F382899

General Info

Members Datasets Scaffolds Average Seq Length
279 149 279 139

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10018723|Ga0070681_100187234
Length 169
Sequence MGSPIRIAGFDHIVLRVRDKTAMLGFYTGVLGLAVDRDRPELGLTHIRAGAQMIDLVTLDGPLGRMGGAAPGAEGRNLDHFALQVRPFDEPAIRAHLAAHGVTVVEEGQRYGADGEGFSLYVRDPEGNTVELKGPPAQSARMMPRKSSAFSEAPPCRISAALPGFTEPP

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 5.02
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02GAEPV 2088090001 Bacteria 521
2 JGI25153J46596_10030800 3300003215 Bacteria 1819
3 Ga0055530_10000685 3300003791 Bacteria 28722
4 Ga0055531_10004322 3300003794 Bacteria 8702
5 Ga0055531_10009816 3300003794 Bacteria 4850
6 Ga0065165_1000552 3300005262 Bacteria 56291
7 Ga0070658_10079234 3300005327 Bacteria 2697
8 Ga0070658_10309145 3300005327 Bacteria 1348
9 Ga0070676_11096888 3300005328 Bacteria 601
10 Ga0070670_100126315 3300005331 Bacteria 2208
11 Ga0070666_10924407 3300005335 Bacteria 645
12 Ga0070680_100025744 3300005336 Bacteria 4703
13 Ga0070680_100028910 3300005336 Bacteria 4449
14 Ga0070680_100049128 3300005336 Bacteria 3439
15 Ga0070680_100437959 3300005336 Bacteria 1116
16 Ga0070660_100264961 3300005339 Bacteria 1404
17 Ga0070660_100347043 3300005339 Bacteria 1222
18 Ga0070689_100027077 3300005340 Bacteria 4320
19 Ga0070691_10011443 3300005341 Bacteria 4052
20 Ga0070671_100196899 3300005355 Bacteria 1708
21 Ga0070671_100197055 3300005355 Bacteria 1707
22 Ga0070671_100247995 3300005355 Bacteria 1512
23 Ga0070671_101024838 3300005355 Bacteria 724
24 Ga0070674_100602977 3300005356 Bacteria 928
25 Ga0070673_100188644 3300005364 Bacteria 1769
26 Ga0070659_100000206 3300005366 Bacteria 45867
27 Ga0070659_102167774 3300005366 Bacteria 500
28 Ga0070678_100069717 3300005456 Bacteria 2626
29 Ga0070681_10017736 3300005458 Bacteria 7114
30 Ga0070681_10018723 3300005458 Bacteria 6929
31 Ga0070681_10079994 3300005458 Bacteria 3224
32 Ga0070681_11138154 3300005458 Bacteria 702
33 Ga0070681_11189415 3300005458 Bacteria 684
34 Ga0070679_100003462 3300005530 Bacteria 14454
35 Ga0070679_100542200 3300005530 Bacteria 1107
36 Ga0070679_100555423 3300005530 Bacteria 1092
37 Ga0070679_100800561 3300005530 Bacteria 886
38 Ga0068853_100040630 3300005539 Bacteria 3969
39 Ga0068853_100446942 3300005539 Bacteria 1215
40 Ga0068853_100717178 3300005539 Bacteria 954
41 Ga0068853_101225434 3300005539 Bacteria 725
42 Ga0070696_100042794 3300005546 Bacteria 3131
43 Ga0070665_100000116 3300005548 Bacteria 150141
44 Ga0070665_100206491 3300005548 Bacteria 1965
45 Ga0068855_100037556 3300005563 Bacteria 5759
46 Ga0068855_100048334 3300005563 Bacteria 5021
47 Ga0068855_100051066 3300005563 Bacteria 4871
48 Ga0068855_100206321 3300005563 Bacteria 2211
49 Ga0068855_100389105 3300005563 Bacteria 1530
50 Ga0068855_100523597 3300005563 Bacteria 1286
51 Ga0068855_100734336 3300005563 Bacteria 1054
52 Ga0068857_100037853 3300005577 Bacteria 4274
53 Ga0068854_100454119 3300005578 Bacteria 1071
54 Ga0068856_100494403 3300005614 Bacteria 1244
55 Ga0068856_100560747 3300005614 Bacteria 1163
56 Ga0068852_100128448 3300005616 Bacteria 2331
57 Ga0068852_102252517 3300005616 Bacteria 566
58 Ga0068859_102096805 3300005617 Bacteria 624
59 Ga0068864_100003980 3300005618 Bacteria 12167
60 Ga0068864_100422013 3300005618 Bacteria 1271
61 Ga0068864_100773247 3300005618 Bacteria 942
62 Ga0068864_102593037 3300005618 Bacteria 513
63 Ga0068863_100222349 3300005841 Bacteria 1819
64 Ga0068863_100437712 3300005841 Bacteria 1282
65 Ga0068863_100484981 3300005841 Bacteria 1216
66 Ga0068863_101810170 3300005841 Bacteria 620
67 Ga0068858_100000031 3300005842 Bacteria 143397
68 Ga0068862_100007701 3300005844 Bacteria 8910
69 Ga0068862_100057656 3300005844 Bacteria 3331
70 Ga0070717_10393251 3300006028 Bacteria 1244
71 Ga0075362_10125493 3300006177 Bacteria 1217
72 Ga0068871_100946748 3300006358 Bacteria 800
73 Ga0068871_101427262 3300006358 Bacteria 653
