F382953

General Info

Members Datasets Scaffolds Average Seq Length
279 164 558 299

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10143786|Ga0081539_101437862
Length 314
Sequence MAEPDALTRGVQLHLVDATYELFRAHYAPRPPVLGRDGVVLSGVSGLVDQLLFLLREQGATHVGCATDRVIESFRNDLFPGYKSSVGMPRDLLAQFPIAEAAVEALGVTLWPMVEWEADDAIAAAAVRFAEDPRVERILVCTPDKDMAQLVRDERIVLWDRRRDLTYDDAGVRAKWGVPPESIPDYLAVVGDSSDGYPGIPGWGAKGAAAVLAKYGHLEDVPERASAWEVPGVTGGRAMTLAASLRDHMDEAFLYRDLARLRTAEDGVKIRQIDPDELRWDGAPRAEWEAFCEEWGLDRLRGRPHKWLKEASSA

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.47
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10143786 3300005985 Bacteria 1156
2 rootH1_10035842 3300003316 Unclassified 1950
3 Ga0070683_100049836 3300005329 Bacteria 3874
4 Ga0070683_100122054 3300005329 Bacteria 2462
5 Ga0070690_100007482 3300005330 Bacteria 6256
6 Ga0070690_100143581 3300005330 Bacteria 1622
7 Ga0070670_100108687 3300005331 Bacteria 2390
8 Ga0068869_100180466 3300005334 Bacteria 1655
9 Ga0070682_100069637 3300005337 Bacteria 2247
10 Ga0070689_100025566 3300005340 Bacteria 4437
11 Ga0070669_100205739 3300005353 Bacteria 1551
12 Ga0070688_100027593 3300005365 Bacteria 3382
13 Ga0070659_100023481 3300005366 Bacteria 4719
14 Ga0070659_100096575 3300005366 Bacteria 2374
15 Ga0070703_10004740 3300005406 Bacteria 3803
16 Ga0070701_10044130 3300005438 Bacteria 2283
17 Ga0070700_100015273 3300005441 Bacteria 4352
18 Ga0070694_100018215 3300005444 Bacteria 4456
19 Ga0070694_100030704 3300005444 Bacteria 3517
20 Ga0070708_100013772 3300005445 Bacteria 6636
21 Ga0070708_100072511 3300005445 Bacteria 3103
22 Ga0070708_100146449 3300005445 Bacteria 2194
23 Ga0070708_100291303 3300005445 Bacteria 1537
24 Ga0070663_100085800 3300005455 Bacteria 2324
25 Ga0070678_100166303 3300005456 Bacteria 1792
26 Ga0068867_100096806 3300005459 Bacteria 2248
27 Ga0070706_100001154 3300005467 Bacteria 28412
28 Ga0070706_100024515 3300005467 Bacteria 5554
29 Ga0070706_100041774 3300005467 Bacteria 4234
30 Ga0070707_100001873 3300005468 Bacteria 20212
31 Ga0070707_100017857 3300005468 Bacteria 6670
32 Ga0070707_100063259 3300005468 Bacteria 3551
33 Ga0070707_100092348 3300005468 Bacteria 2931
34 Ga0070698_100122675 3300005471 Bacteria 2557
35 Ga0070699_100006777 3300005518 Bacteria 9966
36 Ga0070679_100134862 3300005530 Bacteria 2450
37 Ga0070684_100183879 3300005535 Bacteria 1900
38 Ga0070697_100012315 3300005536 Bacteria 6700
39 Ga0070697_100030997 3300005536 Bacteria 4298
40 Ga0070697_100233090 3300005536 Bacteria 1571
41 Ga0070695_100035984 3300005545 Bacteria 3114
42 Ga0070695_100048737 3300005545 Bacteria 2710
43 Ga0070696_100026303 3300005546 Bacteria 3959
44 Ga0070693_100012747 3300005547 Bacteria 4262
45 Ga0070704_100015692 3300005549 Bacteria 4767
46 Ga0070704_100022792 3300005549 Bacteria 4079
47 Ga0070704_100284716 3300005549 Bacteria 1371
48 Ga0070704_100514668 3300005549 Bacteria 1041
49 Ga0068855_100092263 3300005563 Bacteria 3493
50 Ga0070664_100124884 3300005564 Bacteria 2256
51 Ga0068854_100036818 3300005578 Bacteria 3431
52 Ga0068856_100268459 3300005614 Bacteria 1722
53 Ga0068859_100035441 3300005617 Bacteria 5007
