F383052

General Info

Members Datasets Scaffolds Average Seq Length
279 176 279 126

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10079563|Ga0157371_100795633
Length 137
Sequence MPAAGPPDQAETADQQGRRLAPMTPDDLRYTDDHEWARETADGVVRVGITDHAQRQLGDVVLVELPTVGETVAVGDACGTVESTKSVSEIYPLADEPELVNQEPYGGGWMFELRPADHKQLDGLLDAAAYDRLTDDD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
99 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 2.15
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10487030 3300005327 Bacteria 1064
2 Ga0070690_100078188 3300005330 Bacteria 2161
3 Ga0070670_101143061 3300005331 Unclassified 711
4 Ga0070680_100605794 3300005336 Bacteria 940
5 Ga0068868_100181055 3300005338 Bacteria 1748
6 Ga0070660_100848935 3300005339 Bacteria 769
7 Ga0070660_101281924 3300005339 Bacteria 622
8 Ga0070687_100305020 3300005343 Bacteria 1011
9 Ga0070692_10541504 3300005345 Bacteria 761
10 Ga0070668_100501610 3300005347 Bacteria 1051
11 Ga0070669_101172269 3300005353 Bacteria 663
12 Ga0070675_100168882 3300005354 Bacteria 1885
13 Ga0070675_100458578 3300005354 Bacteria 1144
14 Ga0070659_100335225 3300005366 Bacteria 1266
15 Ga0070659_100385992 3300005366 Bacteria 1180
16 Ga0070667_101683063 3300005367 Bacteria 597
17 Ga0070714_100059594 3300005435 Bacteria 3273
18 Ga0070714_100595895 3300005435 Bacteria 1061
19 Ga0070663_100133043 3300005455 Bacteria 1891
20 Ga0070681_10050272 3300005458 Bacteria 4160
21 Ga0070681_10299304 3300005458 Bacteria 1519
22 Ga0068867_101281559 3300005459 Bacteria 676
23 Ga0070685_10150437 3300005466 Bacteria 1475
24 Ga0070679_100898970 3300005530 Bacteria 829
25 Ga0070679_101197787 3300005530 Bacteria 705
26 Ga0070684_101965279 3300005535 Bacteria 552
27 Ga0068853_100748716 3300005539 Bacteria 934
28 Ga0070693_100487757 3300005547 Bacteria 872
29 Ga0070665_100293624 3300005548 Bacteria 1628
30 Ga0068857_100283184 3300005577 Bacteria 1525
31 Ga0068857_100304151 3300005577 Bacteria 1470
32 Ga0068854_100304359 3300005578 Bacteria 1291
33 Ga0068856_100112526 3300005614 Bacteria 2720
34 Ga0070702_100292211 3300005615 Bacteria 1124
35 Ga0068852_100135336 3300005616 Bacteria 2274
36 Ga0068859_101763975 3300005617 Bacteria 684
37 Ga0068859_101882347 3300005617 Unclassified 661
38 Ga0068851_10125018 3300005834 Bacteria 1386
39 Ga0068870_10109682 3300005840 Bacteria 1573
40 Ga0070717_11326051 3300006028 Bacteria 654
41 Ga0075365_10673639 3300006038 Bacteria 731
42 Ga0075363_100383676 3300006048 Bacteria 824
43 Ga0075363_100471851 3300006048 Bacteria 743
44 Ga0075364_10011922 3300006051 Bacteria 5297
45 Ga0070716_101396287 3300006173 Bacteria 569
46 Ga0070712_100725805 3300006175 Bacteria 849
47 Ga0075367_10140322 3300006178 Bacteria 1497
48 Ga0075367_10249158 3300006178 Bacteria 1114
49 Ga0075366_10684601 3300006195 Bacteria 637
50 Ga0075428_100374257 3300006844 Bacteria 1527
51 Ga0068865_100818362 3300006881 Bacteria 805
52 Ga0068865_101207172 3300006881 Bacteria 670
53 Ga0097620_101763917 3300006931 Bacteria 684
54 Ga0097620_101882082 3300006931 Unclassified 661
55 Ga0075435_100756843 3300007076 Bacteria 845
56 Ga0111539_10786811 3300009094 Bacteria 1107
57 Ga0105245_10063697 3300009098 Bacteria 3330
58 Ga0105245_10205861 3300009098 Bacteria 1891
59 Ga0105245_10690483 3300009098 Bacteria 1053
60 Ga0114129_10378087 3300009147 Bacteria 1871
61 Ga0105242_12275583 3300009176 Bacteria 588
62 Ga0105028_109282 3300009993 Bacteria 1030
63 Ga0105239_11660632 3300010375 Bacteria 739
64 Ga0157327_1044142 3300012512 Bacteria 611
65 Ga0157371_10079563 3300013102 Bacteria 2322
66 Ga0157370_11087406 3300013104 Bacteria 723
67 Ga0157369_10149883 3300013105 Bacteria 2465
68 Ga0157377_10268384 3300014745 Bacteria 1113
69 Ga0157377_11126326 3300014745 Bacteria 603
70 Ga0157379_10766946 3300014968 Bacteria 909
71 Ga0206352_10364071 3300020078 Bacteria 517
72 Ga0206353_10037072 3300020082 Bacteria 815
73 Ga0206353_10902115 3300020082 Bacteria 1194
74 Ga0213873_10091603 3300021358 Bacteria 864
75 Ga0213876_10033447 3300021384 Bacteria 2711
