F382790

General Info

Members Datasets Scaffolds Average Seq Length
279 145 274 244

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10028784|rootH2_100287847
Length 270
Sequence MRVGLFIPCYVDQFYPQVGIATLELLEKFGCEVVYPPAQTCCGQPMANSGFEHLTKGCNDLFIRNFEGFEYIVAPSGSCVLHIKEHLRDPAGDTPLEAASSDRTDISALPATAKFPPANSRHNIPNKIYELVEFMTDVLRVSELDASFPYRVGLHQSCHGQRGLKLAQMSELMAPPFSKPQQLLNLVKGLELIELDRKDECCGFGGTFCVAEEAVSVKMGKDRVADHLHHGADVITGSDMSCLMHLEGILRRQQSRVRVKHIAEILNSHL

Samples

Sample ID Description Type Environment
1 2739367656 Pedobacter sp. CF523 Isolate Unclassified
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
98 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
99 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
138 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
139 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 0.72
Rhizosphere 83.51
Stem 0
Stem Tuber 0
Unclassified 8.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026251 3300001979 Bacteria 1953
2 JGI24744J21845_10008133 3300002077 Bacteria 2165
3 JGI25157J39369_1010709 3300002741 Bacteria 1201
4 rootH1_10181773 3300003316 Bacteria 1383
5 rootH2_10026785 3300003320 Bacteria 4350
6 rootH2_10028784 3300003320 Bacteria 31504
7 rootH2_10088470 3300003320 Bacteria 6886
8 rootL2_10008330 3300003322 Bacteria 10074
9 rootL2_10010994 3300003322 Bacteria 37041
10 rootL2_10273601 3300003322 Bacteria 2417
11 rootH1_10036893 3300003323 Bacteria 3164
12 rootH1_10126146 3300003323 Bacteria 1640
13 rootH1_10225360 3300003323 Bacteria 2650
14 JGI25160J50197_1015497 3300003354 Bacteria 2498
15 Ga0065714_10080564 3300005288 Bacteria 2431
16 Ga0070658_10046545 3300005327 Bacteria 3510
17 Ga0070658_10616580 3300005327 Bacteria 941
18 Ga0070676_10000015 3300005328 Bacteria 52703
19 Ga0070683_100125562 3300005329 Bacteria 2426
20 Ga0068869_100522855 3300005334 Unclassified 993
21 Ga0068868_100027235 3300005338 Bacteria 4361
22 Ga0068868_100089146 3300005338 Unclassified 2483
23 Ga0068868_100103141 3300005338 Bacteria 2310
24 Ga0070660_100029257 3300005339 Bacteria 4127
25 Ga0070660_100196864 3300005339 Bacteria 1634
26 Ga0070689_100362545 3300005340 Bacteria 1218
27 Ga0070691_10018879 3300005341 Bacteria 3179
28 Ga0070673_100002607 3300005364 Bacteria 11020
29 Ga0070659_100010930 3300005366 Bacteria 6699
30 Ga0070659_100066247 3300005366 Bacteria 2862
31 Ga0070667_100103668 3300005367 Unclassified 2459
32 Ga0070667_100363361 3300005367 Bacteria 1312
33 Ga0070663_100051799 3300005455 Bacteria 2926
34 Ga0070678_100000121 3300005456 Bacteria 30787
35 Ga0070662_100001108 3300005457 Bacteria 16442
36 Ga0068867_100000210 3300005459 Bacteria 39145
37 Ga0068853_100003568 3300005539 Bacteria 11910
38 Ga0068853_100046732 3300005539 Bacteria 3713
39 Ga0068853_100064695 3300005539 Bacteria 3172
40 Ga0070672_100082963 3300005543 Bacteria 2572
41 Ga0070665_100000006 3300005548 Bacteria 718034
42 Ga0070665_100189209 3300005548 Bacteria 2059
43 Ga0068855_100027574 3300005563 Bacteria 6794
44 Ga0068855_100078355 3300005563 Bacteria 3834
45 Ga0068855_100175239 3300005563 Bacteria 2427
46 Ga0068855_100370211 3300005563 Bacteria 1575
47 Ga0068856_100003301 3300005614 Bacteria 16396
48 Ga0068856_100060188 3300005614 Bacteria 3752
49 Ga0068856_100505074 3300005614 Bacteria 1230
50 Ga0068852_100001727 3300005616 Bacteria 14898
51 Ga0068852_100003100 3300005616 Bacteria 11571
52 Ga0068866_10154474 3300005718 Bacteria 1332
53 Ga0068860_100000005 3300005843 Bacteria 472349
54 Ga0070717_10567479 3300006028 Bacteria 1028
55 Ga0075366_10001082 3300006195 Bacteria 13386
56 Ga0075366_10051063 3300006195 Bacteria 2457
57 Ga0097621_100000308 3300006237 Bacteria 33071
58 Ga0097621_100440823 3300006237 Bacteria 1172
59 Ga0097621_100758908 3300006237 Bacteria 896
60 Ga0068871_100000046 3300006358 Bacteria 66964
61 Ga0068865_100000041 3300006881 Bacteria 72569
62 Ga0105240_10000100 3300009093 Bacteria 176640
63 Ga0105240_10001525 3300009093 Bacteria 39404
64 Ga0105240_10003673 3300009093 Bacteria 23739
65 Ga0105240_10003886 3300009093 Bacteria 23077
