F383027

General Info

Members Datasets Scaffolds Average Seq Length
279 210 558 144

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10197126|Ga0114129_101971262
Length 171
Sequence MSLQERAAMPEEKTIVSLATATAGEVIAELGMQPHPEGGHFVEIFRDRPSTGERGAVTSIYFLLKSGEVSRWHRVDAIEIWNWYAGAPLKIAVAELEGVPPKEHLLGSNVLAGARPQVVVLANAWQSARTLGDWTLVGCTVAPAFEYSGFEMAPEGWEPESGARAQALGTG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
194 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
195 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
196 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
197 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
198 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
199 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
200 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
201 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
202 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
203 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
204 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
205 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
206 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
207 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
208 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
209 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
210 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 0
Isolates 6.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 2.87
Rhizoplane 5.38
Rhizosphere 83.51
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10197126 3300009147 Bacteria 2730
2 JGI25407J50210_10052900 3300003373 Bacteria 1027
3 Ga0065707_10145459 3300005295 Bacteria 1720
4 Ga0070682_100431727 3300005337 Bacteria 1004
5 Ga0070689_100074420 3300005340 Bacteria 2658
6 Ga0070669_100000179 3300005353 Bacteria 55254
7 Ga0070674_100166175 3300005356 Bacteria 1678
8 Ga0070688_100011942 3300005365 Bacteria 4850
9 Ga0070667_100547238 3300005367 Bacteria 1064
10 Ga0070709_10011060 3300005434 Bacteria 5017
11 Ga0070713_101427871 3300005436 Bacteria 671
12 Ga0070711_100539539 3300005439 Bacteria 966
13 Ga0070708_100361179 3300005445 Bacteria 1369
14 Ga0070678_100133617 3300005456 Bacteria 1975
15 Ga0070678_100346161 3300005456 Bacteria 1277
16 Ga0070685_10069832 3300005466 Bacteria 2079
17 Ga0070685_10204635 3300005466 Bacteria 1285
18 Ga0070706_100789850 3300005467 Bacteria 879
19 Ga0070699_100319176 3300005518 Bacteria 1396
20 Ga0070697_100078971 3300005536 Bacteria 2709
21 Ga0070695_101304585 3300005545 Bacteria 600
22 Ga0070665_100043517 3300005548 Bacteria 4513
23 Ga0070665_101087585 3300005548 Bacteria 811
24 Ga0068855_101882878 3300005563 Bacteria 606
25 Ga0068856_100748010 3300005614 Bacteria 998
26 Ga0068864_100340624 3300005618 Bacteria 1413
27 Ga0068861_100126036 3300005719 Bacteria 2072
28 Ga0068870_10561934 3300005840 Bacteria 770
29 Ga0068863_100567946 3300005841 Bacteria 1121
30 Ga0068860_100684204 3300005843 Bacteria 1035
31 Ga0068862_100110284 3300005844 Bacteria 2415
32 Ga0081455_10040942 3300005937 Bacteria 4082
33 Ga0081455_10049752 3300005937 Bacteria 3611
34 Ga0081538_10013960 3300005981 Bacteria 6325