76 Ga0213875_10412118 3300021388 Bacteria 645
77 Ga0207656_10099782 3300025321 Bacteria 1330
78 Ga0207688_10044498 3300025901 Bacteria 2474
79 Ga0207688_10076678 3300025901 Bacteria 1904
80 Ga0207643_10026148 3300025908 Bacteria 3230
81 Ga0207705_10327145 3300025909 Bacteria 1178
82 Ga0207707_10720567 3300025912 Bacteria 836
83 Ga0207660_11181175 3300025917 Bacteria 623
84 Ga0207657_10158555 3300025919 Bacteria 1839
85 Ga0207657_10494821 3300025919 Bacteria 958
86 Ga0207652_10471019 3300025921 Bacteria 1132
87 Ga0207681_10951537 3300025923 Bacteria 720
88 Ga0207659_10353280 3300025926 Bacteria 1220
89 Ga0207659_10556049 3300025926 Bacteria 976
90 Ga0207687_10042068 3300025927 Bacteria 3140
91 Ga0207687_10151663 3300025927 Bacteria 1769
92 Ga0207664_10178881 3300025929 Bacteria 1820
93 Ga0207664_10732656 3300025929 Bacteria 889
94 Ga0207669_11461051 3300025937 Bacteria 583
95 Ga0207704_11987261 3300025938 Bacteria 500
96 Ga0207689_10716070 3300025942 Bacteria 844
97 Ga0207679_10637354 3300025945 Unclassified 963
98 Ga0207651_11088190 3300025960 Bacteria 716
99 Ga0207658_11260441 3300025986 Bacteria 676
100 Ga0207677_10119845 3300026023 Bacteria 1977
101 Ga0207677_11860297 3300026023 Bacteria 559
102 Ga0207703_10427362 3300026035 Bacteria 1234
103 Ga0207702_10016818 3300026078 Bacteria 6054
104 Ga0207648_10267914 3300026089 Bacteria 1525
105 Ga0207648_11059869 3300026089 Bacteria 760
106 Ga0207648_11608195 3300026089 Unclassified 611
107 Ga0207674_10457859 3300026116 Bacteria 1233
108 Ga0207683_10272388 3300026121 Bacteria 1546
109 Ga0207428_10579901 3300027907 Bacteria 809
110 Ga0265316_10267705 3300031344 Bacteria 1251
111 Ga0316576_10274453 3300031727 Bacteria 1263
112 Ga0316576_10544249 3300031727 Bacteria 851
113 Ga0316576_10681353 3300031727 Bacteria 746
114 Ga0316578_10869044 3300031728 Bacteria 521
115 Ga0307413_11186144 3300031824 Bacteria 663
116 Ga0326468_10015521 3300031889 Bacteria 844
117 Ga0307406_11271941 3300031901 Bacteria 641
118 Ga0307407_10141470 3300031903 Bacteria 1553
119 Ga0307412_10043325 3300031911 Bacteria 2930
120 Ga0307409_100234540 3300031995 Bacteria 1666
121 Ga0307416_100980339 3300032002 Bacteria 948
122 Ga0307411_10673799 3300032005 Bacteria 898
123 Ga0373928_0149408 3300035084 Bacteria 646
124 Ga0373951_0050367 3300035091 Bacteria 1023
125 Ga0373952_0019510 3300035092 Bacteria 1413
126 Ga0373954_0483140 3300035118 Bacteria 614
127 Ga0373960_0148073 3300035121 Bacteria 800
128 Ga0316574_0045169 3300035398 Bacteria 2727
129 Ga0316574_0090644 3300035398 Bacteria 1949
130 Ga0316574_0330699 3300035398 Bacteria 966
131 Ga0373931_0311920 3300035691 Bacteria 974
132 Ga0373937_0293157 3300036401 Bacteria 1537
133 Ga0373937_0745303 3300036401 Bacteria 927
134 Ga0436364_0101441 3300037853 Bacteria 976
135 Ga0400483_252475 3300039062 Bacteria 2506
136 Ga0436365_0034501 3300039437 Bacteria 9770
137 Ga0436365_1666615 3300039437 Bacteria 1874
138 Ga0436361_0437054 3300039447 Bacteria 3267
139 Ga0436361_1057605 3300039447 Bacteria 664
140 Ga0436362_0492337 3300039453 Bacteria 652
141 Ga0436362_0876692 3300039453 Bacteria 3082
142 Ga0436362_0976861 3300039453 Bacteria 4280
143 Ga0451791_0858882 3300041451 Bacteria 877
144 Ga0451798_0976550 3300041458 Bacteria 578
145 Ga0451807_2102690 3300041486 Bacteria 646
146 Ga0451833_1056497 3300041491 Bacteria 623
147 Ga0439434_0030593 3300042435 Bacteria 1634
148 Ga0466959_0121607 3300045049 Bacteria 1855
149 Ga0466967_0335901 3300045976 Bacteria 1460
150 Ga0495592_0570016 3300046454 Bacteria 694
151 Ga0495603_0235992 3300046455 Bacteria 1054
152 Ga0495629_0644940 3300046459 Bacteria 706
153 Ga0495662_0227626 3300046476 Bacteria 919
154 Ga0495583_0365246 3300046506 Bacteria 569
155 Ga0495630_0395464 3300046517 Bacteria 1059
156 Ga0495645_0591822 3300046543 Bacteria 683
157 Ga0495599_0166361 3300046678 Bacteria 1362
158 Ga0495613_0174050 3300046689 Bacteria 1526
159 Ga0495604_0480284 3300047317 Bacteria 808
160 Ga0495636_0330358 3300047318 Bacteria 717
161 Ga0496108_0089039 3300048911 Bacteria 2623