66 Ga0105240_10008491 3300009093 Bacteria 14689
67 Ga0105240_10010765 3300009093 Bacteria 12824
68 Ga0105240_10038050 3300009093 Bacteria 6176
69 Ga0105240_10065502 3300009093 Bacteria 4510
70 Ga0105240_10101423 3300009093 Bacteria 3500
71 Ga0105240_10145712 3300009093 Bacteria 2826
72 Ga0105240_10280301 3300009093 Bacteria 1915
73 Ga0105245_10140222 3300009098 Bacteria 2276
74 Ga0105245_10399219 3300009098 Bacteria 1374
75 Ga0105241_10000924 3300009174 Bacteria 22247
76 Ga0105241_10002091 3300009174 Bacteria 15079
77 Ga0105241_10016943 3300009174 Bacteria 5348
78 Ga0105241_10131067 3300009174 Bacteria 2030
79 Ga0105241_10419791 3300009174 Bacteria 1177
80 Ga0105241_10776418 3300009174 Unclassified 881
81 Ga0105242_10009234 3300009176 Bacteria 7566
82 Ga0105237_10000390 3300009545 Bacteria 62424
83 Ga0105237_10001001 3300009545 Bacteria 38035
84 Ga0105237_10002166 3300009545 Bacteria 24657
85 Ga0105237_10002312 3300009545 Bacteria 23678
86 Ga0105237_10012530 3300009545 Bacteria 8931
87 Ga0105237_10022817 3300009545 Bacteria 6421
88 Ga0105237_10034382 3300009545 Bacteria 5132
89 Ga0105237_10040616 3300009545 Bacteria 4691
90 Ga0105237_10099353 3300009545 Bacteria 2902
91 Ga0105237_10130614 3300009545 Bacteria 2506
92 Ga0105237_10200219 3300009545 Unclassified 1997
93 Ga0105237_10276615 3300009545 Bacteria 1681
94 Ga0105237_10442292 3300009545 Bacteria 1306
95 Ga0105238_10001854 3300009551 Bacteria 21188
96 Ga0105238_10002309 3300009551 Bacteria 19195
97 Ga0105238_10011946 3300009551 Bacteria 8749
98 Ga0105238_10020489 3300009551 Bacteria 6732
99 Ga0105238_10425623 3300009551 Bacteria 1323
100 Ga0105238_10574575 3300009551 Bacteria 1133
101 Ga0105249_10121704 3300009553 Bacteria 2480
102 Ga0105249_10674347 3300009553 Unclassified 1093
103 Ga0105239_10000004 3300010375 Bacteria 532483
104 Ga0105239_10000093 3300010375 Bacteria 125821
105 Ga0105239_10000811 3300010375 Bacteria 44304
106 Ga0105239_10002220 3300010375 Bacteria 24921
107 Ga0105239_10002871 3300010375 Bacteria 21552
108 Ga0105239_10006964 3300010375 Bacteria 13025
109 Ga0105239_10009313 3300010375 Bacteria 11100
110 Ga0105239_10019355 3300010375 Bacteria 7518
111 Ga0105239_10051186 3300010375 Bacteria 4528
112 Ga0105239_10173118 3300010375 Bacteria 2414
113 Ga0157373_10000075 3300013100 Bacteria 85818
114 Ga0157370_10000536 3300013104 Bacteria 47516
115 Ga0157370_10264913 3300013104 Bacteria 1588
116 Ga0157369_10000516 3300013105 Bacteria 50779
117 Ga0157369_10018288 3300013105 Bacteria 7860
118 Ga0157374_10000004 3300013296 Bacteria 759774
119 Ga0157374_10000137 3300013296 Bacteria 66006
120 Ga0157374_10000563 3300013296 Bacteria 32897
121 Ga0157374_10130199 3300013296 Bacteria 2435
122 Ga0157378_10054759 3300013297 Bacteria 3552
123 Ga0157378_10121085 3300013297 Bacteria 2412
124 Ga0163162_10004561 3300013306 Bacteria 13346
125 Ga0157372_10000010 3300013307 Bacteria 300658
126 Ga0157372_10000052 3300013307 Bacteria 135497
127 Ga0157372_10001180 3300013307 Bacteria 28252
128 Ga0157372_10009428 3300013307 Bacteria 10387
129 Ga0157372_10093070 3300013307 Bacteria 3430
130 Ga0157372_10304168 3300013307 Bacteria 1855
131 Ga0157375_10155412 3300013308 Bacteria 2426
132 Ga0157375_10798617 3300013308 Bacteria 1092
133 Ga0163163_10354798 3300014325 Bacteria 1523
134 Ga0182008_10015988 3300014497 Bacteria 3906
135 Ga0182008_10025225 3300014497 Bacteria 3020
136 Ga0157376_10010382 3300014969 Bacteria 6809
137 Ga0182007_10009432 3300015262 Bacteria 3934
138 Ga0209026_1000416 3300025250 Bacteria 36810
139 Ga0209026_1001554 3300025250 Bacteria 9948
140 Ga0209455_1003039 3300025272 Bacteria 6140
141 Ga0209050_1001790 3300025298 Bacteria 21145
142 Ga0209050_1011153 3300025298 Bacteria 4304
143 Ga0207426_1000002 3300025302 Bacteria 1249660
144 Ga0207642_10120152 3300025899 Bacteria 1354
145 Ga0207680_10058938 3300025903 Unclassified 2330
146 Ga0207647_10000049 3300025904 Bacteria 88392
147 Ga0207647_10123106 3300025904 Bacteria 1528
148 Ga0207647_10248693 3300025904 Bacteria 1020