54 Ga0068859_100266265 3300005617 Bacteria 1806
55 Ga0068859_100335231 3300005617 Bacteria 1607
56 Ga0068870_10239725 3300005840 Bacteria 1119
57 Ga0068858_100070626 3300005842 Bacteria 3237
58 Ga0068860_100062680 3300005843 Bacteria 3533
59 Ga0081539_10006252 3300005985 Bacteria 11531
60 Ga0075431_100329206 3300006847 Bacteria 1539
61 Ga0075433_10177526 3300006852 Bacteria 1895
62 Ga0075433_10278435 3300006852 Bacteria 1482
63 Ga0075434_100008751 3300006871 Bacteria 9418
64 Ga0068865_100020262 3300006881 Bacteria 4313
65 Ga0097620_100035443 3300006931 Bacteria 5007
66 Ga0097620_100266273 3300006931 Bacteria 1806
67 Ga0097620_100335208 3300006931 Bacteria 1607
68 Ga0097620_100496529 3300006931 Bacteria 1315
69 Ga0075435_100027264 3300007076 Bacteria 4466
70 Ga0105240_10359193 3300009093 Bacteria 1650
71 Ga0111539_10047026 3300009094 Bacteria 5159
72 Ga0111539_10286046 3300009094 Unclassified 1918
73 Ga0105245_10050231 3300009098 Bacteria 3736
74 Ga0105245_10379156 3300009098 Bacteria 1408
75 Ga0105245_10401849 3300009098 Bacteria 1369
76 Ga0114129_10368294 3300009147 Bacteria 1900
77 Ga0105243_10171024 3300009148 Bacteria 1882
78 Ga0105242_10435146 3300009176 Unclassified 1233
79 Ga0105248_10123939 3300009177 Bacteria 2915
80 Ga0105248_10527229 3300009177 Unclassified 1332
81 Ga0105238_10061862 3300009551 Bacteria 3745
82 Ga0105249_10054685 3300009553 Bacteria 3651
83 Ga0105249_10235757 3300009553 Bacteria 1807
84 Ga0105239_10009632 3300010375 Bacteria 10863
85 Ga0157378_10167794 3300013297 Bacteria 2057
86 Ga0157375_10018684 3300013308 Bacteria 6291
87 Ga0163163_10094763 3300014325 Bacteria 3004
88 Ga0163163_10410501 3300014325 Bacteria 1413
89 Ga0157380_10105146 3300014326 Bacteria 2359
90 Ga0157380_10199386 3300014326 Bacteria 1774
91 Ga0157380_10583346 3300014326 Bacteria 1103
92 Ga0157377_10113670 3300014745 Bacteria 1631
93 Ga0157379_10196398 3300014968 Bacteria 1824
94 Ga0157376_10401155 3300014969 Bacteria 1326
95 Ga0157376_10407241 3300014969 Bacteria 1317
96 Ga0163161_10072720 3300017792 Bacteria 2518
97 Ga0163161_10108279 3300017792 Bacteria 2075
98 Ga0207653_10003743 3300025885 Bacteria 4786
99 Ga0207688_10004689 3300025901 Bacteria 7452
100 Ga0207643_10034277 3300025908 Bacteria 2845
101 Ga0207684_10000313 3300025910 Bacteria 68960
102 Ga0207684_10004459 3300025910 Bacteria 13177
103 Ga0207684_10044195 3300025910 Bacteria 3777
104 Ga0207684_10107754 3300025910 Bacteria 2384
105 Ga0207646_10004661 3300025922 Bacteria 14790
106 Ga0207646_10021534 3300025922 Bacteria 5956
107 Ga0207646_10046944 3300025922 Bacteria 3875
108 Ga0207646_10093570 3300025922 Bacteria 2691
109 Ga0207681_10104875 3300025923 Bacteria 2046
110 Ga0207694_10198416 3300025924 Bacteria 1632
111 Ga0207659_10317858 3300025926 Bacteria 1284
112 Ga0207687_10148972 3300025927 Bacteria 1783
113 Ga0207690_10130797 3300025932 Bacteria 1837
114 Ga0207706_10016648 3300025933 Bacteria 6635
115 Ga0207670_10036994 3300025936 Bacteria 3179
116 Ga0207669_10097854 3300025937 Bacteria 1931
117 Ga0207689_10021107 3300025942 Bacteria 5474
118 Ga0207689_10211777 3300025942 Bacteria 1601
119 Ga0207661_10106411 3300025944 Bacteria 2365