162 Ga0496108_1168940 3300048911 Bacteria 652
163 Ga0496110_0068200 3300048913 Bacteria 3148
164 Ga0501031_0135139 3300049568 Bacteria 1611
165 Ga0501031_0284841 3300049568 Bacteria 1072
166 Ga0501032_0134312 3300049569 Bacteria 1631
167 Ga0501032_0189131 3300049569 Bacteria 1346
168 Ga0501032_0867918 3300049569 Bacteria 569
169 Ga0501033_0942909 3300049570 Bacteria 579
170 Ga0501034_0004625 3300049571 Bacteria 15250
171 Ga0501034_0107291 3300049571 Bacteria 2785
172 Ga0501036_0019532 3300049572 Bacteria 5689
173 Ga0501036_0034994 3300049572 Bacteria 4248
174 Ga0501036_0402324 3300049572 Bacteria 1142
175 Ga0501037_0032588 3300049573 Bacteria 3848
176 Ga0501037_0154399 3300049573 Bacteria 1639
177 Ga0501037_0889356 3300049573 Bacteria 584
178 Ga0501038_0007119 3300049574 Bacteria 10335
179 Ga0501038_0082779 3300049574 Bacteria 2702
180 Ga0501038_0170579 3300049574 Bacteria 1762
181 Ga0501038_0449879 3300049574 Bacteria 990
182 Ga0501039_0020227 3300049575 Bacteria 5102
183 Ga0501039_0043170 3300049575 Bacteria 3483
184 Ga0501039_0128924 3300049575 Bacteria 1985
185 Ga0501039_0268348 3300049575 Bacteria 1341
186 Ga0501040_0016622 3300049576 Bacteria 4875
187 Ga0501040_0259746 3300049576 Bacteria 1239
188 Ga0501041_0004797 3300049577 Bacteria 7856
189 Ga0501041_0034598 3300049577 Bacteria 3059
190 Ga0501041_0363059 3300049577 Bacteria 916
191 Ga0501042_0016334 3300049578 Bacteria 5094
192 Ga0501042_0109912 3300049578 Bacteria 1985
193 Ga0501042_0483698 3300049578 Bacteria 899
194 Ga0501042_0676396 3300049578 Bacteria 750
195 Ga0501043_0082768 3300049579 Bacteria 2523
196 Ga0501043_0232941 3300049579 Bacteria 1422
197 Ga0501043_0750539 3300049579 Bacteria 709
198 Ga0501046_0013165 3300049580 Bacteria 7019
199 Ga0501046_0678119 3300049580 Bacteria 727
200 Ga0501048_0033847 3300049582 Bacteria 3690
201 Ga0501048_0050517 3300049582 Bacteria 2961
202 Ga0501048_0058034 3300049582 Bacteria 2744
203 Ga0501048_0673746 3300049582 Bacteria 743
204 Ga0501048_1233466 3300049582 Bacteria 538
205 Ga0501067_0624326 3300049583 Bacteria 605
206 Ga0501068_0001018 3300049584 Bacteria 14781
207 Ga0501068_0033197 3300049584 Bacteria 3073
208 Ga0501069_0004339 3300049585 Bacteria 7322
209 Ga0501069_0027844 3300049585 Bacteria 3098
210 Ga0501070_0000447 3300049586 Bacteria 37526
211 Ga0501070_0099350 3300049586 Bacteria 2408
212 Ga0501071_0013811 3300049587 Bacteria 5511
213 Ga0501071_0094968 3300049587 Bacteria 2194
214 Ga0501071_0241344 3300049587 Bacteria 1362
215 Ga0501072_0001814 3300049588 Bacteria 15906
216 Ga0501072_0011513 3300049588 Bacteria 6760
217 Ga0501072_0101608 3300049588 Bacteria 2285
218 Ga0501073_0000464 3300049589 Bacteria 28106
219 Ga0501073_0003330 3300049589 Bacteria 12077
220 Ga0501073_0252727 3300049589 Bacteria 1217
221 Ga0501074_0006180 3300049590 Bacteria 8647
222 Ga0501074_0028618 3300049590 Bacteria 4039
223 Ga0501074_0032837 3300049590 Bacteria 3760
224 Ga0501074_0141826 3300049590 Bacteria 1719
225 Ga0501075_0003326 3300049591 Bacteria 10749
226 Ga0501075_0004835 3300049591 Bacteria 9169
227 Ga0501075_0237323 3300049591 Bacteria 1390
228 Ga0501076_0017962 3300049592 Bacteria 5380
229 Ga0501076_0021567 3300049592 Bacteria 4942
230 Ga0501076_0077869 3300049592 Bacteria 2660
231 Ga0501076_0092102 3300049592 Bacteria 2439
232 Ga0501077_0007838 3300049593 Bacteria 6593
233 Ga0501077_0185846 3300049593 Bacteria 1320
234 Ga0501079_0003879 3300049741 Bacteria 11029
235 Ga0501079_0018094 3300049741 Bacteria 5381
236 Ga0501079_0659665 3300049741 Bacteria 824
237 Ga0501080_0027591 3300049742 Bacteria 5280
238 Ga0501080_0081290 3300049742 Bacteria 3011
239 Ga0501080_0121678 3300049742 Bacteria 2418
240 Ga0501080_0126555 3300049742 Bacteria 2366
241 Ga0501080_0167996 3300049742 Bacteria 2024
242 Ga0501080_0340313 3300049742 Bacteria 1356
243 Ga0501080_1160175 3300049742 Bacteria 665
244 Ga0501081_0006208 3300049743 Bacteria 7743
245 Ga0501081_0030944 3300049743 Bacteria 3626
246 Ga0501081_0509830 3300049743 Bacteria 897