149 Ga0207645_10000058 3300025907 Bacteria 78487
150 Ga0207654_10008988 3300025911 Bacteria 5069
151 Ga0207654_10012292 3300025911 Bacteria 4385
152 Ga0207654_10016088 3300025911 Bacteria 3890
153 Ga0207654_10038582 3300025911 Bacteria 2681
154 Ga0207654_10115884 3300025911 Bacteria 1674
155 Ga0207654_10156184 3300025911 Bacteria 1469
156 Ga0207695_10000027 3300025913 Bacteria 612456
157 Ga0207695_10000055 3300025913 Bacteria 382776
158 Ga0207695_10000164 3300025913 Bacteria 196777
159 Ga0207695_10002078 3300025913 Bacteria 30525
160 Ga0207695_10006874 3300025913 Bacteria 14642
161 Ga0207695_10019581 3300025913 Bacteria 7788
162 Ga0207695_10024242 3300025913 Bacteria 6831
163 Ga0207695_10039756 3300025913 Bacteria 5052
164 Ga0207695_10214485 3300025913 Bacteria 1834
165 Ga0207695_10346119 3300025913 Bacteria 1374
166 Ga0207671_10000259 3300025914 Bacteria 79366
167 Ga0207671_10000584 3300025914 Bacteria 48796
168 Ga0207671_10000905 3300025914 Bacteria 37474
169 Ga0207671_10000923 3300025914 Bacteria 36887
170 Ga0207671_10019863 3300025914 Bacteria 5128
171 Ga0207671_10034820 3300025914 Bacteria 3741
172 Ga0207671_10059924 3300025914 Bacteria 2823
173 Ga0207671_10060482 3300025914 Bacteria 2810
174 Ga0207671_10253161 3300025914 Bacteria 1384
175 Ga0207657_10096760 3300025919 Bacteria 2455
176 Ga0207657_10131436 3300025919 Bacteria 2051
177 Ga0207694_10032653 3300025924 Bacteria 3986
178 Ga0207694_10071563 3300025924 Bacteria 2710
179 Ga0207694_10164553 3300025924 Bacteria 1793
180 Ga0207694_10251055 3300025924 Bacteria 1447
181 Ga0207694_10505849 3300025924 Bacteria 1012
182 Ga0207690_10025769 3300025932 Bacteria 3697
183 Ga0207706_10000111 3300025933 Bacteria 87282
184 Ga0207686_10013720 3300025934 Bacteria 4491
185 Ga0207704_10000152 3300025938 Bacteria 37143
186 Ga0207691_10073778 3300025940 Bacteria 3078
187 Ga0207667_10002388 3300025949 Bacteria 23501
188 Ga0207667_10042723 3300025949 Bacteria 4817
189 Ga0207667_10049187 3300025949 Bacteria 4455
190 Ga0207651_10037927 3300025960 Bacteria 3161
191 Ga0207712_10102813 3300025961 Bacteria 2128
192 Ga0207640_10166373 3300025981 Bacteria 1638
193 Ga0207658_10366593 3300025986 Bacteria 1258
194 Ga0207658_10424324 3300025986 Bacteria 1173
195 Ga0207677_10016363 3300026023 Bacteria 4390
196 Ga0207677_10080246 3300026023 Bacteria 2337
197 Ga0207639_10001566 3300026041 Bacteria 15344
198 Ga0207639_10034951 3300026041 Bacteria 3718
199 Ga0207678_10073395 3300026067 Bacteria 2932
200 Ga0207702_10006138 3300026078 Bacteria 10404
201 Ga0207702_10070550 3300026078 Bacteria 3005
202 Ga0207702_10576601 3300026078 Bacteria 1102
203 Ga0207648_10001009 3300026089 Bacteria 31692
204 Ga0207674_10023520 3300026116 Bacteria 6597
205 Ga0207683_10046348 3300026121 Bacteria 3804
206 Ga0207698_10004294 3300026142 Bacteria 8679
207 Ga0268266_10000010 3300028379 Bacteria 1030233
208 Ga0268264_10000012 3300028381 Bacteria 521740
209 Ga0307517_10000129 3300028786 Bacteria 114359
210 Ga0307511_10000539 3300030521 Bacteria 40541
211 Ga0316177_1182232 3300030731 Bacteria 5134
212 Ga0316176_1080765 3300030732 Bacteria 11672
213 Ga0316183_1115386 3300030742 Bacteria 36365
214 Ga0316181_1016495 3300030744 Bacteria 6415
215 Ga0316181_1269313 3300030744 Bacteria 2211
216 Ga0307513_10168020 3300031456 Bacteria 2075
217 Ga0307509_10097024 3300031507 Bacteria 2997
218 Ga0307413_10231768 3300031824 Bacteria 1357
219 Ga0307412_10088646 3300031911 Bacteria 2159
220 Ga0307414_10683404 3300032004 Bacteria 928
221 Ga0307510_10000544 3300033180 Bacteria 37722
222 Ga0307510_10003389 3300033180 Bacteria 18602
223 Ga0395899_0000409 3300037312 Bacteria 50188
224 Ga0395899_0000446 3300037312 Bacteria 47368
225 Ga0395899_0049126 3300037312 Bacteria 3137
226 Ga0395900_0000554 3300037418 Bacteria 51989
227 Ga0395900_0002467 3300037418 Bacteria 20362
228 Ga0395898_0016652 3300037466 Bacteria 7514
229 Ga0395905_0000246 3300037471 Bacteria 81356
230 Ga0395905_0005177 3300037471 Bacteria 13371
231 Ga0395905_0700916 3300037471 Bacteria 915
232 Ga0395901_0000184 3300038443 Bacteria 81257
