
53 3300006048 Ga0075363_100102825 Ga0075363_1001028253 166
54 3300006048 Ga0075363_100337055 Ga0075363_1003370552 166
55 3300006177 Ga0075362_10207459 Ga0075362_102074592 166
56 3300006177 Ga0075362_10393137 Ga0075362_103931371 166
57 3300006186 Ga0075369_10001685 Ga0075369_100016857 166
58 3300006186 Ga0075369_10173470 Ga0075369_101734702 166
59 3300006195 Ga0075366_10051741 Ga0075366_100517412 166
60 3300006195 Ga0075366_10172713 Ga0075366_101727132 166
61 3300006195 Ga0075366_10185891 Ga0075366_101858912 166
62 3300006195 Ga0075366_10219012 Ga0075366_102190122 166
63 3300006353 Ga0075370_10086786 Ga0075370_100867862 166
64 3300006353 Ga0075370_10248198 Ga0075370_102481982 166
65 3300009093 Ga0105240_10077997 Ga0105240_100779972 166
66 3300009093 Ga0105240_11061596 Ga0105240_110615962 166
67 3300013105 Ga0157369_10550356 Ga0157369_105503562 166
68 3300015261 Ga0182006_1074257 Ga0182006_10742572 166
69 3300025254 Ga0209148_1029880 Ga0209148_10298802 166
70 3300025272 Ga0209455_1026447 Ga0209455_10264471 166
71 3300025292 Ga0209676_1000379 Ga0209676_100037940 166
72 3300025295 Ga0209564_1033223 Ga0209564_10332232 166
73 3300025297 Ga0209758_1005171 Ga0209758_100517114 166
74 3300025298 Ga0209050_1000154 Ga0209050_100015440 166
75 3300025298 Ga0209050_1015693 Ga0209050_10156932 166
76 3300025299 Ga0209256_1001877 Ga0209256_10018772 166
77 3300025299 Ga0209256_1003983 Ga0209256_10039832 166
78 3300025304 Ga0209257_1000066 Ga0209257_1000066243 166
79 3300025304 Ga0209257_1000966 Ga0209257_100096625 166
80 3300025304 Ga0209257_1010055 Ga0209257_10100553 166
81 3300025909 Ga0207705_10111683 Ga0207705_101116832 166
82 3300025913 Ga0207695_10783776 Ga0207695_107837762 166
83 3300025917 Ga0207660_10077458 Ga0207660_100774581 166
84 3300025923 Ga0207681_11525542 Ga0207681_115255421 166
85 3300025949 Ga0207667_10939724 Ga0207667_109397242 166
86 3300026067 Ga0207678_10335714 Ga0207678_103357142 166
87 3300026078 Ga0207702_10178850 Ga0207702_101788502 166
88 3300026078 Ga0207702_10816908 Ga0207702_108169082 166
89 3300026089 Ga0207648_11377676 Ga0207648_113776761 166
90 3300026118 Ga0207675_100530240 Ga0207675_1005302402 166
91 3300028379 Ga0268266_10086680 Ga0268266_100866802 166
92 3300028786 Ga0307517_10149397 Ga0307517_101493972 166
93 3300028794 Ga0307515_10026487 Ga0307515_100264875 166
94 3300028794 Ga0307515_10323787 Ga0307515_103237872 166
95 3300031251 Ga0265327_10000394 Ga0265327_1000039450 166
96 3300031456 Ga0307513_10041492 Ga0307513_100414924 166
97 3300031731 Ga0307405_10937560 Ga0307405_109375602 166
98 3300031824 Ga0307413_10371271 Ga0307413_103712712 166
99 3300031911 Ga0307412_10854773 Ga0307412_108547732 166
100 3300032004 Ga0307414_10076931 Ga0307414_100769313 166
101 3300035725 Ga0373947_0080052 Ga0373947_0080052_721_1221 166
102 3300037418 Ga0395900_0044298 Ga0395900_0044298_2367_2867 166
103 3300037418 Ga0395900_1416037 Ga0395900_1416037_17_517 166
104 3300037471 Ga0395905_0075530 Ga0395905_0075530_1462_1962 166
105 3300037471 Ga0395905_0459540 Ga0395905_0459540_115_615 166
106 3300037471 Ga0395905_0577009 Ga0395905_0577009_272_772 166