120 Ga0207661_10131091 3300025944 Bacteria 2147
121 Ga0207679_10248963 3300025945 Bacteria 1510
122 Ga0207712_10042355 3300025961 Bacteria 3134
123 Ga0207712_10057651 3300025961 Bacteria 2741
124 Ga0207668_10029677 3300025972 Bacteria 3587
125 Ga0207703_10053745 3300026035 Bacteria 3274
126 Ga0207703_10502850 3300026035 Unclassified 1138
127 Ga0207678_10059439 3300026067 Bacteria 3289
128 Ga0207708_10010506 3300026075 Bacteria 6871
129 Ga0207648_10009025 3300026089 Bacteria 9590
130 Ga0207675_100050453 3300026118 Bacteria 3882
131 Ga0207683_10033257 3300026121 Bacteria 4479
132 Ga0209974_10013523 3300027876 Unclassified 2719
133 Ga0209974_10017873 3300027876 Unclassified 2352
134 Ga0265319_1005690 3300028563 Bacteria 5919
135 Ga0265319_1035165 3300028563 Bacteria 1720
136 Ga0265334_10021562 3300028573 Bacteria 2631
137 Ga0265334_10050826 3300028573 Bacteria 1591
138 Ga0265318_10005426 3300028577 Bacteria 5987
139 Ga0265318_10017841 3300028577 Bacteria 2906
140 Ga0265336_10061235 3300028666 Bacteria 1129
141 Ga0265338_10101587 3300028800 Bacteria 2341
142 Ga0265324_10029910 3300029957 Bacteria 1914
143 Ga0265332_10029484 3300031238 Bacteria 2399
144 Ga0265320_10014957 3300031240 Bacteria 4399
145 Ga0265325_10071647 3300031241 Bacteria 1739
146 Ga0265340_10004838 3300031247 Bacteria 7487
147 Ga0265339_10093311 3300031249 Archaea 1575
148 Ga0265316_10169740 3300031344 Unclassified 1628
149 Ga0307408_100216243 3300031548 Bacteria 1561
150 Ga0265314_10065940 3300031711 Bacteria 2443
151 Ga0307410_10100232 3300031852 Bacteria 2075
152 Ga0307406_10010723 3300031901 Bacteria 5178
153 Ga0307407_10258973 3300031903 Unclassified 1196
154 Ga0307412_10256413 3300031911 Bacteria 1361
155 Ga0307409_100009231 3300031995 Bacteria 6047
156 Ga0307415_100491704 3300032126 Bacteria 1070
157 Ga0316574_0002330 3300035398 Bacteria 9479
158 Ga0395898_0491857 3300037466 Bacteria 1167
159 Ga0395901_0110856 3300038443 Bacteria 2882
160 Ga0439465_0043118 3300041413 Bacteria 1464
161 Ga0451802_0882930 3300041460 Bacteria 958
162 Ga0451807_1772408 3300041486 Bacteria 1016
163 Ga0450920_034746 3300042122 Bacteria 998
164 Ga0495603_0064372 3300046455 Bacteria 2162
165 Ga0495651_0034539 3300046462 Bacteria 3941
166 Ga0495628_0128860 3300046516 Bacteria 1937
167 Ga0495658_0287756 3300046683 Bacteria 1038
168 Ga0495613_0272491 3300046689 Bacteria 1177
169 Ga0495602_0240997 3300048088 Bacteria 1353
170 Ga0496102_0022712 3300048905 Bacteria 5560
171 Ga0496103_0055985 3300048906 Bacteria 2447
172 Ga0496104_0021479 3300048907 Bacteria 5926
173 Ga0496104_0135548 3300048907 Bacteria 2365
174 Ga0496104_0180599 3300048907 Bacteria 2021
175 Ga0496105_0025542 3300048908 Bacteria 4809
176 Ga0496105_0129854 3300048908 Bacteria 2077
177 Ga0496105_0293792 3300048908 Unclassified 1308
178 Ga0496106_0374040 3300048909 Bacteria 1145
179 Ga0496106_0408943 3300048909 Bacteria 1091
180 Ga0496108_0081663 3300048911 Bacteria 2739
181 Ga0496108_0083510 3300048911 Bacteria 2709
182 Ga0496108_0135454 3300048911 Bacteria 2119
183 Ga0496109_0010860 3300048912 Bacteria 7795
184 Ga0496109_0692329 3300048912 Bacteria 957
185 Ga0496110_0029065 3300048913 Bacteria 4753