74 Ga0068865_100005340 3300006881 Bacteria 7781
75 Ga0097620_102097632 3300006931 Bacteria 624
76 Ga0105240_10146575 3300009093 Bacteria 2816
77 Ga0105240_10241070 3300009093 Bacteria 2096
78 Ga0105240_10397932 3300009093 Unclassified 1552
79 Ga0105240_10721440 3300009093 Bacteria 1086
80 Ga0105240_10910921 3300009093 Bacteria 945
81 Ga0105243_11026257 3300009148 Bacteria 829
82 Ga0105241_10533441 3300009174 Bacteria 1051
83 Ga0105248_10263980 3300009177 Bacteria 1938
84 Ga0105248_11239067 3300009177 Bacteria 844
85 Ga0105248_12109504 3300009177 Bacteria 641
86 Ga0105248_12113753 3300009177 Bacteria 640
87 Ga0105248_12122079 3300009177 Bacteria 639
88 Ga0105237_10083404 3300009545 Bacteria 3188
89 Ga0105237_10624912 3300009545 Bacteria 1084
90 Ga0105237_11498539 3300009545 Bacteria 681
91 Ga0105238_10060437 3300009551 Bacteria 3794
92 Ga0105238_10246863 3300009551 Bacteria 1763
93 Ga0105238_10449072 3300009551 Bacteria 1286
94 Ga0105238_11500854 3300009551 Bacteria 703
95 Ga0105249_11575260 3300009553 Bacteria 729
96 Ga0105239_10662168 3300010375 Bacteria 1193
97 Ga0105239_12281560 3300010375 Bacteria 630
98 Ga0157370_10876060 3300013104 Bacteria 815
99 Ga0157369_10222381 3300013105 Bacteria 1976
100 Ga0157369_10773023 3300013105 Bacteria 987
101 Ga0157372_10103612 3300013307 Bacteria 3251
102 Ga0157372_10778591 3300013307 Bacteria 1112
103 Ga0157375_10068466 3300013308 Bacteria 3552
104 Ga0157375_11494335 3300013308 Bacteria 797
105 Ga0163163_10075508 3300014325 Bacteria 3364
106 Ga0163163_10254575 3300014325 Bacteria 1806
107 Ga0163163_11652431 3300014325 Bacteria 701
108 Ga0157380_10509553 3300014326 Bacteria 1171
109 Ga0157379_10005693 3300014968 Bacteria 10709
110 Ga0157379_11469417 3300014968 Bacteria 662
111 Ga0157376_10069849 3300014969 Bacteria 2979
112 Ga0157376_11193529 3300014969 Bacteria 789
113 Ga0163161_10872957 3300017792 Bacteria 760
114 Ga0206356_11349605 3300020070 Bacteria 1031
115 Ga0209758_1001665 3300025297 Bacteria 25124
116 Ga0209050_1000101 3300025298 Bacteria 230076
117 Ga0209257_1000147 3300025304 Bacteria 194105
118 Ga0209257_1000221 3300025304 Bacteria 134870
119 Ga0207680_10347079 3300025903 Bacteria 1042
120 Ga0207705_10011075 3300025909 Bacteria 6538
121 Ga0207707_10013828 3300025912 Bacteria 7038
122 Ga0207707_10057171 3300025912 Bacteria 3395
123 Ga0207707_10329096 3300025912 Bacteria 1318
124 Ga0207695_10001229 3300025913 Bacteria 43850
125 Ga0207695_10049791 3300025913 Bacteria 4412
126 Ga0207695_10603590 3300025913 Bacteria 979
127 Ga0207695_10716049 3300025913 Bacteria 881
128 Ga0207695_10740310 3300025913 Bacteria 863
129 Ga0207660_10004634 3300025917 Bacteria 8962
130 Ga0207660_10154426 3300025917 Bacteria 1766
131 Ga0207660_10364306 3300025917 Bacteria 1160
132 Ga0207660_10975816 3300025917 Bacteria 691
133 Ga0207657_10012251 3300025919 Bacteria 8472
134 Ga0207657_10054993 3300025919 Bacteria 3439
135 Ga0207652_10068600 3300025921 Bacteria 3077
136 Ga0207652_10493701 3300025921 Bacteria 1102
137 Ga0207694_10860311 3300025924 Bacteria 766
138 Ga0207694_11881817 3300025924 Bacteria 502
139 Ga0207650_11260667 3300025925 Bacteria 629
140 Ga0207644_10053087 3300025931 Bacteria 2916
141 Ga0207690_10000129 3300025932 Bacteria 62350
142 Ga0207704_10000400 3300025938 Bacteria 19733
143 Ga0207711_10155536 3300025941 Bacteria 2066
144 Ga0207711_10528689 3300025941 Bacteria 1100
145 Ga0207689_10325040 3300025942 Unclassified 1277
146 Ga0207667_10017409 3300025949 Bacteria 8089
147 Ga0207667_10159969 3300025949 Bacteria 2317
148 Ga0207667_10318330 3300025949 Bacteria 1589
149 Ga0207667_10764390 3300025949 Bacteria 965
150 Ga0207651_10062149 3300025960 Bacteria 2601
151 Ga0207668_10010307 3300025972 Bacteria 5644
152 Ga0207668_10039889 3300025972 Bacteria 3164
153 Ga0207658_10013446 3300025986 Bacteria 5590
154 Ga0207703_10000038 3300026035 Bacteria 175917
155 Ga0207639_10025186 3300026041 Bacteria 4313
156 Ga0207639_10659270 3300026041 Bacteria 969
157 Ga0207639_10704843 3300026041 Bacteria 937