35 Ga0081540_1004883 3300005983 Bacteria 10099
36 Ga0075432_10081899 3300006058 Bacteria 1171
37 Ga0075367_10415595 3300006178 Bacteria 851
38 Ga0068871_100630440 3300006358 Bacteria 977
39 Ga0075430_100497370 3300006846 Bacteria 1006
40 Ga0075431_100648390 3300006847 Bacteria 1036
41 Ga0075434_100594754 3300006871 Bacteria 1125
42 Ga0079104_1000101 3300006946 Bacteria 125456
43 Ga0075435_100188937 3300007076 Bacteria 1743
44 Ga0111539_10000041 3300009094 Bacteria 131679
45 Ga0111539_10598654 3300009094 Bacteria 1284
46 Ga0111539_12249629 3300009094 Bacteria 632
47 Ga0105247_10003784 3300009101 Bacteria 9811
48 Ga0114129_11116028 3300009147 Bacteria 986
49 Ga0105248_10005369 3300009177 Bacteria 14087
50 Ga0105249_10888270 3300009553 Bacteria 958
51 Ga0099796_10012876 3300010159 Bacteria 2375
52 Ga0157373_10258363 3300013100 Bacteria 1232
53 Ga0157370_10289017 3300013104 Bacteria 1514
54 Ga0157369_10001187 3300013105 Bacteria 32500
55 Ga0163163_10804106 3300014325 Bacteria 1004
56 Ga0157380_10014539 3300014326 Bacteria 5760
57 Ga0157380_10257343 3300014326 Bacteria 1583
58 Ga0157377_10378324 3300014745 Bacteria 958
59 Ga0213872_10000652 3300021361 Bacteria 26299
60 Ga0213872_10006479 3300021361 Bacteria 5865
61 Ga0213872_10036663 3300021361 Bacteria 2240
62 Ga0213872_10117973 3300021361 Bacteria 1174
63 Ga0213872_10191366 3300021361 Bacteria 880
64 Ga0213872_10202052 3300021361 Bacteria 851
65 Ga0213876_10541577 3300021384 Bacteria 619
66 Ga0207699_10384734 3300025906 Bacteria 996
67 Ga0207684_10090027 3300025910 Bacteria 2614
68 Ga0207654_10566584 3300025911 Bacteria 808
69 Ga0207693_10097559 3300025915 Bacteria 2304
70 Ga0207681_10000044 3300025923 Bacteria 128566
71 Ga0207650_10274136 3300025925 Bacteria 1372
72 Ga0207700_11675543 3300025928 Bacteria 561
73 Ga0207670_10392941 3300025936 Bacteria 1107
74 Ga0207669_10193825 3300025937 Bacteria 1468
75 Ga0207704_11124166 3300025938 Bacteria 668
76 Ga0207689_10435089 3300025942 Bacteria 1095
77 Ga0207640_10734838 3300025981 Bacteria 849
78 Ga0207658_10225569 3300025986 Bacteria 1579
79 Ga0207641_10182004 3300026088 Bacteria 1926
80 Ga0207648_11189978 3300026089 Bacteria 716
81 Ga0207683_10300526 3300026121 Bacteria 1469
82 Ga0207683_10545282 3300026121 Bacteria 1072
83 Ga0209281_1000028 3300027111 Bacteria 440027
84 Ga0207428_10038011 3300027907 Bacteria 3916
85 Ga0207428_10423482 3300027907 Bacteria 973
86 Ga0268265_10212011 3300028380 Bacteria 1688
87 Ga0268265_10577621 3300028380 Bacteria 1071
88 Ga0268265_10689548 3300028380 Bacteria 986
89 Ga0268265_10920957 3300028380 Bacteria 859
90 Ga0265337_1005850 3300028556 Bacteria 4819
91 Ga0265334_10289411 3300028573 Bacteria 561
92 Ga0265338_10032686 3300028800 Bacteria 5066
93 Ga0307408_100229227 3300031548 Bacteria 1520
94 Ga0265314_10241524 3300031711 Bacteria 1042
95 Ga0307413_10032229 3300031824 Bacteria 2968
96 Ga0307410_10094860 3300031852 Bacteria 2126
97 Ga0307410_10138057 3300031852 Bacteria 1800
98 Ga0307410_10638806 3300031852 Bacteria 892
99 Ga0307407_10053313 3300031903 Bacteria 2327
100 Ga0307409_100003189 3300031995 Bacteria 8819
101 Ga0307416_100014520 3300032002 Bacteria 5404