233 Ga0395901_0004208 3300038443 Bacteria 14506
234 Ga0436361_0137765 3300039447 Bacteria 20400
235 Ga0451798_0096896 3300041458 Bacteria 1081
236 Ga0451802_1062602 3300041460 Bacteria 835
237 Ga0439448_0014484 3300042005 Bacteria 2379
238 Ga0466969_0030432 3300044656 Bacteria 2751
239 Ga0466961_0142959 3300044693 Bacteria 1497
240 Ga0466971_0160981 3300044719 Bacteria 1051
241 Ga0466968_0007233 3300044735 Bacteria 4217
242 Ga0466958_0142933 3300045836 Bacteria 1507
243 Ga0495638_0000015 3300046460 Bacteria 414645
244 Ga0495638_0016902 3300046460 Bacteria 4878
245 Ga0495638_0064722 3300046460 Bacteria 2252
246 Ga0495596_0066164 3300046500 Bacteria 1405
247 Ga0495606_0034941 3300046507 Bacteria 3443
248 Ga0495631_0002836 3300046518 Bacteria 9627
249 Ga0495652_0184805 3300046529 Unclassified 1596
250 Ga0495668_0002782 3300046616 Bacteria 13931
251 Ga0495611_0000038 3300046648 Bacteria 100121
252 Ga0495625_0063530 3300046660 Bacteria 2607
253 Ga0495625_0104912 3300046660 Bacteria 1937
254 Ga0495625_0268499 3300046660 Bacteria 1102
255 Ga0495683_0031009 3300047323 Bacteria 2725
256 Ga0495687_000243 3300047443 Bacteria 75026
257 Ga0495686_0000058 3300047472 Bacteria 240089
258 Ga0495686_0000712 3300047472 Bacteria 44730
259 Ga0495686_0105029 3300047472 Bacteria 1700
260 Ga0501033_0052643 3300049570 Bacteria 3017
261 nmdc:mga0k408_402_c1 3300050493 Bacteria 23586
262 nmdc:mga0k408_46885_c1 3300050493 Bacteria 2496
263 Ga0500644_0025716 3300053088 Bacteria 1815
264 Ga0500583_0002800 3300053092 Bacteria 5339
265 Ga0500651_0370007 3300053093 Bacteria 810
266 Ga0500557_012380 3300053105 Bacteria 2210
267 Ga0500608_000244 3300053122 Bacteria 21445
268 Ga0500642_0004657 3300053130 Bacteria 4324
269 Ga0500559_0011620 3300053136 Bacteria 3760
270 Ga0500604_0012167 3300053151 Bacteria 2320
271 Ga0500622_0003451 3300053156 Bacteria 10545
272 Ga0500622_0011422 3300053156 Bacteria 4837
273 Ga0500637_0044594 3300053178 Bacteria 2513
274 Ga0500645_062543 3300053730 Bacteria 1075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0000058 Ga0495686_0000058_57008_57661 199
2 3300053093 Ga0500651_0370007 Ga0500651_0370007_15_707 199
3 3300005548 Ga0070665_100189209 Ga0070665_1001892092 229
4 3300006195 Ga0075366_10051063 Ga0075366_100510633 236
5 3300009545 Ga0105237_10012530 Ga0105237_100125305 236
6 3300010375 Ga0105239_10002871 Ga0105239_1000287114 236
7 3300046648 Ga0495611_0000038 Ga0495611_0000038_18209_18955 236
8 3300050493 nmdc:mga0k408_46885_c1 nmdc:mga0k408_46885_c1_1177_1914 236
9 iso_pu_bacteria 646564506 646812309 236
10 3300003316 rootH1_10181773 rootH1_101817732 237
11 3300006028 Ga0070717_10567479 Ga0070717_105674791 237
12 3300013296 Ga0157374_10000004 Ga0157374_10000004317 237
13 3300014969 Ga0157376_10010382 Ga0157376_100103822 237
14 3300003320 rootH2_10026785 rootH2_100267853 238
15 3300005341 Ga0070691_10018879 Ga0070691_100188792 238
16 3300005548 Ga0070665_100000006 Ga0070665_100000006126 238
17 3300005563 Ga0068855_100027574 Ga0068855_1000275746 238
18 3300005563 Ga0068855_100175239 Ga0068855_1001752392 238
19 3300005614 Ga0068856_100060188 Ga0068856_1000601883 238
20 3300005616 Ga0068852_100001727 Ga0068852_10000172711 238
21 3300009093 Ga0105240_10065502 Ga0105240_100655025 238
22 3300009174 Ga0105241_10776418 Ga0105241_107764182 238
23 3300009545 Ga0105237_10099353 Ga0105237_100993532 238
24 3300009545 Ga0105237_10442292 Ga0105237_104422922 238
25 3300009551 Ga0105238_10020489 Ga0105238_100204892 238
26 3300009551 Ga0105238_10425623 Ga0105238_104256232 238
27 3300009553 Ga0105249_10674347 Ga0105249_106743472 238
28 3300010375 Ga0105239_10000093 Ga0105239_1000009379 238
29 3300013104 Ga0157370_10000536 Ga0157370_1000053631 238
30 3300013307 Ga0157372_10000052 Ga0157372_1000005231 238
31 3300013307 Ga0157372_10001180 Ga0157372_100011803 238
32 3300025904 Ga0207647_10123106 Ga0207647_101231062 238
33 3300025904 Ga0207647_10248693 Ga0207647_102486932 238
34 3300025911 Ga0207654_10156184 Ga0207654_101561842 238
35 3300025913 Ga0207695_10346119 Ga0207695_103461192 238