186 Ga0496110_0035278 3300048913 Bacteria 4339
187 Ga0496110_0051842 3300048913 Bacteria 3606
188 Ga0496111_0072969 3300048914 Bacteria 2499
189 Ga0496111_0139172 3300048914 Bacteria 1798
190 Ga0496112_0010792 3300048915 Bacteria 8309
191 Ga0496112_0167120 3300048915 Bacteria 2166
192 Ga0496112_0320853 3300048915 Bacteria 1493
193 Ga0496112_0463420 3300048915 Bacteria 1205
194 Ga0496112_0635232 3300048915 Bacteria 998
195 Ga0496113_0017442 3300048916 Bacteria 4984
196 Ga0496113_0034084 3300048916 Bacteria 3712
197 Ga0496113_0153811 3300048916 Bacteria 1816
198 Ga0496114_0009228 3300048917 Bacteria 7821
199 Ga0496114_0091890 3300048917 Bacteria 2578
200 Ga0501031_0013636 3300049568 Bacteria 5297
201 Ga0501031_0037916 3300049568 Bacteria 3146
202 Ga0501036_0200425 3300049572 Bacteria 1679
203 Ga0501036_0358443 3300049572 Bacteria 1218
204 Ga0501039_0014638 3300049575 Bacteria 6004
205 Ga0501039_0199679 3300049575 Bacteria 1572
206 Ga0501039_0225853 3300049575 Unclassified 1472
207 Ga0501039_0360937 3300049575 Bacteria 1141
208 Ga0501040_0048111 3300049576 Bacteria 2914
209 Ga0501040_0048855 3300049576 Bacteria 2892
210 Ga0501041_0021035 3300049577 Bacteria 3908
211 Ga0501041_0033798 3300049577 Bacteria 3095
212 Ga0501042_0112754 3300049578 Bacteria 1958
213 Ga0501042_0361298 3300049578 Unclassified 1051
214 Ga0501046_0336791 3300049580 Unclassified 1097
215 Ga0501048_0040224 3300049582 Bacteria 3351
216 Ga0501048_0137866 3300049582 Bacteria 1724
217 Ga0501048_0156273 3300049582 Unclassified 1613
218 Ga0501048_0164428 3300049582 Bacteria 1571
219 Ga0501067_0005341 3300049583 Bacteria 7136
220 Ga0501067_0024955 3300049583 Bacteria 3315
221 Ga0501067_0032480 3300049583 Bacteria 2897
222 Ga0501068_0065431 3300049584 Bacteria 2213
223 Ga0501068_0137024 3300049584 Bacteria 1533
224 Ga0501069_0018454 3300049585 Bacteria 3764
225 Ga0501071_0005486 3300049587 Bacteria 8162
226 Ga0501071_0091768 3300049587 Bacteria 2231
227 Ga0501071_0244991 3300049587 Unclassified 1352
228 Ga0501072_0114054 3300049588 Unclassified 2152
229 Ga0501072_0132783 3300049588 Unclassified 1985
230 Ga0501072_0244927 3300049588 Unclassified 1428
231 Ga0501074_0084636 3300049590 Bacteria 2273
232 Ga0501074_0318713 3300049590 Bacteria 1104
233 Ga0501075_0023638 3300049591 Bacteria 4502
234 Ga0501075_0031229 3300049591 Bacteria 3952
235 Ga0501075_0120851 3300049591 Unclassified 1994
236 Ga0501075_0443728 3300049591 Bacteria 990
237 Ga0501075_0529607 3300049591 Bacteria 899
238 Ga0501076_0016069 3300049592 Bacteria 5668
239 Ga0501076_0046697 3300049592 Bacteria 3422
240 Ga0501076_0222919 3300049592 Unclassified 1541
241 Ga0501076_0247551 3300049592 Bacteria 1458
242 Ga0501077_0012208 3300049593 Bacteria 5378
243 Ga0501077_0103275 3300049593 Unclassified 1806
244 Ga0501077_0115651 3300049593 Bacteria 1700
245 Ga0501079_0084316 3300049741 Bacteria 2458
246 Ga0501079_0135996 3300049741 Bacteria 1914
247 Ga0501079_0224842 3300049741 Unclassified 1466
248 Ga0501079_0226520 3300049741 Unclassified 1460
249 Ga0501080_0212476 3300049742 Bacteria 1773
250 Ga0501080_0389400 3300049742 Unclassified 1255