102 Ga0307416_100080816 3300032002 Bacteria 2746
103 Ga0307411_10064763 3300032005 Bacteria 2448
104 Ga0373955_0421439 3300035172 Bacteria 812
105 Ga0316574_0224552 3300035398 Unclassified 1203
106 Ga0316574_0289435 3300035398 Bacteria 1043
107 Ga0373935_0530906 3300035692 Bacteria 856
108 Ga0373927_0148813 3300035695 Bacteria 1533
109 Ga0373947_0826509 3300035725 Bacteria 632
110 Ga0373937_0104404 3300036401 Bacteria 2633
111 Ga0373937_1369760 3300036401 Bacteria 655
112 Ga0316582_1104828 3300036647 Bacteria 540
113 Ga0373925_0236856 3300037068 Bacteria 1461
114 Ga0395905_0284191 3300037471 Bacteria 1541
115 Ga0436365_0009724 3300039437 Bacteria 1649
116 Ga0436361_0063866 3300039447 Bacteria 6530
117 Ga0436361_0258150 3300039447 Bacteria 738
118 Ga0436361_0387816 3300039447 Bacteria 1155
119 Ga0436361_0418263 3300039447 Bacteria 1821
120 Ga0436361_0535418 3300039447 Bacteria 12923
121 Ga0436361_0800978 3300039447 Bacteria 4057
122 Ga0436361_0968855 3300039447 Bacteria 1186
123 Ga0436361_0992165 3300039447 Bacteria 658
124 Ga0436362_0988740 3300039453 Bacteria 506
125 Ga0451791_0838974 3300041451 Bacteria 545
126 Ga0439432_123275 3300042006 Bacteria 767
127 Ga0439440_0015054 3300042993 Bacteria 1678
128 Ga0453684_0296225 3300044712 Bacteria 1840
129 Ga0466968_0457952 3300044735 Bacteria 631
130 Ga0466970_0328625 3300044765 Bacteria 865
131 Ga0466960_0140858 3300044901 Bacteria 1281
132 Ga0451576_0000621 3300045051 Bacteria 74139
133 Ga0451576_0224642 3300045051 Bacteria 1961
134 Ga0451576_0982937 3300045051 Bacteria 885
135 Ga0466958_0003059 3300045836 Bacteria 8576
136 Ga0495629_0536415 3300046459 Bacteria 786
137 Ga0495651_0038887 3300046462 Bacteria 3704
138 Ga0495580_0204966 3300046472 Bacteria 1358
139 Ga0495594_0348605 3300046499 Bacteria 843
140 Ga0495607_0058529 3300046501 Bacteria 2202
141 Ga0495608_0026571 3300046511 Bacteria 3944
142 Ga0495608_0432952 3300046511 Bacteria 802
143 Ga0495618_0281201 3300046514 Bacteria 1038
144 Ga0495630_0631767 3300046517 Bacteria 820
145 Ga0495630_0904816 3300046517 Bacteria 672
146 Ga0495643_0393415 3300046522 Bacteria 613
147 Ga0495643_0488458 3300046522 Bacteria 531
148 Ga0495652_0331747 3300046529 Bacteria 1096
149 Ga0495654_0000296 3300046530 Bacteria 44716
150 Ga0495665_0013846 3300046531 Bacteria 4357
151 Ga0495640_0287195 3300046533 Bacteria 1024
152 Ga0495587_0011284 3300046536 Bacteria 5663
153 Ga0495645_0455064 3300046543 Bacteria 807
154 Ga0495667_0044350 3300046559 Bacteria 2945
155 Ga0495635_0234842 3300046663 Bacteria 1238
156 Ga0495588_0209464 3300046674 Bacteria 1029
157 Ga0495657_0005365 3300046675 Bacteria 10137
158 Ga0495623_0074755 3300046679 Unclassified 2105
159 Ga0495600_0017567 3300046809 Bacteria 4552
160 Ga0495581_0149647 3300047315 Bacteria 1363
161 Ga0495604_0035023 3300047317 Bacteria 3967
162 Ga0495636_0529814 3300047318 Bacteria 572
163 Ga0495672_0156778 3300047320 Bacteria 1175
164 Ga0495676_0378162 3300047321 Bacteria 943
165 Ga0495680_0001380 3300047322 Bacteria 26245
166 Ga0495680_0128872 3300047322 Bacteria 1861
167 Ga0495675_0327583 3300047444 Bacteria 905