36 3300025914 Ga0207671_10253161 Ga0207671_102531612 238
37 3300025924 Ga0207694_10032653 Ga0207694_100326532 238
38 3300025924 Ga0207694_10505849 Ga0207694_105058492 238
39 3300025949 Ga0207667_10002388 Ga0207667_1000238812 238
40 3300025949 Ga0207667_10042723 Ga0207667_100427232 238
41 3300025981 Ga0207640_10166373 Ga0207640_101663732 238
42 3300026078 Ga0207702_10006138 Ga0207702_100061386 238
43 3300026116 Ga0207674_10023520 Ga0207674_100235202 238
44 3300028379 Ga0268266_10000010 Ga0268266_10000010206 238
45 3300044735 Ga0466968_0007233 Ga0466968_0007233_2448_3167 238
46 3300046460 Ga0495638_0016902 Ga0495638_0016902_1407_2126 238
47 3300046660 Ga0495625_0104912 Ga0495625_0104912_134_853 238
48 3300053088 Ga0500644_0025716 Ga0500644_0025716_986_1705 238
49 3300053092 Ga0500583_0002800 Ga0500583_0002800_2213_2932 238
50 3300053130 Ga0500642_0004657 Ga0500642_0004657_2114_2833 238
51 3300053156 Ga0500622_0003451 Ga0500622_0003451_211_930 238
52 3300009545 Ga0105237_10000390 Ga0105237_1000039018 239
53 3300025914 Ga0207671_10000923 Ga0207671_1000092318 239
54 3300046507 Ga0495606_0034941 Ga0495606_0034941_488_1210 239
55 iso_pu_bacteria 2739367656 2739615771 240
56 iso_pu_bacteria 2842903701 2842907366 240
57 iso_pu_bacteria 2910245624 2910247568 240
58 iso_pu_bacteria 2977232053 2977233928 240
59 3300003323 rootH1_10225360 rootH1_102253602 241
60 3300005367 Ga0070667_100363361 Ga0070667_1003633612 241
61 3300005539 Ga0068853_100003568 Ga0068853_1000035687 241
62 3300005563 Ga0068855_100370211 Ga0068855_1003702111 241
63 3300009093 Ga0105240_10003886 Ga0105240_1000388612 241
64 3300009093 Ga0105240_10101423 Ga0105240_101014232 241
65 3300009545 Ga0105237_10034382 Ga0105237_100343822 241
66 3300010375 Ga0105239_10006964 Ga0105239_100069642 241
67 3300025913 Ga0207695_10000164 Ga0207695_10000164121 241
68 3300025913 Ga0207695_10019581 Ga0207695_100195816 241
69 3300025914 Ga0207671_10060482 Ga0207671_100604822 241
70 3300025986 Ga0207658_10366593 Ga0207658_103665932 241
71 3300026041 Ga0207639_10001566 Ga0207639_1000156610 241
72 3300028786 Ga0307517_10000129 Ga0307517_1000012927 241
73 3300033180 Ga0307510_10000544 Ga0307510_100005447 241
74 3300046500 Ga0495596_0066164 Ga0495596_0066164_154_879 241
75 3300046518 Ga0495631_0002836 Ga0495631_0002836_1682_2407 241
76 3300046660 Ga0495625_0268499 Ga0495625_0268499_342_1067 241
77 3300047323 Ga0495683_0031009 Ga0495683_0031009_1673_2398 241
78 3300053122 Ga0500608_000244 Ga0500608_000244_11565_12290 241
79 3300009093 Ga0105240_10038050 Ga0105240_100380503 242
80 3300009098 Ga0105245_10140222 Ga0105245_101402222 242
81 3300009174 Ga0105241_10131067 Ga0105241_101310672 242
82 3300009174 Ga0105241_10419791 Ga0105241_104197911 242
83 3300009545 Ga0105237_10040616 Ga0105237_100406164 242
84 3300009551 Ga0105238_10574575 Ga0105238_105745752 242
85 3300010375 Ga0105239_10009313 Ga0105239_100093137 242
86 3300025913 Ga0207695_10006874 Ga0207695_100068746 242
87 3300025914 Ga0207671_10059924 Ga0207671_100599242 242
88 3300031507 Ga0307509_10097024 Ga0307509_100970242 242
89 3300047472 Ga0495686_0000712 Ga0495686_0000712_34499_35254 242
90 3300005338 Ga0068868_100089146 Ga0068868_1000891462 243
91 3300005367 Ga0070667_100103668 Ga0070667_1001036682 243
92 3300005563 Ga0068855_100078355 Ga0068855_1000783552 243
93 3300005614 Ga0068856_100505074 Ga0068856_1005050742 243
94 3300005843 Ga0068860_100000005 Ga0068860_10000000568 243
95 3300006237 Ga0097621_100758908 Ga0097621_1007589082 243
96 3300009093 Ga0105240_10001525 Ga0105240_1000152533 243
97 3300009093 Ga0105240_10008491 Ga0105240_100084912 243
98 3300009174 Ga0105241_10002091 Ga0105241_100020914 243
99 3300009545 Ga0105237_10002312 Ga0105237_100023124 243
100 3300009545 Ga0105237_10130614 Ga0105237_101306142 243
101 3300009551 Ga0105238_10001854 Ga0105238_100018545 243
102 3300009553 Ga0105249_10121704 Ga0105249_101217042 243
103 3300010375 Ga0105239_10002220 Ga0105239_1000222020 243
104 3300010375 Ga0105239_10173118 Ga0105239_101731182 243