247 Ga0501083_0007045 3300049744 Bacteria 7983
248 Ga0501083_0007281 3300049744 Bacteria 7847
249 Ga0501083_0043333 3300049744 Bacteria 3049
250 Ga0501035_0767943 3300049822 Bacteria 772
251 Ga0501044_0926754 3300049823 Bacteria 745
252 Ga0501044_1333704 3300049823 Bacteria 583
253 Ga0501045_0005057 3300049824 Bacteria 9130
254 Ga0501045_0012304 3300049824 Bacteria 6023
255 Ga0501045_0252236 3300049824 Bacteria 1313
256 nmdc:mga03n38_626961_c1 3300050490 Bacteria 614
257 nmdc:mga00v17_695_c1 3300050491 Bacteria 18443
258 nmdc:mga0yw44_1047595_c1 3300050492 Bacteria 552
259 nmdc:mga0yw44_358560_c1 3300050492 Bacteria 982
260 nmdc:mga06z11_56374_c1 3300050494 Bacteria 2032
261 nmdc:mga05p37_315764_c1 3300050507 Bacteria 1851
262 nmdc:mga09592_454083_c1 3300050508 Bacteria 1105
263 nmdc:mga06r32_600011_c1 3300050510 Bacteria 1072
264 nmdc:mga08y16_1370100_c1 3300050511 Unclassified 672
265 nmdc:mga0rr50_682321_c1 3300050513 Bacteria 877
266 nmdc:mga08x19_750374_c1 3300050514 Bacteria 693
267 Ga0495595_0049088 3300053084 Bacteria 1951
268 Ga0495595_0631641 3300053084 Bacteria 548
269 Ga0495595_0637267 3300053084 Bacteria 545
270 Ga0495619_0066792 3300053085 Bacteria 2400
271 Ga0501084_0003298 3300054114 Bacteria 13056
272 Ga0501084_0777668 3300054114 Bacteria 806
273 Ga0501082_0009297 3300060353 Bacteria 8472
274 Ga0501082_0013758 3300060353 Bacteria 6956
275 Ga0501082_0240290 3300060353 Bacteria 1576
276 Ga0501082_0522545 3300060353 Bacteria 1038
277 Ga0530510_0013215 3300061734 Bacteria 5805
278 Ga0530510_0137004 3300061734 Bacteria 1802
279 Ga0530510_0181940 3300061734 Bacteria 1559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031889 Ga0326468_10015521 Ga0326468_100155212 111
2 3300005343 Ga0070687_100305020 Ga0070687_1003050201 115
3 3300005345 Ga0070692_10541504 Ga0070692_105415042 115
4 3300005455 Ga0070663_100133043 Ga0070663_1001330431 115
5 3300005530 Ga0070679_100898970 Ga0070679_1008989701 115
6 3300005539 Ga0068853_100748716 Ga0068853_1007487161 115
7 3300005547 Ga0070693_100487757 Ga0070693_1004877572 115
8 3300005577 Ga0068857_100304151 Ga0068857_1003041512 115
9 3300005578 Ga0068854_100304359 Ga0068854_1003043592 115
10 3300005617 Ga0068859_101763975 Ga0068859_1017639752 115
11 3300005834 Ga0068851_10125018 Ga0068851_101250182 115
12 3300006931 Ga0097620_101763917 Ga0097620_1017639172 115
13 3300013102 Ga0157371_10079563 Ga0157371_100795633 115
14 3300020082 Ga0206353_10902115 Ga0206353_109021152 115
15 3300025321 Ga0207656_10099782 Ga0207656_100997822 115
16 3300025942 Ga0207689_10716070 Ga0207689_107160701 115
17 3300026089 Ga0207648_11059869 Ga0207648_110598692 115
18 3300026116 Ga0207674_10457859 Ga0207674_104578593 115
19 3300026121 Ga0207683_10272388 Ga0207683_102723883 115
20 3300005339 Ga0070660_101281924 Ga0070660_1012819242 117
21 3300005331 Ga0070670_101143061 Ga0070670_1011430612 123
22 3300005354 Ga0070675_100168882 Ga0070675_1001688822 123
23 3300005577 Ga0068857_100283184 Ga0068857_1002831841 123
24 3300005617 Ga0068859_101882347 Ga0068859_1018823471 123
25 3300006931 Ga0097620_101882082 Ga0097620_1018820821 123
26 3300025926 Ga0207659_10353280 Ga0207659_103532801 123
27 3300025945 Ga0207679_10637354 Ga0207679_106373542 123
28 3300036401 Ga0373937_0293157 Ga0373937_0293157_408_782 123
29 3300045976 Ga0466967_0335901 Ga0466967_0335901_686_1060 123
30 3300047318 Ga0495636_0330358 Ga0495636_0330358_28_402 123
31 3300031824 Ga0307413_11186144 Ga0307413_111861442 124
32 3300031995 Ga0307409_100234540 Ga0307409_1002345403 124
33 3300032002 Ga0307416_100980339 Ga0307416_1009803392 124
34 3300032005 Ga0307411_10673799 Ga0307411_106737992 124
35 3300005336 Ga0070680_100605794 Ga0070680_1006057942 125
36 3300005366 Ga0070659_100385992 Ga0070659_1003859922 125
37 3300005435 Ga0070714_100059594 Ga0070714_1000595942 125
38 3300005435 Ga0070714_100595895 Ga0070714_1005958952 125
39 3300005458 Ga0070681_10050272 Ga0070681_100502721 125
40 3300005458 Ga0070681_10299304 Ga0070681_102993043 125
41 3300005530 Ga0070679_101197787 Ga0070679_1011977872 125