158 Ga0207678_10988056 3300026067 Bacteria 745
159 Ga0207702_10093562 3300026078 Bacteria 2636
160 Ga0207702_10197531 3300026078 Bacteria 1863
161 Ga0207702_10230966 3300026078 Bacteria 1729
162 Ga0207702_11787803 3300026078 Unclassified 607
163 Ga0207641_10204371 3300026088 Bacteria 1823
164 Ga0207641_10240162 3300026088 Bacteria 1688
165 Ga0207676_10031203 3300026095 Bacteria 4006
166 Ga0207676_10565226 3300026095 Bacteria 1088
167 Ga0207676_10578904 3300026095 Bacteria 1076
168 Ga0207676_11065436 3300026095 Bacteria 798
169 Ga0207683_10097760 3300026121 Bacteria 2619
170 Ga0207698_10799767 3300026142 Bacteria 945
171 Ga0268266_10000064 3300028379 Bacteria 249533
172 Ga0268266_10199415 3300028379 Bacteria 1831
173 Ga0268265_10004003 3300028380 Bacteria 10375
174 Ga0268265_10054260 3300028380 Bacteria 3040
175 Ga0307517_10060958 3300028786 Bacteria 3579
176 Ga0307517_10170611 3300028786 Bacteria 1431
177 Ga0307515_10468021 3300028794 Bacteria 874
178 Ga0307511_10086813 3300030521 Bacteria 2152
179 Ga0265327_10007130 3300031251 Bacteria 8721
180 Ga0265327_10034801 3300031251 Bacteria 2791
181 Ga0307513_10018891 3300031456 Bacteria 8220
182 Ga0307513_10522564 3300031456 Bacteria 902
183 Ga0307413_10425784 3300031824 Bacteria 1047
184 Ga0307413_10762516 3300031824 Bacteria 810
185 Ga0307406_12104138 3300031901 Bacteria 506
186 Ga0307414_10145722 3300032004 Bacteria 1860
187 Ga0307414_10151600 3300032004 Bacteria 1830
188 Ga0307414_10175708 3300032004 Bacteria 1717
189 Ga0307414_10782553 3300032004 Bacteria 869
190 Ga0307414_11293295 3300032004 Bacteria 676
191 Ga0307411_11368994 3300032005 Unclassified 647
192 Ga0307411_11447926 3300032005 Bacteria 630
193 Ga0307415_102217393 3300032126 Bacteria 538
194 Ga0373936_0026337 3300035113 Bacteria 2277
195 Ga0373935_0256640 3300035692 Bacteria 1225
196 Ga0373927_0520334 3300035695 Bacteria 786
197 Ga0373933_0801181 3300035724 Bacteria 620
198 Ga0373947_0601048 3300035725 Unclassified 750
199 Ga0395899_0052144 3300037312 Bacteria 3033
200 Ga0395899_0173470 3300037312 Bacteria 1517
201 Ga0395899_0392823 3300037312 Bacteria 919
202 Ga0395899_0554603 3300037312 Bacteria 738
203 Ga0395900_0000009 3300037418 Bacteria 476249
204 Ga0395900_0020261 3300037418 Bacteria 6787
205 Ga0395900_0277799 3300037418 Bacteria 1668
206 Ga0395900_0560220 3300037418 Bacteria 1086
207 Ga0395900_1345965 3300037418 Bacteria 627
208 Ga0395898_0003722 3300037466 Bacteria 16914
209 Ga0395898_0124538 3300037466 Bacteria 2469
210 Ga0395898_0230939 3300037466 Bacteria 1764
211 Ga0395898_0287689 3300037466 Bacteria 1568
212 Ga0395898_0507001 3300037466 Bacteria 1147
213 Ga0395905_0002729 3300037471 Bacteria 19333
214 Ga0395905_0016382 3300037471 Bacteria 7042
215 Ga0395905_0032055 3300037471 Bacteria 4943
216 Ga0395905_0054502 3300037471 Bacteria 3742
217 Ga0395905_0764640 3300037471 Bacteria 869
218 Ga0395905_1434906 3300037471 Bacteria 594
219 Ga0395901_0000014 3300038443 Bacteria 375100
220 Ga0395901_0033445 3300038443 Bacteria 5309
221 Ga0395901_0693742 3300038443 Bacteria 1016
222 Ga0395901_0826472 3300038443 Bacteria 913
223 Ga0395901_0945547 3300038443 Bacteria 841
224 Ga0395901_1038832 3300038443 Bacteria 793
225 Ga0439457_014035 3300042014 Bacteria 1797
226 Ga0439434_0153480 3300042435 Bacteria 763
227 Ga0453684_2168116 3300044712 Bacteria 556
228 Ga0466957_0149415 3300044842 Bacteria 1510
229 Ga0466967_2413564 3300045976 Bacteria 521
230 Ga0495629_0659506 3300046459 Unclassified 697
231 Ga0495650_0078101 3300046471 Bacteria 1282
232 Ga0495650_0226855 3300046471 Bacteria 642
233 Ga0495662_0409122 3300046476 Bacteria 666
234 Ga0495585_0179826 3300046492 Bacteria 1088
235 Ga0495583_0314418 3300046506 Bacteria 621
236 Ga0495606_0371836 3300046507 Bacteria 752
237 Ga0495620_0041978 3300046515 Bacteria 2002
238 Ga0495628_0220137 3300046516 Bacteria 1426
239 Ga0495648_0007568 3300046524 Bacteria 8680
240 Ga0495663_0042364 3300046525 Bacteria 1387