107 3300038443 Ga0395901_1349675 Ga0395901_1349675_144_644 166
108 3300041451 Ga0451791_1915529 Ga0451791_1915529_71_571 166
109 3300041512 Ga0451853_0416643 Ga0451853_0416643_615_1115 166
110 3300042129 Ga0450891_016542 Ga0450891_016542_67_597 166
111 3300042436 Ga0439435_0007978 Ga0439435_0007978_1094_1594 166
112 3300042438 Ga0439459_0003990 Ga0439459_0003990_1521_2021 166
113 3300045976 Ga0466967_1312804 Ga0466967_1312804_117_617 166
114 3300046460 Ga0495638_0000109 Ga0495638_0000109_91672_92178 166
115 3300046460 Ga0495638_0005052 Ga0495638_0005052_170_670 166
116 3300046460 Ga0495638_0131225 Ga0495638_0131225_160_666 166
117 3300046471 Ga0495650_0244916 Ga0495650_0244916_54_563 166
118 3300046501 Ga0495607_0161530 Ga0495607_0161530_78_596 166
119 3300046512 Ga0495610_0002807 Ga0495610_0002807_9500_10006 166
120 3300046512 Ga0495610_0250419 Ga0495610_0250419_78_578 166
121 3300046513 Ga0495616_0001067 Ga0495616_0001067_9251_9751 166
122 3300046513 Ga0495616_0105075 Ga0495616_0105075_132_638 166
123 3300046518 Ga0495631_0011245 Ga0495631_0011245_2560_3066 166
124 3300046519 Ga0495632_0002715 Ga0495632_0002715_3494_4012 166
125 3300046520 Ga0495637_0045554 Ga0495637_0045554_540_1046 166
126 3300046522 Ga0495643_0031859 Ga0495643_0031859_2297_2821 166
127 3300046524 Ga0495648_0000075 Ga0495648_0000075_101868_102374 166
128 3300046524 Ga0495648_0263568 Ga0495648_0263568_131_649 166
129 3300046529 Ga0495652_0660525 Ga0495652_0660525_58_558 166
130 3300046530 Ga0495654_0156671 Ga0495654_0156671_123_641 166
131 3300046530 Ga0495654_0203821 Ga0495654_0203821_271_777 166
132 3300046538 Ga0495609_0050970 Ga0495609_0050970_847_1347 166
133 3300046542 Ga0495597_0101026 Ga0495597_0101026_460_966 166
134 3300046616 Ga0495668_0000042 Ga0495668_0000042_94991_95497 166
135 3300046616 Ga0495668_0015614 Ga0495668_0015614_2834_3340 166
136 3300046616 Ga0495668_0018659 Ga0495668_0018659_3241_3747 166
137 3300046616 Ga0495668_0031580 Ga0495668_0031580_398_916 166
138 3300046616 Ga0495668_0074411 Ga0495668_0074411_764_1264 166
139 3300046616 Ga0495668_0137866 Ga0495668_0137866_498_1016 166
140 3300046616 Ga0495668_0554426 Ga0495668_0554426_82_591 166
141 3300046660 Ga0495625_0020928 Ga0495625_0020928_4492_4998 166
142 3300046660 Ga0495625_0279520 Ga0495625_0279520_100_606 166
143 3300046794 Ga0495589_0003796 Ga0495589_0003796_7579_8097 166
144 3300046810 Ga0495660_0024954 Ga0495660_0024954_96_596 166
145 3300046810 Ga0495660_0253562 Ga0495660_0253562_16_516 166
146 3300047469 Ga0495673_0000139 Ga0495673_0000139_867_1373 166
147 3300047472 Ga0495686_0000870 Ga0495686_0000870_21242_21748 166
148 3300047472 Ga0495686_0006911 Ga0495686_0006911_4961_5470 166
149 3300047472 Ga0495686_0016070 Ga0495686_0016070_949_1455 166
150 3300048917 Ga0496114_0446920 Ga0496114_0446920_310_816 166
151 3300048918 Ga0496115_0133534 Ga0496115_0133534_1197_1703 166
152 3300048918 Ga0496115_0143039 Ga0496115_0143039_959_1459 166
153 3300048918 Ga0496115_0253088 Ga0496115_0253088_324_842 166
154 3300048924 Ga0496121_0582942 Ga0496121_0582942_103_609 166
155 3300048927 Ga0496124_0015996 Ga0496124_0015996_6379_6885 166