251 Ga0501081_0142475 3300049743 Bacteria 1718
252 Ga0501081_0154319 3300049743 Unclassified 1651
253 Ga0501083_0224007 3300049744 Bacteria 1225
254 Ga0501045_0097646 3300049824 Bacteria 2173
255 Ga0501045_0141677 3300049824 Bacteria 1788
256 nmdc:mga05p37_396121_c1 3300050507 Bacteria 1613
257 nmdc:mga08y16_106250_c1 3300050511 Bacteria 2922
258 nmdc:mga08y16_263876_c1 3300050511 Unclassified 1778
259 nmdc:mga08y16_381748_c1 3300050511 Bacteria 1444
260 nmdc:mga08y16_660474_c1 3300050511 Bacteria 1049
261 nmdc:mga0n895_313973_c1 3300050512 Unclassified 1588
262 nmdc:mga0n895_86834_c1 3300050512 Bacteria 3125
263 nmdc:mga0rr50_102294_c1 3300050513 Bacteria 2253
264 Ga0495601_0057042 3300053077 Bacteria 2474
265 Ga0495612_0055083 3300053078 Bacteria 1639
266 Ga0501084_0025767 3300054114 Bacteria 4904
267 Ga0501084_0039246 3300054114 Bacteria 3960
268 Ga0501084_0077102 3300054114 Bacteria 2794
269 Ga0501084_0253531 3300054114 Bacteria 1485
270 Ga0501084_0370053 3300054114 Unclassified 1211
271 Ga0590071_002332 3300059421 Bacteria 4795
272 Ga0501082_0024959 3300060353 Bacteria 5150
273 Ga0501082_0192398 3300060353 Unclassified 1774
274 Ga0501082_0478836 3300060353 Unclassified 1088
275 Ga0530510_0014781 3300061734 Bacteria 5511
276 Ga0530510_0055221 3300061734 Bacteria 2869
277 Ga0530510_0135087 3300061734 Bacteria 1816
278 Ga0530510_0213847 3300061734 Unclassified 1432
279 Ga0530510_0259997 3300061734 Bacteria 1294
280 Ga0081539_10143786
281 rootH1_10035842
282 Ga0070683_100049836
283 Ga0070683_100122054
284 Ga0070690_100007482
285 Ga0070690_100143581
286 Ga0070670_100108687
287 Ga0068869_100180466
288 Ga0070682_100069637
289 Ga0070689_100025566
290 Ga0070669_100205739
291 Ga0070688_100027593
292 Ga0070659_100023481
293 Ga0070659_100096575
294 Ga0070703_10004740
295 Ga0070701_10044130
296 Ga0070700_100015273
297 Ga0070694_100018215
298 Ga0070694_100030704
299 Ga0070708_100013772
300 Ga0070708_100072511
301 Ga0070708_100146449
302 Ga0070708_100291303
303 Ga0070663_100085800
304 Ga0070678_100166303
305 Ga0068867_100096806
306 Ga0070706_100001154
307 Ga0070706_100024515
308 Ga0070706_100041774
309 Ga0070707_100001873
310 Ga0070707_100017857
311 Ga0070707_100063259
312 Ga0070707_100092348
313 Ga0070698_100122675
314 Ga0070699_100006777
315 Ga0070679_100134862
316 Ga0070684_100183879
317 Ga0070697_100012315
318 Ga0070697_100030997
319 Ga0070697_100233090
320 Ga0070695_100035984
321 Ga0070695_100048737
322 Ga0070696_100026303
323 Ga0070693_100012747
324 Ga0070704_100015692
325 Ga0070704_100022792
326 Ga0070704_100284716
327 Ga0070704_100514668
328 Ga0068855_100092263
329 Ga0070664_100124884
330 Ga0068854_100036818
331 Ga0068856_100268459
332 Ga0068859_100035441
333 Ga0068859_100266265
334 Ga0068859_100335231
335 Ga0068870_10239725
336 Ga0068858_100070626
337 Ga0068860_100062680
338 Ga0081539_10006252
339 Ga0075431_100329206
340 Ga0075433_10177526
341 Ga0075433_10278435
342 Ga0075434_100008751
343 Ga0068865_100020262
344 Ga0097620_100035443
345 Ga0097620_100266273
346 Ga0097620_100335208
347 Ga0097620_100496529
348 Ga0075435_100027264
349 Ga0105240_10359193
350 Ga0111539_10047026
351 Ga0111539_10286046