42 3300005535 Ga0070684_101965279 Ga0070684_1019652791 125
43 3300005614 Ga0068856_100112526 Ga0068856_1001125261 125
44 3300006028 Ga0070717_11326051 Ga0070717_113260512 125
45 3300006038 Ga0075365_10673639 Ga0075365_106736391 125
46 3300006048 Ga0075363_100383676 Ga0075363_1003836762 125
47 3300006048 Ga0075363_100471851 Ga0075363_1004718512 125
48 3300006051 Ga0075364_10011922 Ga0075364_100119225 125
49 3300006173 Ga0070716_101396287 Ga0070716_1013962872 125
50 3300006175 Ga0070712_100725805 Ga0070712_1007258052 125
51 3300006178 Ga0075367_10140322 Ga0075367_101403223 125
52 3300006178 Ga0075367_10249158 Ga0075367_102491582 125
53 3300006195 Ga0075366_10684601 Ga0075366_106846012 125
54 3300007076 Ga0075435_100756843 Ga0075435_1007568432 125
55 3300009176 Ga0105242_12275583 Ga0105242_122755832 125
56 3300009993 Ga0105028_109282 Ga0105028_1092822 125
57 3300013104 Ga0157370_11087406 Ga0157370_110874061 125
58 3300013105 Ga0157369_10149883 Ga0157369_101498833 125
59 3300014745 Ga0157377_11126326 Ga0157377_111263262 125
60 3300020082 Ga0206353_10037072 Ga0206353_100370721 125
61 3300021358 Ga0213873_10091603 Ga0213873_100916032 125
62 3300021384 Ga0213876_10033447 Ga0213876_100334472 125
63 3300025912 Ga0207707_10720567 Ga0207707_107205672 125
64 3300025921 Ga0207652_10471019 Ga0207652_104710192 125
65 3300025927 Ga0207687_10042068 Ga0207687_100420682 125
66 3300025929 Ga0207664_10178881 Ga0207664_101788812 125
67 3300025929 Ga0207664_10732656 Ga0207664_107326562 125
68 3300025960 Ga0207651_11088190 Ga0207651_110881902 125
69 3300026078 Ga0207702_10016818 Ga0207702_100168188 125
70 3300031727 Ga0316576_10544249 Ga0316576_105442492 125
71 3300031901 Ga0307406_11271941 Ga0307406_112719412 125
72 3300031903 Ga0307407_10141470 Ga0307407_101414702 125
73 3300031911 Ga0307412_10043325 Ga0307412_100433252 125
74 3300035091 Ga0373951_0050367 Ga0373951_0050367_66_446 125
75 3300035092 Ga0373952_0019510 Ga0373952_0019510_485_865 125
76 3300035118 Ga0373954_0483140 Ga0373954_0483140_204_593 125
77 3300035398 Ga0316574_0045169 Ga0316574_0045169_186_581 125
78 3300036401 Ga0373937_0745303 Ga0373937_0745303_320_700 125
79 3300039437 Ga0436365_0034501 Ga0436365_0034501_5537_5917 125
80 3300039437 Ga0436365_1666615 Ga0436365_1666615_456_836 125
81 3300039447 Ga0436361_0437054 Ga0436361_0437054_651_1031 125
82 3300039447 Ga0436361_1057605 Ga0436361_1057605_124_504 125
83 3300039453 Ga0436362_0492337 Ga0436362_0492337_91_471 125
84 3300039453 Ga0436362_0876692 Ga0436362_0876692_1661_2041 125
85 3300039453 Ga0436362_0976861 Ga0436362_0976861_486_866 125
86 3300041451 Ga0451791_0858882 Ga0451791_0858882_215_595 125
87 3300041458 Ga0451798_0976550 Ga0451798_0976550_36_416 125
88 3300041486 Ga0451807_2102690 Ga0451807_2102690_229_615 125
89 3300042435 Ga0439434_0030593 Ga0439434_0030593_730_1110 125
90 3300045049 Ga0466959_0121607 Ga0466959_0121607_28_408 125
91 3300046454 Ga0495592_0570016 Ga0495592_0570016_253_633 125
92 3300046455 Ga0495603_0235992 Ga0495603_0235992_422_802 125
93 3300046459 Ga0495629_0644940 Ga0495629_0644940_268_648 125
94 3300046476 Ga0495662_0227626 Ga0495662_0227626_242_622 125
95 3300046506 Ga0495583_0365246 Ga0495583_0365246_126_506 125
96 3300046517 Ga0495630_0395464 Ga0495630_0395464_620_1000 125
97 3300046543 Ga0495645_0591822 Ga0495645_0591822_243_623 125
98 3300046678 Ga0495599_0166361 Ga0495599_0166361_157_537 125
99 3300046689 Ga0495613_0174050 Ga0495613_0174050_95_475 125
100 3300047317 Ga0495604_0480284 Ga0495604_0480284_189_569 125
101 3300048911 Ga0496108_1168940 Ga0496108_1168940_57_440 125
102 3300049568 Ga0501031_0135139 Ga0501031_0135139_920_1300 125
103 3300049569 Ga0501032_0134312 Ga0501032_0134312_838_1218 125
104 3300049569 Ga0501032_0189131 Ga0501032_0189131_786_1166 125
105 3300049570 Ga0501033_0942909 Ga0501033_0942909_174_554 125
106 3300049571 Ga0501034_0004625 Ga0501034_0004625_699_1079 125
107 3300049571 Ga0501034_0107291 Ga0501034_0107291_1888_2268 125
108 3300049572 Ga0501036_0019532 Ga0501036_0019532_479_859 125