156 3300048928 Ga0496125_0012540 Ga0496125_0012540_884_1390 166
157 3300048929 Ga0496126_0009455 Ga0496126_0009455_3724_4230 166
158 3300048929 Ga0496126_0107843 Ga0496126_0107843_180_680 166
159 3300049459 Ga0495678_001134 Ga0495678_001134_4382_4888 166
160 3300049579 Ga0501043_0440831 Ga0501043_0440831_389_889 166
161 3300049581 Ga0501047_0029700 Ga0501047_0029700_693_1193 166
162 3300049581 Ga0501047_0101781 Ga0501047_0101781_113_613 166
163 3300049581 Ga0501047_0493105 Ga0501047_0493105_391_891 166
164 3300049581 Ga0501047_0809005 Ga0501047_0809005_140_649 166
165 3300049582 Ga0501048_0033502 Ga0501048_0033502_433_933 166
166 3300049823 Ga0501044_0221897 Ga0501044_0221897_503_1003 166
167 3300049823 Ga0501044_0409038 Ga0501044_0409038_130_648 166
168 3300050489 nmdc:mga03683_152075_c1 nmdc:mga03683_152075_c1_220_729 166
169 3300050490 nmdc:mga03n38_567457_c1 nmdc:mga03n38_567457_c1_97_603 166
170 3300050493 nmdc:mga0k408_68244_c1 nmdc:mga0k408_68244_c1_583_1089 166
171 3300050493 nmdc:mga0k408_95086_c1 nmdc:mga0k408_95086_c1_684_1184 166
172 3300050493 nmdc:mga0k408_95448_c1 nmdc:mga0k408_95448_c1_544_1062 166
173 3300050496 nmdc:mga07m45_237388_c1 nmdc:mga07m45_237388_c1_424_930 166
174 3300050496 nmdc:mga07m45_64379_c2 nmdc:mga07m45_64379_c2_626_1135 166
175 3300050496 nmdc:mga07m45_76366_c1 nmdc:mga07m45_76366_c1_395_901 166
176 3300050516 nmdc:mga0sz30_3042_c1 nmdc:mga0sz30_3042_c1_924_1430 166
177 3300053086 Ga0500578_0000023 Ga0500578_0000023_68158_68664 166
178 3300053087 Ga0500643_000423 Ga0500643_000423_24860_25363 166
179 3300053087 Ga0500643_028141 Ga0500643_028141_825_1331 166
180 3300053087 Ga0500643_041618 Ga0500643_041618_100_621 166
181 3300053087 Ga0500643_057503 Ga0500643_057503_462_965 166
182 3300053088 Ga0500644_0000005 Ga0500644_0000005_98469_98975 166
183 3300053090 Ga0500646_0112148 Ga0500646_0112148_28_534 166
184 3300053096 Ga0500641_0000558 Ga0500641_0000558_10569_11072 166
185 3300053104 Ga0500556_0015121 Ga0500556_0015121_44_547 166
186 3300053104 Ga0500556_0019048 Ga0500556_0019048_276_782 166
187 3300053104 Ga0500556_0076290 Ga0500556_0076290_624_1127 166
188 3300053108 Ga0500562_000242 Ga0500562_000242_2496_2999 166
189 3300053108 Ga0500562_010071 Ga0500562_010071_446_952 166
190 3300053108 Ga0500562_011937 Ga0500562_011937_929_1432 166
191 3300053118 Ga0500594_0000078 Ga0500594_0000078_25783_26289 166
192 3300053119 Ga0500595_003780 Ga0500595_003780_4917_5417 166
193 3300053122 Ga0500608_000013 Ga0500608_000013_47481_47987 166
194 3300053138 Ga0500564_000100 Ga0500564_000100_20735_21241 166
195 3300053142 Ga0500577_0001328 Ga0500577_0001328_2900_3418 166
196 3300053146 Ga0500588_0054851 Ga0500588_0054851_87_593 166
197 3300053153 Ga0500616_0029837 Ga0500616_0029837_1492_1995 166
198 3300053156 Ga0500622_0002724 Ga0500622_0002724_794_1300 166
199 3300053156 Ga0500622_0003809 Ga0500622_0003809_1539_2045 166
200 3300053156 Ga0500622_0007061 Ga0500622_0007061_4406_4909 166
201 3300053156 Ga0500622_0007316 Ga0500622_0007316_1120_1623 166
202 3300053160 Ga0500633_0200053 Ga0500633_0200053_156_659 166
203 3300053730 Ga0500645_000594 Ga0500645_000594_12426_12929 166