352 Ga0105245_10050231
353 Ga0105245_10379156
354 Ga0105245_10401849
355 Ga0114129_10368294
356 Ga0105243_10171024
357 Ga0105242_10435146
358 Ga0105248_10123939
359 Ga0105248_10527229
360 Ga0105238_10061862
361 Ga0105249_10054685
362 Ga0105249_10235757
363 Ga0105239_10009632
364 Ga0157378_10167794
365 Ga0157375_10018684
366 Ga0163163_10094763
367 Ga0163163_10410501
368 Ga0157380_10105146
369 Ga0157380_10199386
370 Ga0157380_10583346
371 Ga0157377_10113670
372 Ga0157379_10196398
373 Ga0157376_10401155
374 Ga0157376_10407241
375 Ga0163161_10072720
376 Ga0163161_10108279
377 Ga0207653_10003743
378 Ga0207688_10004689
379 Ga0207643_10034277
380 Ga0207684_10000313
381 Ga0207684_10004459
382 Ga0207684_10044195
383 Ga0207684_10107754
384 Ga0207646_10004661
385 Ga0207646_10021534
386 Ga0207646_10046944
387 Ga0207646_10093570
388 Ga0207681_10104875
389 Ga0207694_10198416
390 Ga0207659_10317858
391 Ga0207687_10148972
392 Ga0207690_10130797
393 Ga0207706_10016648
394 Ga0207670_10036994
395 Ga0207669_10097854
396 Ga0207689_10021107
397 Ga0207689_10211777
398 Ga0207661_10106411
399 Ga0207661_10131091
400 Ga0207679_10248963
401 Ga0207712_10042355
402 Ga0207712_10057651
403 Ga0207668_10029677
404 Ga0207703_10053745
405 Ga0207703_10502850
406 Ga0207678_10059439
407 Ga0207708_10010506
408 Ga0207648_10009025
409 Ga0207675_100050453
410 Ga0207683_10033257
411 Ga0209974_10013523
412 Ga0209974_10017873
413 Ga0265319_1005690
414 Ga0265319_1035165
415 Ga0265334_10021562
416 Ga0265334_10050826
417 Ga0265318_10005426
418 Ga0265318_10017841
419 Ga0265336_10061235
420 Ga0265338_10101587
421 Ga0265324_10029910
422 Ga0265332_10029484
423 Ga0265320_10014957
424 Ga0265325_10071647
425 Ga0265340_10004838
426 Ga0265339_10093311
427 Ga0265316_10169740
428 Ga0307408_100216243
429 Ga0265314_10065940
430 Ga0307410_10100232
431 Ga0307406_10010723
432 Ga0307407_10258973
433 Ga0307412_10256413
434 Ga0307409_100009231
435 Ga0307415_100491704
436 Ga0316574_0002330
437 Ga0395898_0491857
438 Ga0395901_0110856
439 Ga0439465_0043118
440 Ga0451802_0882930
441 Ga0451807_1772408
442 Ga0450920_034746
443 Ga0495603_0064372
444 Ga0495651_0034539
445 Ga0495628_0128860
446 Ga0495658_0287756
447 Ga0495613_0272491
448 Ga0495602_0240997
449 Ga0496102_0022712
450 Ga0496103_0055985
451 Ga0496104_0021479
452 Ga0496104_0135548
453 Ga0496104_0180599
454 Ga0496105_0025542
455 Ga0496105_0129854
456 Ga0496105_0293792
457 Ga0496106_0374040
458 Ga0496106_0408943
459 Ga0496108_0081663
460 Ga0496108_0083510
461 Ga0496108_0135454
462 Ga0496109_0010860
463 Ga0496109_0692329
464 Ga0496110_0029065
465 Ga0496110_0035278
466 Ga0496110_0051842
467 Ga0496111_0072969
468 Ga0496111_0139172
469 Ga0496112_0010792
470 Ga0496112_0167120
471 Ga0496112_0320853
472 Ga0496112_0463420
473 Ga0496112_0635232
474 Ga0496113_0017442
475 Ga0496113_0034084
476 Ga0496113_0153811
477 Ga0496114_0009228
478 Ga0496114_0091890
479 Ga0501031_0013636
480 Ga0501031_0037916
481 Ga0501036_0200425
482 Ga0501036_0358443
483 Ga0501039_0014638
484 Ga0501039_0199679
485 Ga0501039_0225853
486 Ga0501039_0360937
487 Ga0501040_0048111
488 Ga0501040_0048855
489 Ga0501041_0021035
490 Ga0501041_0033798