241 Ga0495642_0017964 3300046528 Bacteria 2765
242 Ga0495642_0018342 3300046528 Bacteria 2739
243 Ga0495642_0234705 3300046528 Bacteria 801
244 Ga0495645_0083464 3300046543 Bacteria 2290
245 Ga0495668_0398274 3300046616 Bacteria 756
246 Ga0495625_0016679 3300046660 Bacteria 5770
247 Ga0495625_0054818 3300046660 Bacteria 2846
248 Ga0495625_0272464 3300046660 Bacteria 1092
249 Ga0495669_0028770 3300046684 Bacteria 2435
250 Ga0495669_0042351 3300046684 Bacteria 2024
251 Ga0495636_0117747 3300047318 Bacteria 1173
252 Ga0495672_0024140 3300047320 Bacteria 3923
253 Ga0495677_0032617 3300047445 Bacteria 1897
254 Ga0496100_0288611 3300048903 Bacteria 1225
255 Ga0496100_0395880 3300048903 Bacteria 1051
256 Ga0496102_0501975 3300048905 Bacteria 1135
257 Ga0496103_0487232 3300048906 Bacteria 789
258 Ga0496106_0539538 3300048909 Bacteria 936
259 Ga0496107_0149553 3300048910 Bacteria 1727
260 Ga0496109_0021464 3300048912 Bacteria 5710
261 Ga0496110_1038741 3300048913 Bacteria 727
262 Ga0496112_0009470 3300048915 Bacteria 8780
263 Ga0496112_0133973 3300048915 Bacteria 2448
264 Ga0496112_0638490 3300048915 Bacteria 995
265 Ga0496113_0061358 3300048916 Bacteria 2837
266 Ga0496113_1360578 3300048916 Bacteria 551
267 Ga0496115_0003418 3300048918 Bacteria 11405
268 Ga0501033_0077447 3300049570 Bacteria 2440
269 Ga0501043_0328991 3300049579 Unclassified 1164
270 Ga0501047_0066523 3300049581 Bacteria 3474
271 Ga0501047_0074679 3300049581 Bacteria 3264
272 Ga0501047_0234723 3300049581 Unclassified 1686
273 Ga0501083_0224303 3300049744 Bacteria 1224
274 Ga0501044_0024503 3300049823 Bacteria 6403
275 Ga0501044_0607928 3300049823 Bacteria 986
276 nmdc:mga03n38_326755_c1 3300050490 Bacteria 829
277 nmdc:mga0k408_841930_c1 3300050493 Bacteria 533
278 Ga0500556_0022635 3300053104 Bacteria 2043
279 Ga0501084_0000178 3300054114 Bacteria 49576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10069849 Ga0157376_100698492 134
2 3300005331 Ga0070670_100126315 Ga0070670_1001263151 135
3 3300005335 Ga0070666_10924407 Ga0070666_109244071 135
4 3300005340 Ga0070689_100027077 Ga0070689_1000270773 135
5 3300005355 Ga0070671_100196899 Ga0070671_1001968992 135
6 3300005618 Ga0068864_100422013 Ga0068864_1004220132 135
7 3300005841 Ga0068863_100484981 Ga0068863_1004849812 135
8 3300005844 Ga0068862_100007701 Ga0068862_10000770110 135
9 3300005844 Ga0068862_100057656 Ga0068862_1000576562 135
10 3300009177 Ga0105248_12109504 Ga0105248_121095042 135
11 3300010375 Ga0105239_10662168 Ga0105239_106621682 135
12 3300014326 Ga0157380_10509553 Ga0157380_105095532 135
13 3300025925 Ga0207650_11260667 Ga0207650_112606671 135
14 3300025972 Ga0207668_10010307 Ga0207668_100103077 135
15 3300025972 Ga0207668_10039889 Ga0207668_100398894 135
16 3300025986 Ga0207658_10013446 Ga0207658_100134467 135
17 3300026095 Ga0207676_10578904 Ga0207676_105789042 135
18 3300028380 Ga0268265_10004003 Ga0268265_100040034 135
19 3300028380 Ga0268265_10054260 Ga0268265_100542604 135
20 3300031251 Ga0265327_10007130 Ga0265327_100071308 135
21 3300046492 Ga0495585_0179826 Ga0495585_0179826_445_855 135
22 3300046524 Ga0495648_0007568 Ga0495648_0007568_4489_4905 135
23 3300048906 Ga0496103_0487232 Ga0496103_0487232_217_627 135
24 3300053104 Ga0500556_0022635 Ga0500556_0022635_1284_1715 135
25 2088090001 CNB_F6ESG4R02GAEPV CNB_00014630 136
26 3300003215 JGI25153J46596_10030800 JGI25153J46596_100308001 136
27 3300003791 Ga0055530_10000685 Ga0055530_1000068531 136
28 3300003794 Ga0055531_10004322 Ga0055531_100043221 136
29 3300003794 Ga0055531_10009816 Ga0055531_100098161 136
30 3300005262 Ga0065165_1000552 Ga0065165_10005522 136
31 3300005327 Ga0070658_10079234 Ga0070658_100792342 136
32 3300005327 Ga0070658_10309145 Ga0070658_103091452 136
33 3300005328 Ga0070676_11096888 Ga0070676_110968881 136
34 3300005336 Ga0070680_100025744 Ga0070680_1000257443 136
35 3300005336 Ga0070680_100028910 Ga0070680_1000289102 136
36 3300005336 Ga0070680_100049128 Ga0070680_1000491284 136