204 3300053730 Ga0500645_000819 Ga0500645_000819_4517_5020 166
205 3300053730 Ga0500645_009486 Ga0500645_009486_2164_2664 166
206 3300053731 Ga0500609_000114 Ga0500609_000114_8500_9000 166
207 iso_pu_bacteria 2791355048 2792463534 166
208 iso_pu_bacteria 2843744320 2843748326 166
209 iso_pu_bacteria 2849560528 2849564775 166
210 iso_pu_bacteria 2851153111 2851155164 166
211 3300005341 Ga0070691_10024488 Ga0070691_100244882 167
212 3300025920 Ga0207649_10182304 Ga0207649_101823042 167
213 3300046512 Ga0495610_0003224 Ga0495610_0003224_2378_2914 167
214 iso_pu_bacteria 2643221583 2643926446 168
215 3300003781 Ga0055536_1004003 Ga0055536_10040034 170
216 3300003791 Ga0055530_10004969 Ga0055530_100049696 170
217 3300003794 Ga0055531_10006606 Ga0055531_100066063 170
218 3300025292 Ga0209676_1000067 Ga0209676_1000067221 170
219 3300025298 Ga0209050_1000449 Ga0209050_100044936 170
220 3300025304 Ga0209257_1000203 Ga0209257_100020399 170
221 3300003215 JGI25153J46596_10038024 JGI25153J46596_100380242 172
222 3300003773 Ga0055537_1001890 Ga0055537_10018902 172
223 3300003775 Ga0055524_1020919 Ga0055524_10209192 172
224 3300003790 Ga0055528_1014364 Ga0055528_10143643 172
225 3300025263 Ga0209565_1000466 Ga0209565_100046621 172
226 3300025273 Ga0209673_1000722 Ga0209673_100072234 172
227 3300025297 Ga0209758_1003007 Ga0209758_10030075 172
228 3300025299 Ga0209256_1010502 Ga0209256_10105023 172
229 3300028794 Ga0307515_10139358 Ga0307515_101393582 172
230 3300042004 Ga0439445_0029574 Ga0439445_0029574_149_667 172
231 3300042156 Ga0439446_0018177 Ga0439446_0018177_843_1361 172
232 3300046453 Ga0495627_002025 Ga0495627_002025_779_1297 172
233 3300046460 Ga0495638_0001122 Ga0495638_0001122_12140_12658 172
234 3300046460 Ga0495638_0001193 Ga0495638_0001193_3046_3564 172
235 3300046460 Ga0495638_0031759 Ga0495638_0031759_905_1423 172
236 3300046471 Ga0495650_0000020 Ga0495650_0000020_387808_388326 172
237 3300046471 Ga0495650_0046848 Ga0495650_0046848_627_1145 172
238 3300046506 Ga0495583_0000001 Ga0495583_0000001_142667_143185 172
239 3300046507 Ga0495606_0022286 Ga0495606_0022286_636_1154 172
240 3300046512 Ga0495610_0000218 Ga0495610_0000218_23682_24200 172
241 3300046515 Ga0495620_0125304 Ga0495620_0125304_191_709 172
242 3300046520 Ga0495637_0013209 Ga0495637_0013209_244_762 172
243 3300046520 Ga0495637_0083472 Ga0495637_0083472_436_972 172
244 3300046530 Ga0495654_0000139 Ga0495654_0000139_36639_37157 172
245 3300046558 Ga0495633_0198272 Ga0495633_0198272_13_531 172
246 3300046660 Ga0495625_0000165 Ga0495625_0000165_3322_3840 172
247 3300046660 Ga0495625_0002840 Ga0495625_0002840_3188_3706 172
248 3300046660 Ga0495625_0020407 Ga0495625_0020407_4295_4813 172
249 3300046660 Ga0495625_0026723 Ga0495625_0026723_440_958 172
250 3300046660 Ga0495625_0088733 Ga0495625_0088733_74_592 172
251 3300046691 Ga0495670_0172866 Ga0495670_0172866_498_1016 172
252 3300046692 Ga0495671_0116688 Ga0495671_0116688_503_1021 172
253 3300046692 Ga0495671_0206099 Ga0495671_0206099_187_705 172
254 3300047320 Ga0495672_0001176 Ga0495672_0001176_4392_4910 172
255 3300047469 Ga0495673_0000305 Ga0495673_0000305_51096_51614 172