491 Ga0501042_0112754
492 Ga0501042_0361298
493 Ga0501046_0336791
494 Ga0501048_0040224
495 Ga0501048_0137866
496 Ga0501048_0156273
497 Ga0501048_0164428
498 Ga0501067_0005341
499 Ga0501067_0024955
500 Ga0501067_0032480
501 Ga0501068_0065431
502 Ga0501068_0137024
503 Ga0501069_0018454
504 Ga0501071_0005486
505 Ga0501071_0091768
506 Ga0501071_0244991
507 Ga0501072_0114054
508 Ga0501072_0132783
509 Ga0501072_0244927
510 Ga0501074_0084636
511 Ga0501074_0318713
512 Ga0501075_0023638
513 Ga0501075_0031229
514 Ga0501075_0120851
515 Ga0501075_0443728
516 Ga0501075_0529607
517 Ga0501076_0016069
518 Ga0501076_0046697
519 Ga0501076_0222919
520 Ga0501076_0247551
521 Ga0501077_0012208
522 Ga0501077_0103275
523 Ga0501077_0115651
524 Ga0501079_0084316
525 Ga0501079_0135996
526 Ga0501079_0224842
527 Ga0501079_0226520
528 Ga0501080_0212476
529 Ga0501080_0389400
530 Ga0501081_0142475
531 Ga0501081_0154319
532 Ga0501083_0224007
533 Ga0501045_0097646
534 Ga0501045_0141677
535 nmdc:mga05p37_396121_c1
536 nmdc:mga08y16_106250_c1
537 nmdc:mga08y16_263876_c1
538 nmdc:mga08y16_381748_c1
539 nmdc:mga08y16_660474_c1
540 nmdc:mga0n895_313973_c1
541 nmdc:mga0n895_86834_c1
542 nmdc:mga0rr50_102294_c1
543 Ga0495601_0057042
544 Ga0495612_0055083
545 Ga0501084_0025767
546 Ga0501084_0039246
547 Ga0501084_0077102
548 Ga0501084_0253531
549 Ga0501084_0370053
550 Ga0590071_002332
551 Ga0501082_0024959
552 Ga0501082_0192398
553 Ga0501082_0478836
554 Ga0530510_0014781
555 Ga0530510_0055221
556 Ga0530510_0135087
557 Ga0530510_0213847
558 Ga0530510_0259997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

12

177

0.92

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

178

284

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8715 1 268
3zdb-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, di-magnesium and potassium 0.8702 1 269
3zde-assembly1.cif.gz_A potassium free structure of e. coli exoix 0.8688 1 269
3zda-assembly1.cif.gz_A structure of e. coli exoix in complex with a fragment of the flap1 dna oligonucleotide, potassium and magnesium 0.8647 1 269
3zdd-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov6 oligonucleotide and potassium 0.8635 1 269
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8943 3 169 3.40.50.1010
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8551 3 169 3.40.50.1010
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8551 2 167 3.40.50.1010
af_A8MQG8_313_403_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8546 172 251 1.10.150.20
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8472 2 167 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A535W1F0-F1-model_v4 Flap endonuclease 0.9871 1 297 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A535W1F0-F1-model_v4 Flap endonuclease 0.9805 1 297 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A537H256-F1-model_v4 Flap endonuclease 0.9779 1 174 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A2E7SA55-F1-model_v4 Flap endonuclease 0.9746 1 297 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A537H256-F1-model_v4 Flap endonuclease 0.9723 1 174 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map