37 3300005336 Ga0070680_100437959 Ga0070680_1004379592 136
38 3300005339 Ga0070660_100264961 Ga0070660_1002649612 136
39 3300005339 Ga0070660_100347043 Ga0070660_1003470432 136
40 3300005341 Ga0070691_10011443 Ga0070691_100114434 136
41 3300005355 Ga0070671_100197055 Ga0070671_1001970552 136
42 3300005355 Ga0070671_100247995 Ga0070671_1002479952 136
43 3300005355 Ga0070671_101024838 Ga0070671_1010248382 136
44 3300005356 Ga0070674_100602977 Ga0070674_1006029772 136
45 3300005364 Ga0070673_100188644 Ga0070673_1001886441 136
46 3300005366 Ga0070659_100000206 Ga0070659_10000020648 136
47 3300005366 Ga0070659_102167774 Ga0070659_1021677741 136
48 3300005456 Ga0070678_100069717 Ga0070678_1000697174 136
49 3300005458 Ga0070681_10017736 Ga0070681_100177365 136
50 3300005458 Ga0070681_10018723 Ga0070681_100187234 136
51 3300005458 Ga0070681_10079994 Ga0070681_100799944 136
52 3300005458 Ga0070681_11138154 Ga0070681_111381541 136
53 3300005458 Ga0070681_11189415 Ga0070681_111894152 136
54 3300005530 Ga0070679_100003462 Ga0070679_10000346217 136
55 3300005530 Ga0070679_100542200 Ga0070679_1005422001 136
56 3300005530 Ga0070679_100555423 Ga0070679_1005554232 136
57 3300005530 Ga0070679_100800561 Ga0070679_1008005612 136
58 3300005539 Ga0068853_100040630 Ga0068853_1000406304 136
59 3300005539 Ga0068853_100446942 Ga0068853_1004469422 136
60 3300005539 Ga0068853_100717178 Ga0068853_1007171782 136
61 3300005539 Ga0068853_101225434 Ga0068853_1012254342 136
62 3300005546 Ga0070696_100042794 Ga0070696_1000427942 136
63 3300005548 Ga0070665_100000116 Ga0070665_10000011674 136
64 3300005548 Ga0070665_100206491 Ga0070665_1002064912 136
65 3300005563 Ga0068855_100037556 Ga0068855_1000375563 136
66 3300005563 Ga0068855_100048334 Ga0068855_1000483344 136
67 3300005563 Ga0068855_100051066 Ga0068855_1000510663 136
68 3300005563 Ga0068855_100206321 Ga0068855_1002063212 136
69 3300005563 Ga0068855_100389105 Ga0068855_1003891053 136
70 3300005563 Ga0068855_100523597 Ga0068855_1005235972 136
71 3300005563 Ga0068855_100734336 Ga0068855_1007343362 136
72 3300005577 Ga0068857_100037853 Ga0068857_1000378532 136
73 3300005578 Ga0068854_100454119 Ga0068854_1004541192 136
74 3300005614 Ga0068856_100494403 Ga0068856_1004944032 136
75 3300005614 Ga0068856_100560747 Ga0068856_1005607472 136
76 3300005616 Ga0068852_100128448 Ga0068852_1001284483 136
77 3300005616 Ga0068852_102252517 Ga0068852_1022525171 136
78 3300005617 Ga0068859_102096805 Ga0068859_1020968051 136
79 3300005618 Ga0068864_100003980 Ga0068864_10000398012 136
80 3300005618 Ga0068864_100773247 Ga0068864_1007732472 136
81 3300005618 Ga0068864_102593037 Ga0068864_1025930371 136
82 3300005841 Ga0068863_100222349 Ga0068863_1002223492 136
83 3300005841 Ga0068863_100437712 Ga0068863_1004377122 136
84 3300005841 Ga0068863_101810170 Ga0068863_1018101702 136
85 3300005842 Ga0068858_100000031 Ga0068858_10000003195 136
86 3300006028 Ga0070717_10393251 Ga0070717_103932512 136
87 3300006177 Ga0075362_10125493 Ga0075362_101254932 136
88 3300006358 Ga0068871_100946748 Ga0068871_1009467482 136
89 3300006358 Ga0068871_101427262 Ga0068871_1014272622 136
90 3300006881 Ga0068865_100005340 Ga0068865_1000053402 136
91 3300006931 Ga0097620_102097632 Ga0097620_1020976321 136
92 3300009093 Ga0105240_10146575 Ga0105240_101465752 136
93 3300009093 Ga0105240_10241070 Ga0105240_102410702 136
94 3300009093 Ga0105240_10397932 Ga0105240_103979321 136
95 3300009093 Ga0105240_10721440 Ga0105240_107214402 136
96 3300009093 Ga0105240_10910921 Ga0105240_109109212 136
97 3300009148 Ga0105243_11026257 Ga0105243_110262571 136
98 3300009174 Ga0105241_10533441 Ga0105241_105334412 136
99 3300009177 Ga0105248_10263980 Ga0105248_102639802 136
100 3300009177 Ga0105248_11239067 Ga0105248_112390672 136
101 3300009177 Ga0105248_12113753 Ga0105248_121137532 136
102 3300009177 Ga0105248_12122079 Ga0105248_121220792 136
103 3300009545 Ga0105237_10083404 Ga0105237_100834043 136