256 3300047469 Ga0495673_0001209 Ga0495673_0001209_3037_3555 172
257 3300047470 Ga0495681_0177096 Ga0495681_0177096_152_688 172
258 3300047472 Ga0495686_0004871 Ga0495686_0004871_4787_5305 172
259 3300047472 Ga0495686_0032210 Ga0495686_0032210_2637_3173 172
260 3300048904 Ga0496101_0366875 Ga0496101_0366875_467_985 172
261 3300048909 Ga0496106_0069223 Ga0496106_0069223_1427_1945 172
262 3300048910 Ga0496107_0000050 Ga0496107_0000050_58171_58689 172
263 3300048918 Ga0496115_0018435 Ga0496115_0018435_2689_3207 172
264 3300048924 Ga0496121_0019233 Ga0496121_0019233_1258_1776 172
265 3300048924 Ga0496121_0110474 Ga0496121_0110474_1258_1776 172
266 3300049671 Ga0501238_006083 Ga0501238_006083_915_1433 172
267 3300053103 Ga0500555_032260 Ga0500555_032260_180_698 172
268 3300053104 Ga0500556_0001541 Ga0500556_0001541_4357_4875 172
269 3300053122 Ga0500608_032928 Ga0500608_032928_1727_2245 172
270 3300053125 Ga0500618_000195 Ga0500618_000195_16025_16543 172
271 3300053134 Ga0500658_0002785 Ga0500658_0002785_915_1433 172
272 3300053136 Ga0500559_0000024 Ga0500559_0000024_66953_67489 172
273 3300053136 Ga0500559_0010593 Ga0500559_0010593_2042_2560 172
274 3300053153 Ga0500616_0071650 Ga0500616_0071650_578_1096 172
275 3300053156 Ga0500622_0007734 Ga0500622_0007734_1011_1529 172
276 3300053158 Ga0500627_0005963 Ga0500627_0005963_465_983 172
277 3300053160 Ga0500633_0053480 Ga0500633_0053480_395_913 172
278 3300053727 Ga0500611_017912 Ga0500611_017912_386_904 172
279 3300053730 Ga0500645_002964 Ga0500645_002964_503_1021 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06073

DUF934

Bacterial protein of unknown function (DUF934)

57

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uqh-assembly1.cif.gz_A crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.7821 58 134
6mgr-assembly1.cif.gz_C crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor oxanosine monophosphate 0.7812 58 134
5uqg-assembly2.cif.gz_G crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p200 0.7799 58 134
5uqh-assembly2.cif.gz_E crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.7795 58 134
5uqh-assembly2.cif.gz_G crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.7792 58 134
ID Description Score Start End Superfamily
af_A0A0G2JW38_1_228_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8001 37 132 3.20.20.70
6mgrC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7812 58 134 3.20.20.70
af_Q4DFH5_1_145_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7584 37 150 3.20.20.70
af_A4IBQ7_24_252_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7482 37 149 3.20.20.70
3ct7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7372 38 148 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0Q8MKC2-F1-model_v4 Oxidoreductase 0.9707 1 170
AF-A0A382FJS1-F1-model_v4 DUF934 domain-containing protein 0.9666 40 118
AF-A0A521PKF5-F1-model_v4 DUF934 domain-containing protein 0.9619 1 172
AF-A0A0Q8MKC2-F1-model_v4 Oxidoreductase 0.9592 1 170
AF-A0A526TBK2-F1-model_v4 DUF934 domain-containing protein 0.9584 65 139

Feature Viewer

pLDDT pTM Quality
91.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map