105 3300013306 Ga0163162_10004561 Ga0163162_1000456111 243
106 3300025903 Ga0207680_10058938 Ga0207680_100589381 243
107 3300025911 Ga0207654_10016088 Ga0207654_100160882 243
108 3300025911 Ga0207654_10115884 Ga0207654_101158842 243
109 3300025913 Ga0207695_10002078 Ga0207695_100020782 243
110 3300025913 Ga0207695_10039756 Ga0207695_100397562 243
111 3300025914 Ga0207671_10034820 Ga0207671_100348202 243
112 3300025961 Ga0207712_10102813 Ga0207712_101028132 243
113 3300025986 Ga0207658_10424324 Ga0207658_104243242 243
114 3300028381 Ga0268264_10000012 Ga0268264_1000001250 243
115 3300041458 Ga0451798_0096896 Ga0451798_0096896_232_981 243
116 3300041460 Ga0451802_1062602 Ga0451802_1062602_77_811 243
117 3300047443 Ga0495687_000243 Ga0495687_000243_44254_45000 243
118 3300002077 JGI24744J21845_10008133 JGI24744J21845_100081332 244
119 3300002741 JGI25157J39369_1010709 JGI25157J39369_10107091 244
120 3300003320 rootH2_10028784 rootH2_100287847 244
121 3300003320 rootH2_10088470 rootH2_100884703 244
122 3300003322 rootL2_10008330 rootL2_100083309 244
123 3300003322 rootL2_10010994 rootL2_1001099414 244
124 3300003322 rootL2_10273601 rootL2_102736012 244
125 3300003323 rootH1_10036893 rootH1_100368932 244
126 3300003323 rootH1_10126146 rootH1_101261462 244
127 3300003354 JGI25160J50197_1015497 JGI25160J50197_10154972 244
128 3300005288 Ga0065714_10080564 Ga0065714_100805641 244
129 3300005327 Ga0070658_10046545 Ga0070658_100465453 244
130 3300005327 Ga0070658_10616580 Ga0070658_106165802 244
131 3300005328 Ga0070676_10000015 Ga0070676_1000001515 244
132 3300005329 Ga0070683_100125562 Ga0070683_1001255622 244
133 3300005334 Ga0068869_100522855 Ga0068869_1005228551 244
134 3300005338 Ga0068868_100027235 Ga0068868_1000272352 244
135 3300005338 Ga0068868_100103141 Ga0068868_1001031412 244
136 3300005339 Ga0070660_100029257 Ga0070660_1000292574 244
137 3300005339 Ga0070660_100196864 Ga0070660_1001968642 244
138 3300005340 Ga0070689_100362545 Ga0070689_1003625452 244
139 3300005364 Ga0070673_100002607 Ga0070673_1000026076 244
140 3300005366 Ga0070659_100010930 Ga0070659_1000109303 244
141 3300005366 Ga0070659_100066247 Ga0070659_1000662472 244
142 3300005456 Ga0070678_100000121 Ga0070678_10000012119 244
143 3300005457 Ga0070662_100001108 Ga0070662_1000011087 244
144 3300005459 Ga0068867_100000210 Ga0068867_1000002106 244
145 3300005539 Ga0068853_100046732 Ga0068853_1000467323 244
146 3300005539 Ga0068853_100064695 Ga0068853_1000646952 244
147 3300005543 Ga0070672_100082963 Ga0070672_1000829632 244
148 3300005614 Ga0068856_100003301 Ga0068856_1000033012 244
149 3300005616 Ga0068852_100003100 Ga0068852_1000031005 244
150 3300005718 Ga0068866_10154474 Ga0068866_101544742 244
151 3300006195 Ga0075366_10001082 Ga0075366_100010822 244
152 3300006237 Ga0097621_100000308 Ga0097621_10000030829 244
153 3300006237 Ga0097621_100440823 Ga0097621_1004408232 244
154 3300006358 Ga0068871_100000046 Ga0068871_10000004640 244
155 3300006881 Ga0068865_100000041 Ga0068865_10000004158 244
156 3300009093 Ga0105240_10000100 Ga0105240_1000010013 244
157 3300009093 Ga0105240_10003673 Ga0105240_1000367317 244
158 3300009093 Ga0105240_10010765 Ga0105240_1001076510 244
159 3300009093 Ga0105240_10145712 Ga0105240_101457122 244
160 3300009093 Ga0105240_10280301 Ga0105240_102803012 244
161 3300009098 Ga0105245_10399219 Ga0105245_103992192 244
162 3300009174 Ga0105241_10000924 Ga0105241_1000092416 244
163 3300009174 Ga0105241_10016943 Ga0105241_100169432 244
164 3300009176 Ga0105242_10009234 Ga0105242_100092344 244
165 3300009545 Ga0105237_10001001 Ga0105237_1000100114 244
166 3300009545 Ga0105237_10002166 Ga0105237_1000216619 244
167 3300009545 Ga0105237_10022817 Ga0105237_100228173 244
168 3300009545 Ga0105237_10200219 Ga0105237_102002192 244
169 3300009545 Ga0105237_10276615 Ga0105237_102766152 244
170 3300009551 Ga0105238_10002309 Ga0105238_1000230915 244
171 3300009551 Ga0105238_10011946 Ga0105238_100119463 244
172 3300010375 Ga0105239_10000004 Ga0105239_10000004323 244