104 3300009545 Ga0105237_10624912 Ga0105237_106249122 136
105 3300009545 Ga0105237_11498539 Ga0105237_114985391 136
106 3300009551 Ga0105238_10060437 Ga0105238_100604374 136
107 3300009551 Ga0105238_10246863 Ga0105238_102468633 136
108 3300009551 Ga0105238_10449072 Ga0105238_104490722 136
109 3300009551 Ga0105238_11500854 Ga0105238_115008542 136
110 3300009553 Ga0105249_11575260 Ga0105249_115752602 136
111 3300010375 Ga0105239_12281560 Ga0105239_122815602 136
112 3300013104 Ga0157370_10876060 Ga0157370_108760602 136
113 3300013105 Ga0157369_10222381 Ga0157369_102223813 136
114 3300013105 Ga0157369_10773023 Ga0157369_107730232 136
115 3300013307 Ga0157372_10103612 Ga0157372_101036123 136
116 3300013307 Ga0157372_10778591 Ga0157372_107785911 136
117 3300013308 Ga0157375_10068466 Ga0157375_100684663 136
118 3300013308 Ga0157375_11494335 Ga0157375_114943352 136
119 3300014325 Ga0163163_10075508 Ga0163163_100755082 136
120 3300014325 Ga0163163_10254575 Ga0163163_102545752 136
121 3300014325 Ga0163163_11652431 Ga0163163_116524311 136
122 3300014968 Ga0157379_10005693 Ga0157379_100056938 136
123 3300014968 Ga0157379_11469417 Ga0157379_114694172 136
124 3300014969 Ga0157376_11193529 Ga0157376_111935292 136
125 3300017792 Ga0163161_10872957 Ga0163161_108729572 136
126 3300020070 Ga0206356_11349605 Ga0206356_113496052 136
127 3300025297 Ga0209758_1001665 Ga0209758_10016652 136
128 3300025298 Ga0209050_1000101 Ga0209050_1000101225 136
129 3300025304 Ga0209257_1000147 Ga0209257_100014754 136
130 3300025304 Ga0209257_1000221 Ga0209257_100022131 136
131 3300025903 Ga0207680_10347079 Ga0207680_103470792 136
132 3300025909 Ga0207705_10011075 Ga0207705_100110754 136
133 3300025912 Ga0207707_10013828 Ga0207707_100138284 136
134 3300025912 Ga0207707_10057171 Ga0207707_100571713 136
135 3300025912 Ga0207707_10329096 Ga0207707_103290962 136
136 3300025913 Ga0207695_10001229 Ga0207695_1000122940 136
137 3300025913 Ga0207695_10049791 Ga0207695_100497914 136
138 3300025913 Ga0207695_10603590 Ga0207695_106035902 136
139 3300025913 Ga0207695_10716049 Ga0207695_107160492 136
140 3300025913 Ga0207695_10740310 Ga0207695_107403102 136
141 3300025917 Ga0207660_10004634 Ga0207660_100046346 136
142 3300025917 Ga0207660_10154426 Ga0207660_101544261 136
143 3300025917 Ga0207660_10364306 Ga0207660_103643062 136
144 3300025917 Ga0207660_10975816 Ga0207660_109758162 136
145 3300025919 Ga0207657_10012251 Ga0207657_100122515 136
146 3300025919 Ga0207657_10054993 Ga0207657_100549932 136
147 3300025921 Ga0207652_10068600 Ga0207652_100686004 136
148 3300025921 Ga0207652_10493701 Ga0207652_104937012 136
149 3300025924 Ga0207694_10860311 Ga0207694_108603111 136
150 3300025924 Ga0207694_11881817 Ga0207694_118818171 136
151 3300025931 Ga0207644_10053087 Ga0207644_100530873 136
152 3300025932 Ga0207690_10000129 Ga0207690_1000012918 136
153 3300025938 Ga0207704_10000400 Ga0207704_1000040018 136
154 3300025941 Ga0207711_10155536 Ga0207711_101555362 136
155 3300025941 Ga0207711_10528689 Ga0207711_105286892 136
156 3300025942 Ga0207689_10325040 Ga0207689_103250402 136
157 3300025949 Ga0207667_10017409 Ga0207667_100174095 136
158 3300025949 Ga0207667_10159969 Ga0207667_101599693 136
159 3300025949 Ga0207667_10318330 Ga0207667_103183303 136
160 3300025949 Ga0207667_10764390 Ga0207667_107643902 136
161 3300025960 Ga0207651_10062149 Ga0207651_100621492 136
162 3300026035 Ga0207703_10000038 Ga0207703_1000003892 136
163 3300026041 Ga0207639_10025186 Ga0207639_100251862 136
164 3300026041 Ga0207639_10659270 Ga0207639_106592701 136
165 3300026041 Ga0207639_10704843 Ga0207639_107048432 136
166 3300026067 Ga0207678_10988056 Ga0207678_109880562 136
167 3300026078 Ga0207702_10093562 Ga0207702_100935623 136
168 3300026078 Ga0207702_10197531 Ga0207702_101975312 136
169 3300026078 Ga0207702_10230966 Ga0207702_102309663 136
170 3300026078 Ga0207702_11787803 Ga0207702_117878031 136
171 3300026088 Ga0207641_10204371 Ga0207641_102043712 136