168 Ga0495686_0077522 3300047472 Bacteria 2035
169 Ga0495602_0085331 3300048088 Bacteria 2639
170 Ga0496102_0064595 3300048905 Bacteria 3352
171 Ga0496103_0101999 3300048906 Bacteria 1817
172 Ga0496104_0002199 3300048907 Bacteria 16874
173 Ga0496105_0063017 3300048908 Bacteria 3059
174 Ga0496108_0002321 3300048911 Bacteria 15223
175 Ga0496109_0225332 3300048912 Bacteria 1763
176 Ga0496109_0298698 3300048912 Bacteria 1518
177 Ga0496110_0014796 3300048913 Bacteria 6483
178 Ga0496111_0042428 3300048914 Bacteria 3266
179 Ga0496112_0057332 3300048915 Bacteria 3835
180 Ga0496113_0027721 3300048916 Bacteria 4064
181 Ga0496115_0390776 3300048918 Bacteria 1130
182 Ga0496118_0403038 3300048921 Bacteria 710
183 Ga0496121_0003935 3300048924 Bacteria 20564
184 Ga0496124_0074350 3300048927 Bacteria 2809
185 Ga0496126_0006400 3300048929 Bacteria 13132
186 Ga0496126_0080055 3300048929 Bacteria 2891
187 Ga0496126_0644324 3300048929 Bacteria 830
188 Ga0501031_0016956 3300049568 Bacteria 4732
189 Ga0501031_0099212 3300049568 Bacteria 1901
190 Ga0501032_0345806 3300049569 Bacteria 958
191 Ga0501033_0301858 3300049570 Bacteria 1127
192 Ga0501036_0019322 3300049572 Bacteria 5718
193 Ga0501036_0232874 3300049572 Bacteria 1545
194 Ga0501038_0057153 3300049574 Bacteria 3350
195 Ga0501039_0017401 3300049575 Bacteria 5513
196 Ga0501039_1020102 3300049575 Bacteria 643
197 Ga0501040_0221392 3300049576 Bacteria 1346
198 Ga0501041_0069472 3300049577 Bacteria 2161
199 Ga0501041_0558503 3300049577 Bacteria 730
200 Ga0501042_0013591 3300049578 Bacteria 5542
201 Ga0501043_0108503 3300049579 Bacteria 2180
202 Ga0501046_0297050 3300049580 Bacteria 1180
203 Ga0501048_0141600 3300049582 Bacteria 1700
204 Ga0501048_0574310 3300049582 Bacteria 809
205 Ga0501068_0113722 3300049584 Bacteria 1684
206 Ga0501071_0056407 3300049587 Bacteria 2837
207 Ga0501071_1155754 3300049587 Bacteria 598
208 Ga0501072_0106997 3300049588 Bacteria 2224
209 Ga0501072_0333186 3300049588 Bacteria 1206
210 Ga0501073_0854077 3300049589 Bacteria 627
211 Ga0501074_0008261 3300049590 Bacteria 7546
212 Ga0501074_0050743 3300049590 Bacteria 2995
213 Ga0501075_0066577 3300049591 Bacteria 2718
214 Ga0501075_0074052 3300049591 Bacteria 2576
215 Ga0501076_0009187 3300049592 Bacteria 7288
216 Ga0501076_0096793 3300049592 Bacteria 2377
217 Ga0501076_0190675 3300049592 Bacteria 1673
218 Ga0501076_0697990 3300049592 Bacteria 838
219 Ga0501076_1124447 3300049592 Bacteria 647
220 Ga0501077_0138095 3300049593 Bacteria 1545
221 Ga0501077_0754761 3300049593 Bacteria 625
222 Ga0501079_0048081 3300049741 Bacteria 3291
223 Ga0501080_0063224 3300049742 Bacteria 3445
224 Ga0501080_0068252 3300049742 Bacteria 3307
225 Ga0501080_0268334 3300049742 Bacteria 1554
226 Ga0501081_0111982 3300049743 Bacteria 1937
227 Ga0501081_0138065 3300049743 Bacteria 1746
228 Ga0501081_0314203 3300049743 Bacteria 1151
229 Ga0501081_0534699 3300049743 Unclassified 875
230 Ga0501083_0057977 3300049744 Bacteria 2592
231 Ga0501035_0148517 3300049822 Bacteria 2035
232 Ga0501044_0123468 3300049823 Bacteria 2588
233 Ga0501044_0753090 3300049823 Bacteria 856
234 Ga0501045_0004607 3300049824 Bacteria 9522