109 3300049572 Ga0501036_0034994 Ga0501036_0034994_68_448 125
110 3300049572 Ga0501036_0402324 Ga0501036_0402324_73_453 125
111 3300049573 Ga0501037_0032588 Ga0501037_0032588_2659_3039 125
112 3300049573 Ga0501037_0154399 Ga0501037_0154399_264_644 125
113 3300049574 Ga0501038_0007119 Ga0501038_0007119_5013_5393 125
114 3300049574 Ga0501038_0082779 Ga0501038_0082779_790_1170 125
115 3300049574 Ga0501038_0449879 Ga0501038_0449879_528_908 125
116 3300049575 Ga0501039_0128924 Ga0501039_0128924_1454_1834 125
117 3300049575 Ga0501039_0268348 Ga0501039_0268348_69_449 125
118 3300049576 Ga0501040_0016622 Ga0501040_0016622_672_1052 125
119 3300049577 Ga0501041_0004797 Ga0501041_0004797_3650_4030 125
120 3300049578 Ga0501042_0016334 Ga0501042_0016334_3632_4012 125
121 3300049578 Ga0501042_0676396 Ga0501042_0676396_194_574 125
122 3300049579 Ga0501043_0082768 Ga0501043_0082768_1878_2258 125
123 3300049579 Ga0501043_0232941 Ga0501043_0232941_878_1258 125
124 3300049580 Ga0501046_0013165 Ga0501046_0013165_2464_2844 125
125 3300049580 Ga0501046_0678119 Ga0501046_0678119_179_559 125
126 3300049582 Ga0501048_0033847 Ga0501048_0033847_782_1162 125
127 3300049582 Ga0501048_0058034 Ga0501048_0058034_608_988 125
128 3300049582 Ga0501048_0673746 Ga0501048_0673746_289_669 125
129 3300049584 Ga0501068_0001018 Ga0501068_0001018_8039_8419 125
130 3300049585 Ga0501069_0004339 Ga0501069_0004339_3551_3931 125
131 3300049585 Ga0501069_0027844 Ga0501069_0027844_778_1158 125
132 3300049586 Ga0501070_0000447 Ga0501070_0000447_68_448 125
133 3300049586 Ga0501070_0099350 Ga0501070_0099350_1469_1849 125
134 3300049587 Ga0501071_0013811 Ga0501071_0013811_1010_1390 125
135 3300049587 Ga0501071_0094968 Ga0501071_0094968_615_995 125
136 3300049587 Ga0501071_0241344 Ga0501071_0241344_15_395 125
137 3300049588 Ga0501072_0001814 Ga0501072_0001814_11310_11690 125
138 3300049588 Ga0501072_0101608 Ga0501072_0101608_1480_1860 125
139 3300049589 Ga0501073_0000464 Ga0501073_0000464_2608_2988 125
140 3300049589 Ga0501073_0003330 Ga0501073_0003330_11645_12025 125
141 3300049589 Ga0501073_0252727 Ga0501073_0252727_51_431 125
142 3300049590 Ga0501074_0006180 Ga0501074_0006180_541_921 125
143 3300049590 Ga0501074_0032837 Ga0501074_0032837_2304_2684 125
144 3300049590 Ga0501074_0141826 Ga0501074_0141826_573_953 125
145 3300049591 Ga0501075_0004835 Ga0501075_0004835_4246_4626 125
146 3300049591 Ga0501075_0237323 Ga0501075_0237323_454_834 125
147 3300049592 Ga0501076_0017962 Ga0501076_0017962_4301_4681 125
148 3300049592 Ga0501076_0077869 Ga0501076_0077869_1369_1749 125
149 3300049592 Ga0501076_0092102 Ga0501076_0092102_1477_1857 125
150 3300049593 Ga0501077_0007838 Ga0501077_0007838_2271_2651 125
151 3300049741 Ga0501079_0018094 Ga0501079_0018094_837_1217 125
152 3300049741 Ga0501079_0659665 Ga0501079_0659665_34_414 125
153 3300049742 Ga0501080_0027591 Ga0501080_0027591_3614_3994 125
154 3300049742 Ga0501080_0081290 Ga0501080_0081290_1857_2237 125
155 3300049742 Ga0501080_0121678 Ga0501080_0121678_1373_1753 125
156 3300049742 Ga0501080_0167996 Ga0501080_0167996_649_1029 125
157 3300049742 Ga0501080_0340313 Ga0501080_0340313_219_599 125
158 3300049742 Ga0501080_1160175 Ga0501080_1160175_31_411 125
159 3300049743 Ga0501081_0006208 Ga0501081_0006208_3724_4104 125
160 3300049743 Ga0501081_0509830 Ga0501081_0509830_248_628 125
161 3300049744 Ga0501083_0007045 Ga0501083_0007045_7522_7902 125
162 3300049744 Ga0501083_0007281 Ga0501083_0007281_689_1069 125
163 3300049744 Ga0501083_0043333 Ga0501083_0043333_753_1133 125
164 3300049822 Ga0501035_0767943 Ga0501035_0767943_61_441 125
165 3300049823 Ga0501044_0926754 Ga0501044_0926754_77_457 125
166 3300049823 Ga0501044_1333704 Ga0501044_1333704_43_423 125
167 3300049824 Ga0501045_0005057 Ga0501045_0005057_3703_4083 125
168 3300049824 Ga0501045_0252236 Ga0501045_0252236_741_1121 125
169 3300050490 nmdc:mga03n38_626961_c1 nmdc:mga03n38_626961_c1_51_431 125
170 3300050491 nmdc:mga00v17_695_c1 nmdc:mga00v17_695_c1_7476_7856 125