172 3300026088 Ga0207641_10240162 Ga0207641_102401622 136
173 3300026095 Ga0207676_10031203 Ga0207676_100312033 136
174 3300026095 Ga0207676_10565226 Ga0207676_105652262 136
175 3300026095 Ga0207676_11065436 Ga0207676_110654362 136
176 3300026121 Ga0207683_10097760 Ga0207683_100977602 136
177 3300026142 Ga0207698_10799767 Ga0207698_107997672 136
178 3300028379 Ga0268266_10000064 Ga0268266_10000064180 136
179 3300028379 Ga0268266_10199415 Ga0268266_101994153 136
180 3300028786 Ga0307517_10060958 Ga0307517_100609582 136
181 3300028786 Ga0307517_10170611 Ga0307517_101706112 136
182 3300028794 Ga0307515_10468021 Ga0307515_104680211 136
183 3300030521 Ga0307511_10086813 Ga0307511_100868133 136
184 3300031251 Ga0265327_10034801 Ga0265327_100348013 136
185 3300031456 Ga0307513_10018891 Ga0307513_100188915 136
186 3300031456 Ga0307513_10522564 Ga0307513_105225642 136
187 3300031824 Ga0307413_10425784 Ga0307413_104257842 136
188 3300031824 Ga0307413_10762516 Ga0307413_107625162 136
189 3300031901 Ga0307406_12104138 Ga0307406_121041381 136
190 3300032004 Ga0307414_10145722 Ga0307414_101457222 136
191 3300032004 Ga0307414_10151600 Ga0307414_101516001 136
192 3300032004 Ga0307414_10175708 Ga0307414_101757084 136
193 3300032004 Ga0307414_10782553 Ga0307414_107825531 136
194 3300032004 Ga0307414_11293295 Ga0307414_112932952 136
195 3300032005 Ga0307411_11368994 Ga0307411_113689942 136
196 3300032005 Ga0307411_11447926 Ga0307411_114479262 136
197 3300032126 Ga0307415_102217393 Ga0307415_1022173931 136
198 3300035113 Ga0373936_0026337 Ga0373936_0026337_1141_1554 136
199 3300035692 Ga0373935_0256640 Ga0373935_0256640_798_1211 136
200 3300035695 Ga0373927_0520334 Ga0373927_0520334_68_481 136
201 3300035724 Ga0373933_0801181 Ga0373933_0801181_18_431 136
202 3300035725 Ga0373947_0601048 Ga0373947_0601048_57_470 136
203 3300037312 Ga0395899_0052144 Ga0395899_0052144_363_782 136
204 3300037312 Ga0395899_0173470 Ga0395899_0173470_185_598 136
205 3300037312 Ga0395899_0392823 Ga0395899_0392823_254_673 136
206 3300037312 Ga0395899_0554603 Ga0395899_0554603_51_464 136
207 3300037418 Ga0395900_0000009 Ga0395900_0000009_298405_298824 136
208 3300037418 Ga0395900_0020261 Ga0395900_0020261_3684_4097 136
209 3300037418 Ga0395900_0277799 Ga0395900_0277799_904_1317 136
210 3300037418 Ga0395900_0560220 Ga0395900_0560220_58_477 136
211 3300037418 Ga0395900_1345965 Ga0395900_1345965_138_557 136
212 3300037466 Ga0395898_0003722 Ga0395898_0003722_15165_15584 136
213 3300037466 Ga0395898_0124538 Ga0395898_0124538_1080_1493 136
214 3300037466 Ga0395898_0230939 Ga0395898_0230939_109_528 136
215 3300037466 Ga0395898_0287689 Ga0395898_0287689_987_1400 136
216 3300037466 Ga0395898_0507001 Ga0395898_0507001_92_511 136
217 3300037471 Ga0395905_0002729 Ga0395905_0002729_994_1413 136
218 3300037471 Ga0395905_0016382 Ga0395905_0016382_2082_2495 136
219 3300037471 Ga0395905_0032055 Ga0395905_0032055_4374_4787 136
220 3300037471 Ga0395905_0054502 Ga0395905_0054502_3119_3532 136
221 3300037471 Ga0395905_0764640 Ga0395905_0764640_49_468 136
222 3300037471 Ga0395905_1434906 Ga0395905_1434906_142_555 136
223 3300038443 Ga0395901_0000014 Ga0395901_0000014_249610_250029 136
224 3300038443 Ga0395901_0033445 Ga0395901_0033445_1401_1814 136
225 3300038443 Ga0395901_0693742 Ga0395901_0693742_140_559 136
226 3300038443 Ga0395901_0826472 Ga0395901_0826472_45_464 136
227 3300038443 Ga0395901_0945547 Ga0395901_0945547_235_654 136
228 3300038443 Ga0395901_1038832 Ga0395901_1038832_368_781 136
229 3300042014 Ga0439457_014035 Ga0439457_014035_676_1089 136
230 3300042435 Ga0439434_0153480 Ga0439434_0153480_75_488 136
231 3300044712 Ga0453684_2168116 Ga0453684_2168116_29_442 136
232 3300044842 Ga0466957_0149415 Ga0466957_0149415_468_893 136
233 3300045976 Ga0466967_2413564 Ga0466967_2413564_54_470 136
234 3300046459 Ga0495629_0659506 Ga0495629_0659506_249_662 136
235 3300046471 Ga0495650_0078101 Ga0495650_0078101_385_798 136
236 3300046471 Ga0495650_0226855 Ga0495650_0226855_64_474 136