173 3300010375 Ga0105239_10000811 Ga0105239_1000081137 244
174 3300010375 Ga0105239_10019355 Ga0105239_100193555 244
175 3300010375 Ga0105239_10051186 Ga0105239_100511864 244
176 3300013100 Ga0157373_10000075 Ga0157373_1000007517 244
177 3300013105 Ga0157369_10018288 Ga0157369_100182884 244
178 3300013296 Ga0157374_10000137 Ga0157374_1000013732 244
179 3300013296 Ga0157374_10000563 Ga0157374_100005635 244
180 3300013296 Ga0157374_10130199 Ga0157374_101301992 244
181 3300013297 Ga0157378_10054759 Ga0157378_100547591 244
182 3300013297 Ga0157378_10121085 Ga0157378_101210852 244
183 3300013307 Ga0157372_10009428 Ga0157372_100094284 244
184 3300013307 Ga0157372_10093070 Ga0157372_100930704 244
185 3300013307 Ga0157372_10304168 Ga0157372_103041682 244
186 3300013308 Ga0157375_10155412 Ga0157375_101554122 244
187 3300013308 Ga0157375_10798617 Ga0157375_107986172 244
188 3300014325 Ga0163163_10354798 Ga0163163_103547981 244
189 3300014497 Ga0182008_10015988 Ga0182008_100159882 244
190 3300014497 Ga0182008_10025225 Ga0182008_100252253 244
191 3300015262 Ga0182007_10009432 Ga0182007_100094322 244
192 3300025250 Ga0209026_1000416 Ga0209026_100041618 244
193 3300025250 Ga0209026_1001554 Ga0209026_10015545 244
194 3300025272 Ga0209455_1003039 Ga0209455_10030395 244
195 3300025298 Ga0209050_1001790 Ga0209050_100179013 244
196 3300025298 Ga0209050_1011153 Ga0209050_10111534 244
197 3300025302 Ga0207426_1000002 Ga0207426_1000002536 244
198 3300025899 Ga0207642_10120152 Ga0207642_101201522 244
199 3300025904 Ga0207647_10000049 Ga0207647_1000004948 244
200 3300025907 Ga0207645_10000058 Ga0207645_1000005865 244
201 3300025911 Ga0207654_10008988 Ga0207654_100089882 244
202 3300025911 Ga0207654_10012292 Ga0207654_100122922 244
203 3300025911 Ga0207654_10038582 Ga0207654_100385822 244
204 3300025913 Ga0207695_10000027 Ga0207695_10000027350 244
205 3300025913 Ga0207695_10000055 Ga0207695_10000055100 244
206 3300025913 Ga0207695_10024242 Ga0207695_100242424 244
207 3300025913 Ga0207695_10214485 Ga0207695_102144852 244
208 3300025914 Ga0207671_10000259 Ga0207671_1000025935 244
209 3300025914 Ga0207671_10000584 Ga0207671_1000058436 244
210 3300025914 Ga0207671_10000905 Ga0207671_1000090512 244
211 3300025914 Ga0207671_10019863 Ga0207671_100198634 244
212 3300025919 Ga0207657_10096760 Ga0207657_100967602 244
213 3300025919 Ga0207657_10131436 Ga0207657_101314362 244
214 3300025924 Ga0207694_10071563 Ga0207694_100715633 244
215 3300025924 Ga0207694_10164553 Ga0207694_101645532 244
216 3300025924 Ga0207694_10251055 Ga0207694_102510552 244
217 3300025932 Ga0207690_10025769 Ga0207690_100257693 244
218 3300025933 Ga0207706_10000111 Ga0207706_1000011147 244
219 3300025934 Ga0207686_10013720 Ga0207686_100137205 244
220 3300025938 Ga0207704_10000152 Ga0207704_1000015223 244
221 3300025940 Ga0207691_10073778 Ga0207691_100737782 244
222 3300025949 Ga0207667_10049187 Ga0207667_100491873 244
223 3300025960 Ga0207651_10037927 Ga0207651_100379272 244
224 3300026023 Ga0207677_10016363 Ga0207677_100163634 244
225 3300026023 Ga0207677_10080246 Ga0207677_100802462 244
226 3300026041 Ga0207639_10034951 Ga0207639_100349512 244
227 3300026078 Ga0207702_10070550 Ga0207702_100705502 244
228 3300026078 Ga0207702_10576601 Ga0207702_105766012 244
229 3300026089 Ga0207648_10001009 Ga0207648_100010094 244
230 3300026121 Ga0207683_10046348 Ga0207683_100463483 244
231 3300026142 Ga0207698_10004294 Ga0207698_100042944 244
232 3300030521 Ga0307511_10000539 Ga0307511_100005399 244
233 3300030731 Ga0316177_1182232 Ga0316177_11822323 244
234 3300030732 Ga0316176_1080765 Ga0316176_10807653 244
235 3300030742 Ga0316183_1115386 Ga0316183_111538617 244
236 3300030744 Ga0316181_1016495 Ga0316181_10164956 244
237 3300030744 Ga0316181_1269313 Ga0316181_12693132 244
238 3300031456 Ga0307513_10168020 Ga0307513_101680202 244
239 3300031824 Ga0307413_10231768 Ga0307413_102317682 244
240 3300031911 Ga0307412_10088646 Ga0307412_100886462 244
241 3300032004 Ga0307414_10683404 Ga0307414_106834041 244
242 3300033180 Ga0307510_10003389 Ga0307510_100033892 244