235 Ga0501045_0195198 3300049824 Bacteria 1509
236 Ga0501045_0205066 3300049824 Bacteria 1469
237 nmdc:mga06z11_445027_c1 3300050494 Bacteria 782
238 nmdc:mga05p37_893691_c1 3300050507 Bacteria 959
239 nmdc:mga08y16_1171337_c1 3300050511 Bacteria 740
240 nmdc:mga08y16_1328057_c1 3300050511 Bacteria 685
241 nmdc:mga08y16_279_c1 3300050511 Bacteria 46569
242 nmdc:mga0n895_547776_c1 3300050512 Bacteria 1163
243 Ga0495601_0278526 3300053077 Bacteria 1091
244 Ga0495612_0184978 3300053078 Bacteria 916
245 Ga0495655_0005224 3300053083 Bacteria 2281
246 Ga0495595_0011061 3300053084 Bacteria 3766
247 Ga0495595_0142588 3300053084 Bacteria 1176
248 Ga0495619_0129584 3300053085 Bacteria 1733
249 Ga0495619_0199381 3300053085 Bacteria 1385
250 Ga0500618_000222 3300053125 Bacteria 44764
251 Ga0500618_072143 3300053125 Bacteria 774
252 Ga0500627_0109586 3300053158 Bacteria 1242
253 Ga0501084_0060225 3300054114 Bacteria 3178
254 Ga0501084_0139068 3300054114 Bacteria 2044
255 Ga0501084_0352165 3300054114 Bacteria 1244
256 Ga0590074_019005 3300059423 Bacteria 1177
257 Ga0590075_009648 3300059424 Bacteria 2316
258 Ga0590077_130314 3300059426 Bacteria 597
259 Ga0501082_0115784 3300060353 Bacteria 2321
260 Ga0530510_0010250 3300061734 Bacteria 6567
261 Ga0530510_0087215 3300061734 Bacteria 2274
262 2513673907 2513237098 Bacteria 9902361
263 2524468358 2524023210 Bacteria 9029266
264 2599104241 2597490356 Bacteria 7030811
265 2599720191 2599185236 Bacteria 6875203
266 2600373359 2600254933 Bacteria 4750527
267 2819687148 2818991461 Bacteria 7026071
268 2821128585 2821123053 Bacteria 7836056
269 2828308471 2828305725 Bacteria 4916900
270 2838741603 2838736955 Bacteria 5760694
271 2841845563 2841840854 Bacteria 5761912
272 2842145266 2842140634 Bacteria 5759631
273 2842337237 2842333319 Bacteria 8899485
274 2846956553 2846952575 Bacteria 6587527
275 2848862206 2848858292 Bacteria 7391279
276 2854896987 2854896431 Bacteria 5869725
277 2854917136 2854916844 Bacteria 5725939
278 2857534262 2857531043 Bacteria 6754041
279 2903778201 2903768456 Bacteria 9749579
280 Ga0114129_10197126
281 JGI25407J50210_10052900
282 Ga0065707_10145459
283 Ga0070682_100431727
284 Ga0070689_100074420
285 Ga0070669_100000179
286 Ga0070674_100166175
287 Ga0070688_100011942
288 Ga0070667_100547238
289 Ga0070709_10011060
290 Ga0070713_101427871
291 Ga0070711_100539539
292 Ga0070708_100361179
293 Ga0070678_100133617
294 Ga0070678_100346161
295 Ga0070685_10069832
296 Ga0070685_10204635
297 Ga0070706_100789850
298 Ga0070699_100319176
299 Ga0070697_100078971
300 Ga0070695_101304585
301 Ga0070665_100043517
302 Ga0070665_101087585
303 Ga0068855_101882878
304 Ga0068856_100748010
305 Ga0068864_100340624
306 Ga0068861_100126036
307 Ga0068870_10561934
308 Ga0068863_100567946
309 Ga0068860_100684204
310 Ga0068862_100110284
311 Ga0081455_10040942
312 Ga0081455_10049752
313 Ga0081538_10013960
314 Ga0081540_1004883
315 Ga0075432_10081899
316 Ga0075367_10415595
317 Ga0068871_100630440
318 Ga0075430_100497370
319 Ga0075431_100648390
320 Ga0075434_100594754
321 Ga0079104_1000101
322 Ga0075435_100188937
323 Ga0111539_10000041
324 Ga0111539_10598654
325 Ga0111539_12249629