237 3300046476 Ga0495662_0409122 Ga0495662_0409122_28_438 136
238 3300046506 Ga0495583_0314418 Ga0495583_0314418_80_490 136
239 3300046507 Ga0495606_0371836 Ga0495606_0371836_168_581 136
240 3300046515 Ga0495620_0041978 Ga0495620_0041978_978_1391 136
241 3300046516 Ga0495628_0220137 Ga0495628_0220137_471_884 136
242 3300046525 Ga0495663_0042364 Ga0495663_0042364_370_798 136
243 3300046528 Ga0495642_0017964 Ga0495642_0017964_1253_1663 136
244 3300046528 Ga0495642_0018342 Ga0495642_0018342_2061_2471 136
245 3300046528 Ga0495642_0234705 Ga0495642_0234705_75_485 136
246 3300046543 Ga0495645_0083464 Ga0495645_0083464_1544_1957 136
247 3300046616 Ga0495668_0398274 Ga0495668_0398274_42_452 136
248 3300046660 Ga0495625_0016679 Ga0495625_0016679_22_432 136
249 3300046660 Ga0495625_0054818 Ga0495625_0054818_2013_2423 136
250 3300046660 Ga0495625_0272464 Ga0495625_0272464_639_1052 136
251 3300046684 Ga0495669_0028770 Ga0495669_0028770_668_1078 136
252 3300046684 Ga0495669_0042351 Ga0495669_0042351_1313_1723 136
253 3300047318 Ga0495636_0117747 Ga0495636_0117747_429_839 136
254 3300047320 Ga0495672_0024140 Ga0495672_0024140_1486_1896 136
255 3300047445 Ga0495677_0032617 Ga0495677_0032617_1110_1520 136
256 3300048903 Ga0496100_0288611 Ga0496100_0288611_712_1122 136
257 3300048903 Ga0496100_0395880 Ga0496100_0395880_122_544 136
258 3300048905 Ga0496102_0501975 Ga0496102_0501975_129_539 136
259 3300048909 Ga0496106_0539538 Ga0496106_0539538_427_840 136
260 3300048910 Ga0496107_0149553 Ga0496107_0149553_53_463 136
261 3300048912 Ga0496109_0021464 Ga0496109_0021464_4363_4773 136
262 3300048913 Ga0496110_1038741 Ga0496110_1038741_209_619 136
263 3300048915 Ga0496112_0009470 Ga0496112_0009470_5774_6187 136
264 3300048915 Ga0496112_0133973 Ga0496112_0133973_1252_1662 136
265 3300048915 Ga0496112_0638490 Ga0496112_0638490_420_830 136
266 3300048916 Ga0496113_0061358 Ga0496113_0061358_399_809 136
267 3300048916 Ga0496113_1360578 Ga0496113_1360578_118_531 136
268 3300048918 Ga0496115_0003418 Ga0496115_0003418_1712_2125 136
269 3300049570 Ga0501033_0077447 Ga0501033_0077447_713_1132 136
270 3300049579 Ga0501043_0328991 Ga0501043_0328991_194_613 136
271 3300049581 Ga0501047_0066523 Ga0501047_0066523_1733_2146 136
272 3300049581 Ga0501047_0074679 Ga0501047_0074679_775_1191 136
273 3300049581 Ga0501047_0234723 Ga0501047_0234723_649_1068 136
274 3300049744 Ga0501083_0224303 Ga0501083_0224303_19_444 136
275 3300049823 Ga0501044_0024503 Ga0501044_0024503_905_1324 136
276 3300049823 Ga0501044_0607928 Ga0501044_0607928_341_757 136
277 3300050490 nmdc:mga03n38_326755_c1 nmdc:mga03n38_326755_c1_292_705 136
278 3300050493 nmdc:mga0k408_841930_c1 nmdc:mga0k408_841930_c1_20_433 136
279 3300054114 Ga0501084_0000178 Ga0501084_0000178_21762_22187 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

132

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

12

133

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8379 5 133
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8378 4 135
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8313 4 136
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8248 5 133
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8227 6 133
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8645 10 133 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.851 10 133 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8494 9 136 3.10.180.10
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8045 6 60 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7989 6 133 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2G4IKI1-F1-model_v4 VOC family virulence protein 0.9658 3 136
AF-A0A839LU08-F1-model_v4 deleted 0.9563 1 136
AF-A0A521PRJ4-F1-model_v4 VOC family protein 0.954 1 136
AF-A0A2N8FPT5-F1-model_v4 deleted 0.9521 1 63
AF-A0A839LU08-F1-model_v4 deleted 0.9494 1 136

Feature Viewer

pLDDT pTM Quality
91.87 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map