171 3300050492 nmdc:mga0yw44_1047595_c1 nmdc:mga0yw44_1047595_c1_90_470 125
172 3300050492 nmdc:mga0yw44_358560_c1 nmdc:mga0yw44_358560_c1_418_798 125
173 3300050494 nmdc:mga06z11_56374_c1 nmdc:mga06z11_56374_c1_445_825 125
174 3300050513 nmdc:mga0rr50_682321_c1 nmdc:mga0rr50_682321_c1_470_850 125
175 3300050514 nmdc:mga08x19_750374_c1 nmdc:mga08x19_750374_c1_143_523 125
176 3300053084 Ga0495595_0049088 Ga0495595_0049088_1121_1501 125
177 3300053084 Ga0495595_0637267 Ga0495595_0637267_103_483 125
178 3300053085 Ga0495619_0066792 Ga0495619_0066792_438_818 125
179 3300054114 Ga0501084_0003298 Ga0501084_0003298_4375_4755 125
180 3300060353 Ga0501082_0009297 Ga0501082_0009297_3714_4094 125
181 3300060353 Ga0501082_0240290 Ga0501082_0240290_1018_1398 125
182 3300060353 Ga0501082_0522545 Ga0501082_0522545_453_833 125
183 3300061734 Ga0530510_0137004 Ga0530510_0137004_401_781 125
184 3300061734 Ga0530510_0181940 Ga0530510_0181940_1040_1420 125
185 3300005353 Ga0070669_101172269 Ga0070669_1011722692 126
186 3300009098 Ga0105245_10205861 Ga0105245_102058612 126
187 3300009147 Ga0114129_10378087 Ga0114129_103780873 126
188 3300021388 Ga0213875_10412118 Ga0213875_104121181 126
189 3300025917 Ga0207660_11181175 Ga0207660_111811752 126
190 3300025923 Ga0207681_10951537 Ga0207681_109515372 126
191 3300025937 Ga0207669_11461051 Ga0207669_114610512 126
192 3300026089 Ga0207648_11608195 Ga0207648_116081951 126
193 3300031344 Ga0265316_10267705 Ga0265316_102677052 126
194 3300031727 Ga0316576_10274453 Ga0316576_102744531 126
195 3300031727 Ga0316576_10681353 Ga0316576_106813532 126
196 3300031728 Ga0316578_10869044 Ga0316578_108690442 126
197 3300035398 Ga0316574_0090644 Ga0316574_0090644_813_1196 126
198 3300035398 Ga0316574_0330699 Ga0316574_0330699_61_444 126
199 3300037853 Ga0436364_0101441 Ga0436364_0101441_267_650 126
200 3300039062 Ga0400483_252475 Ga0400483_252475_1390_1773 126
201 3300041491 Ga0451833_1056497 Ga0451833_1056497_71_454 126
202 3300049573 Ga0501037_0889356 Ga0501037_0889356_81_473 126
203 3300049574 Ga0501038_0170579 Ga0501038_0170579_271_663 126
204 3300049575 Ga0501039_0020227 Ga0501039_0020227_2500_2892 126
205 3300049575 Ga0501039_0043170 Ga0501039_0043170_3032_3415 126
206 3300049576 Ga0501040_0259746 Ga0501040_0259746_331_723 126
207 3300049577 Ga0501041_0034598 Ga0501041_0034598_2029_2421 126
208 3300049578 Ga0501042_0109912 Ga0501042_0109912_1263_1655 126
209 3300049579 Ga0501043_0750539 Ga0501043_0750539_217_609 126
210 3300049582 Ga0501048_0050517 Ga0501048_0050517_1239_1631 126
211 3300049583 Ga0501067_0624326 Ga0501067_0624326_151_534 126
212 3300049584 Ga0501068_0033197 Ga0501068_0033197_680_1063 126
213 3300049588 Ga0501072_0011513 Ga0501072_0011513_2470_2940 126
214 3300049590 Ga0501074_0028618 Ga0501074_0028618_3494_3886 126
215 3300049591 Ga0501075_0003326 Ga0501075_0003326_5711_6103 126
216 3300049592 Ga0501076_0021567 Ga0501076_0021567_639_1031 126
217 3300049593 Ga0501077_0185846 Ga0501077_0185846_602_994 126
218 3300049741 Ga0501079_0003879 Ga0501079_0003879_2581_2973 126
219 3300049742 Ga0501080_0126555 Ga0501080_0126555_1946_2338 126
220 3300049743 Ga0501081_0030944 Ga0501081_0030944_368_760 126
221 3300049824 Ga0501045_0012304 Ga0501045_0012304_3335_3727 126
222 3300050507 nmdc:mga05p37_315764_c1 nmdc:mga05p37_315764_c1_914_1297 126
223 3300050510 nmdc:mga06r32_600011_c1 nmdc:mga06r32_600011_c1_418_801 126
224 3300053084 Ga0495595_0631641 Ga0495595_0631641_141_527 126
225 3300054114 Ga0501084_0777668 Ga0501084_0777668_211_603 126
226 3300060353 Ga0501082_0013758 Ga0501082_0013758_1487_1879 126
227 3300061734 Ga0530510_0013215 Ga0530510_0013215_5271_5663 126
228 3300005327 Ga0070658_10487030 Ga0070658_104870301 127
229 3300005330 Ga0070690_100078188 Ga0070690_1000781882 127
230 3300005338 Ga0068868_100181055 Ga0068868_1001810552 127
231 3300005339 Ga0070660_100848935 Ga0070660_1008489351 127
232 3300005347 Ga0070668_100501610 Ga0070668_1005016102 127
233 3300005354 Ga0070675_100458578 Ga0070675_1004585781 127