326 Ga0105247_10003784
327 Ga0114129_11116028
328 Ga0105248_10005369
329 Ga0105249_10888270
330 Ga0099796_10012876
331 Ga0157373_10258363
332 Ga0157370_10289017
333 Ga0157369_10001187
334 Ga0163163_10804106
335 Ga0157380_10014539
336 Ga0157380_10257343
337 Ga0157377_10378324
338 Ga0213872_10000652
339 Ga0213872_10006479
340 Ga0213872_10036663
341 Ga0213872_10117973
342 Ga0213872_10191366
343 Ga0213872_10202052
344 Ga0213876_10541577
345 Ga0207699_10384734
346 Ga0207684_10090027
347 Ga0207654_10566584
348 Ga0207693_10097559
349 Ga0207681_10000044
350 Ga0207650_10274136
351 Ga0207700_11675543
352 Ga0207670_10392941
353 Ga0207669_10193825
354 Ga0207704_11124166
355 Ga0207689_10435089
356 Ga0207640_10734838
357 Ga0207658_10225569
358 Ga0207641_10182004
359 Ga0207648_11189978
360 Ga0207683_10300526
361 Ga0207683_10545282
362 Ga0209281_1000028
363 Ga0207428_10038011
364 Ga0207428_10423482
365 Ga0268265_10212011
366 Ga0268265_10577621
367 Ga0268265_10689548
368 Ga0268265_10920957
369 Ga0265337_1005850
370 Ga0265334_10289411
371 Ga0265338_10032686
372 Ga0307408_100229227
373 Ga0265314_10241524
374 Ga0307413_10032229
375 Ga0307410_10094860
376 Ga0307410_10138057
377 Ga0307410_10638806
378 Ga0307407_10053313
379 Ga0307409_100003189
380 Ga0307416_100014520
381 Ga0307416_100080816
382 Ga0307411_10064763
383 Ga0373955_0421439
384 Ga0316574_0224552
385 Ga0316574_0289435
386 Ga0373935_0530906
387 Ga0373927_0148813
388 Ga0373947_0826509
389 Ga0373937_0104404
390 Ga0373937_1369760
391 Ga0316582_1104828
392 Ga0373925_0236856
393 Ga0395905_0284191
394 Ga0436365_0009724
395 Ga0436361_0063866
396 Ga0436361_0258150
397 Ga0436361_0387816
398 Ga0436361_0418263
399 Ga0436361_0535418
400 Ga0436361_0800978
401 Ga0436361_0968855
402 Ga0436361_0992165
403 Ga0436362_0988740
404 Ga0451791_0838974
405 Ga0439432_123275
406 Ga0439440_0015054
407 Ga0453684_0296225
408 Ga0466968_0457952
409 Ga0466970_0328625
410 Ga0466960_0140858
411 Ga0451576_0000621
412 Ga0451576_0224642
413 Ga0451576_0982937
414 Ga0466958_0003059
415 Ga0495629_0536415
416 Ga0495651_0038887
417 Ga0495580_0204966
418 Ga0495594_0348605
419 Ga0495607_0058529
420 Ga0495608_0026571
421 Ga0495608_0432952
422 Ga0495618_0281201
423 Ga0495630_0631767
424 Ga0495630_0904816
425 Ga0495643_0393415
426 Ga0495643_0488458
427 Ga0495652_0331747
428 Ga0495654_0000296
429 Ga0495665_0013846
430 Ga0495640_0287195
431 Ga0495587_0011284
432 Ga0495645_0455064
433 Ga0495667_0044350
434 Ga0495635_0234842
435 Ga0495588_0209464
436 Ga0495657_0005365
437 Ga0495623_0074755
438 Ga0495600_0017567
439 Ga0495581_0149647
440 Ga0495604_0035023
441 Ga0495636_0529814
442 Ga0495672_0156778
443 Ga0495676_0378162
444 Ga0495680_0001380
445 Ga0495680_0128872
446 Ga0495675_0327583
447 Ga0495686_0077522
448 Ga0495602_0085331
449 Ga0496102_0064595
450 Ga0496103_0101999
451 Ga0496104_0002199
452 Ga0496105_0063017
453 Ga0496108_0002321
454 Ga0496109_0225332
455 Ga0496109_0298698
456 Ga0496110_0014796
457 Ga0496111_0042428
458 Ga0496112_0057332
459 Ga0496113_0027721
460 Ga0496115_0390776
461 Ga0496118_0403038
462 Ga0496121_0003935
463 Ga0496124_0074350
464 Ga0496126_0006400
465 Ga0496126_0080055