243 3300037312 Ga0395899_0000446 Ga0395899_0000446_26142_26882 244
244 3300037312 Ga0395899_0049126 Ga0395899_0049126_963_1697 244
245 3300037418 Ga0395900_0000554 Ga0395900_0000554_45791_46531 244
246 3300037418 Ga0395900_0002467 Ga0395900_0002467_9800_10534 244
247 3300037466 Ga0395898_0016652 Ga0395898_0016652_4625_5359 244
248 3300037471 Ga0395905_0000246 Ga0395905_0000246_45624_46364 244
249 3300037471 Ga0395905_0005177 Ga0395905_0005177_4540_5274 244
250 3300037471 Ga0395905_0700916 Ga0395905_0700916_72_809 244
251 3300038443 Ga0395901_0000184 Ga0395901_0000184_45565_46305 244
252 3300038443 Ga0395901_0004208 Ga0395901_0004208_7176_7910 244
253 3300039447 Ga0436361_0137765 Ga0436361_0137765_2995_3735 244
254 3300042005 Ga0439448_0014484 Ga0439448_0014484_650_1390 244
255 3300046460 Ga0495638_0000015 Ga0495638_0000015_296113_296847 244
256 3300046460 Ga0495638_0064722 Ga0495638_0064722_615_1358 244
257 3300046529 Ga0495652_0184805 Ga0495652_0184805_641_1384 244
258 3300046616 Ga0495668_0002782 Ga0495668_0002782_11518_12261 244
259 3300046660 Ga0495625_0063530 Ga0495625_0063530_1596_2336 244
260 3300047472 Ga0495686_0105029 Ga0495686_0105029_110_847 244
261 3300049570 Ga0501033_0052643 Ga0501033_0052643_1063_1809 244
262 3300050493 nmdc:mga0k408_402_c1 nmdc:mga0k408_402_c1_11457_12194 244
263 3300053105 Ga0500557_012380 Ga0500557_012380_1163_1897 244
264 3300053136 Ga0500559_0011620 Ga0500559_0011620_2081_2815 244
265 3300053151 Ga0500604_0012167 Ga0500604_0012167_834_1571 244
266 3300053156 Ga0500622_0011422 Ga0500622_0011422_1150_1890 244
267 3300053178 Ga0500637_0044594 Ga0500637_0044594_637_1380 244
268 3300053730 Ga0500645_062543 Ga0500645_062543_222_959 244
269 3300001979 JGI24740J21852_10026251 JGI24740J21852_100262512 245
270 3300005455 Ga0070663_100051799 Ga0070663_1000517992 245
271 3300013104 Ga0157370_10264913 Ga0157370_102649132 245
272 3300013105 Ga0157369_10000516 Ga0157369_1000051611 245
273 3300013307 Ga0157372_10000010 Ga0157372_10000010117 245
274 3300026067 Ga0207678_10073395 Ga0207678_100733953 245
275 3300037312 Ga0395899_0000409 Ga0395899_0000409_13919_14656 245
276 3300044656 Ga0466969_0030432 Ga0466969_0030432_1540_2277 245
277 3300044693 Ga0466961_0142959 Ga0466961_0142959_363_1100 245
278 3300044719 Ga0466971_0160981 Ga0466971_0160981_173_910 245
279 3300045836 Ga0466958_0142933 Ga0466958_0142933_253_990 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

3

84

0.97

PF02754

CCG

Cysteine-rich domain

152

247

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q0h-assembly1.cif.gz_A crystal structure of selenomethionine-labelled dxr in complex with fosmidomycin 0.8708 200 237
1jvs-assembly1.cif.gz_B crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs 0.8626 200 237
1ono-assembly1.cif.gz_A ispc mn2+ complex 0.841 200 237
5dul-assembly1.cif.gz_B 1-deoxy-d-xylulose 5-phosphate reductoisomerase from yersinia pestis in complex with nadph 0.8289 197 237
1k5h-assembly2.cif.gz_B 1-deoxy-d-xylulose-5-phosphate reductoisomerase 0.8089 197 237
ID Description Score Start End Superfamily
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9451 4 82 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.91 4 82 3.40.30.10
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8915 4 82 3.40.30.10
af_P0A996_163_249_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8804 4 82 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8412 129 222 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D3PBI6-F1-model_v4 Fe-S oxidoreductase 0.9965 1 84 GO:0005829
GO:0016491
AF-R9GTX2-F1-model_v4 Putative L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE 0.9898 1 106 GO:0005829
GO:0016491
AF-A0A3D3PBI6-F1-model_v4 Fe-S oxidoreductase 0.9734 1 84 GO:0005829
GO:0016491
AF-A0A258JFC9-F1-model_v4 Fe-S oxidoreductase 0.9633 1 167 GO:0005829
GO:0016491
AF-A0A520AGB4-F1-model_v4 (Fe-S)-binding protein 0.9614 1 245 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.29 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map