234 3300005366 Ga0070659_100335225 Ga0070659_1003352251 127
235 3300005367 Ga0070667_101683063 Ga0070667_1016830631 127
236 3300005459 Ga0068867_101281559 Ga0068867_1012815591 127
237 3300005466 Ga0070685_10150437 Ga0070685_101504372 127
238 3300005548 Ga0070665_100293624 Ga0070665_1002936242 127
239 3300005615 Ga0070702_100292211 Ga0070702_1002922112 127
240 3300005616 Ga0068852_100135336 Ga0068852_1001353363 127
241 3300005840 Ga0068870_10109682 Ga0068870_101096822 127
242 3300006844 Ga0075428_100374257 Ga0075428_1003742573 127
243 3300006881 Ga0068865_100818362 Ga0068865_1008183622 127
244 3300006881 Ga0068865_101207172 Ga0068865_1012071721 127
245 3300009094 Ga0111539_10786811 Ga0111539_107868112 127
246 3300009098 Ga0105245_10063697 Ga0105245_100636974 127
247 3300009098 Ga0105245_10690483 Ga0105245_106904832 127
248 3300010375 Ga0105239_11660632 Ga0105239_116606321 127
249 3300012512 Ga0157327_1044142 Ga0157327_10441421 127
250 3300014745 Ga0157377_10268384 Ga0157377_102683841 127
251 3300014968 Ga0157379_10766946 Ga0157379_107669462 127
252 3300020078 Ga0206352_10364071 Ga0206352_103640711 127
253 3300025901 Ga0207688_10044498 Ga0207688_100444983 127
254 3300025901 Ga0207688_10076678 Ga0207688_100766782 127
255 3300025908 Ga0207643_10026148 Ga0207643_100261485 127
256 3300025909 Ga0207705_10327145 Ga0207705_103271452 127
257 3300025919 Ga0207657_10158555 Ga0207657_101585553 127
258 3300025919 Ga0207657_10494821 Ga0207657_104948212 127
259 3300025926 Ga0207659_10556049 Ga0207659_105560491 127
260 3300025927 Ga0207687_10151663 Ga0207687_101516632 127
261 3300025938 Ga0207704_11987261 Ga0207704_119872611 127
262 3300025986 Ga0207658_11260441 Ga0207658_112604411 127
263 3300026023 Ga0207677_10119845 Ga0207677_101198452 127
264 3300026023 Ga0207677_11860297 Ga0207677_118602971 127
265 3300026035 Ga0207703_10427362 Ga0207703_104273622 127
266 3300026089 Ga0207648_10267914 Ga0207648_102679142 127
267 3300027907 Ga0207428_10579901 Ga0207428_105799012 127
268 3300035084 Ga0373928_0149408 Ga0373928_0149408_201_584 127
269 3300035121 Ga0373960_0148073 Ga0373960_0148073_294_677 127
270 3300035691 Ga0373931_0311920 Ga0373931_0311920_559_942 127
271 3300048911 Ga0496108_0089039 Ga0496108_0089039_254_637 127
272 3300048913 Ga0496110_0068200 Ga0496110_0068200_809_1192 127
273 3300049568 Ga0501031_0284841 Ga0501031_0284841_509_892 127
274 3300049569 Ga0501032_0867918 Ga0501032_0867918_92_475 127
275 3300049577 Ga0501041_0363059 Ga0501041_0363059_112_495 127
276 3300049578 Ga0501042_0483698 Ga0501042_0483698_105_488 127
277 3300049582 Ga0501048_1233466 Ga0501048_1233466_27_410 127
278 3300050508 nmdc:mga09592_454083_c1 nmdc:mga09592_454083_c1_305_688 127
279 3300050511 nmdc:mga08y16_1370100_c1 nmdc:mga08y16_1370100_c1_102_485 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

28

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9818 1 126
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9805 1 126
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9733 1 127
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9713 6 126
3a8k-assembly1.cif.gz_E crystal structure of etd97n-ehred complex 0.9699 1 125
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9735 6 123 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.972 2 125 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.971 6 126 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9616 6 123 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.956 6 122 2.40.50.100
ID Description Score Start End GO Terms
AF-W6K3J1-F1-model_v4 Glycine cleavage system H protein 0.9965 3 123 GO:0005829
GO:0005960
GO:0019464
AF-G2IYA0-F1-model_v4 Glycine cleavage system H protein 0.9959 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A6I6IGN9-F1-model_v4 deleted 0.9958 1 125
AF-A0A1V4RCH0-F1-model_v4 Glycine cleavage system H protein 0.9947 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A6N9BR01-F1-model_v4 Glycine cleavage system H protein 0.9943 1 126 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map