466 Ga0496126_0644324
467 Ga0501031_0016956
468 Ga0501031_0099212
469 Ga0501032_0345806
470 Ga0501033_0301858
471 Ga0501036_0019322
472 Ga0501036_0232874
473 Ga0501038_0057153
474 Ga0501039_0017401
475 Ga0501039_1020102
476 Ga0501040_0221392
477 Ga0501041_0069472
478 Ga0501041_0558503
479 Ga0501042_0013591
480 Ga0501043_0108503
481 Ga0501046_0297050
482 Ga0501048_0141600
483 Ga0501048_0574310
484 Ga0501068_0113722
485 Ga0501071_0056407
486 Ga0501071_1155754
487 Ga0501072_0106997
488 Ga0501072_0333186
489 Ga0501073_0854077
490 Ga0501074_0008261
491 Ga0501074_0050743
492 Ga0501075_0066577
493 Ga0501075_0074052
494 Ga0501076_0009187
495 Ga0501076_0096793
496 Ga0501076_0190675
497 Ga0501076_0697990
498 Ga0501076_1124447
499 Ga0501077_0138095
500 Ga0501077_0754761
501 Ga0501079_0048081
502 Ga0501080_0063224
503 Ga0501080_0068252
504 Ga0501080_0268334
505 Ga0501081_0111982
506 Ga0501081_0138065
507 Ga0501081_0314203
508 Ga0501081_0534699
509 Ga0501083_0057977
510 Ga0501035_0148517
511 Ga0501044_0123468
512 Ga0501044_0753090
513 Ga0501045_0004607
514 Ga0501045_0195198
515 Ga0501045_0205066
516 nmdc:mga06z11_445027_c1
517 nmdc:mga05p37_893691_c1
518 nmdc:mga08y16_1171337_c1
519 nmdc:mga08y16_1328057_c1
520 nmdc:mga08y16_279_c1
521 nmdc:mga0n895_547776_c1
522 Ga0495601_0278526
523 Ga0495612_0184978
524 Ga0495655_0005224
525 Ga0495595_0011061
526 Ga0495595_0142588
527 Ga0495619_0129584
528 Ga0495619_0199381
529 Ga0500618_000222
530 Ga0500618_072143
531 Ga0500627_0109586
532 Ga0501084_0060225
533 Ga0501084_0139068
534 Ga0501084_0352165
535 Ga0590074_019005
536 Ga0590075_009648
537 Ga0590077_130314
538 Ga0501082_0115784
539 Ga0530510_0010250
540 Ga0530510_0087215
541 2513673907
542 2524468358
543 2599104241
544 2599720191
545 2600373359
546 2819687148
547 2821128585
548 2828308471
549 2838741603
550 2841845563
551 2842145266
552 2842337237
553 2846956553
554 2848862206
555 2854896987
556 2854917136
557 2857534262
558 2903778201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06172

Cupin_5

Cupin superfamily (DUF985)

24

153

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.9614 14 153
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.948 14 153
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9426 14 146
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8823 33 136
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.8715 17 147
ID Description Score Start End Superfamily
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9581 15 153 2.60.120.10
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9446 15 153 2.60.120.10
af_Q8GYZ3_2_189_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9287 14 147 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8967 50 134 2.60.120.10
3m3iG01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8944 14 144 2.60.120.10
ID Description Score Start End GO Terms
AF-G8ANV9-F1-model_v4 deleted 0.9901 15 152
AF-A0A060DMD9-F1-model_v4 Cupin 0.9893 14 152
AF-A0A1X6ZYL2-F1-model_v4 DUF985 domain-containing protein 0.989 14 152
AF-A0A2M7YBY5-F1-model_v4 Cupin 0.9877 57 152
AF-A4EKI0-F1-model_v4 DUF985 domain-containing protein 0.9861 13 151

Map