F382768
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 134 | 272 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10002022|JGI24737J22298_100020223 |
| Length | 228 |
| Sequence | MKRSILGVSGLAVAAVVAGSIAWLGFERERAPAAATAVKGAPRAAIPSPEPAPPAAGRIMLSPAQLDEAIAAGLVDRPVKSLLDVPERMTYGQFVWNDRGVAPGPVWVRVDLGSQILSVFRSGHEIGTAVILYGTDGLPTPTGKFPILAKLKDHRSATYGDAPMPYTLRLTPDGVAIHGSNVRWGFATHGCVGVPKAFAAKIFDAVSTGDEVVIVSERAAQKNEVSAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 52 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 87 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 88 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 89 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 93 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 95 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 96 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 97 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 101 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 102 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 103 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 104 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 105 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 106 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 107 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 108 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 124 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 129 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.96 |
| Rhizosphere | 89.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10002022 | 3300001990 | Bacteria | 7247 |
| 2 | rootL2_10315959 | 3300003322 | Unclassified | 1199 |
| 3 | rootH1_10138591 | 3300003323 | Bacteria | 5807 |
| 4 | Ga0070658_10015356 | 3300005327 | Bacteria | 6129 |
| 5 | Ga0070658_10018600 | 3300005327 | Bacteria | 5564 |
| 6 | Ga0070658_10071184 | 3300005327 | Bacteria | 2848 |
| 7 | Ga0070658_10111542 | 3300005327 | Bacteria | 2266 |
| 8 | Ga0070658_10180655 | 3300005327 | Unclassified | 1775 |
| 9 | Ga0070658_10472655 | 3300005327 | Bacteria | 1081 |
| 10 | Ga0070658_10727901 | 3300005327 | Bacteria | 861 |
| 11 | Ga0070670_100006312 | 3300005331 | Bacteria | 10037 |
| 12 | Ga0070677_10016999 | 3300005333 | Bacteria | 2598 |
| 13 | Ga0070666_10040709 | 3300005335 | Bacteria | 3102 |
| 14 | Ga0070666_10081772 | 3300005335 | Bacteria | 2209 |
| 15 | Ga0070680_100101658 | 3300005336 | Bacteria | 2386 |
| 16 | Ga0068868_100006919 | 3300005338 | Bacteria | 8058 |
| 17 | Ga0068868_100034449 | 3300005338 | Bacteria | 3909 |
| 18 | Ga0070660_100004780 | 3300005339 | Bacteria | 9365 |
| 19 | Ga0070660_100059473 | 3300005339 | Unclassified | 2963 |
| 20 | Ga0070660_100228370 | 3300005339 | Unclassified | 1514 |
| 21 | Ga0070661_100109738 | 3300005344 | Bacteria | 2059 |
| 22 | Ga0070671_100012742 | 3300005355 | Bacteria | 6778 |
| 23 | Ga0070671_100049958 | 3300005355 | Bacteria | 3479 |
| 24 | Ga0070671_100186735 | 3300005355 | Bacteria | 1756 |
| 25 | Ga0070674_100026769 | 3300005356 | Bacteria | 3771 |
| 26 | Ga0070674_100310012 | 3300005356 | Bacteria | 1261 |
| 27 | Ga0070674_100831752 | 3300005356 | Bacteria | 799 |
| 28 | Ga0070673_100033421 | 3300005364 | Bacteria | 3884 |
| 29 | Ga0070673_100074593 | 3300005364 | Bacteria | 2734 |
| 30 | Ga0070673_100389462 | 3300005364 | Bacteria | 1244 |
| 31 | Ga0070659_100002128 | 3300005366 | Bacteria | 14118 |
| 32 | Ga0070659_100046016 | 3300005366 | Bacteria | 3420 |
| 33 | Ga0070659_100068240 | 3300005366 | Bacteria | 2820 |
| 34 | Ga0070659_100295987 | 3300005366 | Bacteria | 1348 |
| 35 | Ga0070659_100474832 | 3300005366 | Unclassified | 1063 |
| 36 | Ga0070667_100163804 | 3300005367 | Bacteria | 1960 |
| 37 | Ga0070714_100601886 | 3300005435 | Unclassified | 1056 |
| 38 | Ga0070713_100361589 | 3300005436 | Unclassified | 1349 |
| 39 | Ga0070663_100205450 | 3300005455 | Bacteria | 1539 |
| 40 | Ga0070678_100078953 | 3300005456 | Bacteria | 2488 |
| 41 | Ga0070662_100005161 | 3300005457 | Bacteria | 8327 |
| 42 | Ga0070662_100070711 | 3300005457 | Bacteria | 2571 |
| 43 | Ga0070662_100295052 | 3300005457 | Bacteria | 1315 |
| 44 | Ga0068867_100115041 | 3300005459 | Unclassified | 2071 |
| 45 | Ga0070679_100082480 | 3300005530 | Bacteria | 3205 |
| 46 | Ga0070679_100397860 | 3300005530 | Unclassified | 1323 |
| 47 | Ga0070684_100999337 | 3300005535 | Bacteria | 785 |
| 48 | Ga0068853_100168287 | 3300005539 | Bacteria | 1982 |
| 49 | Ga0070672_100071653 | 3300005543 | Bacteria | 2757 |
| 50 | Ga0070672_100561895 | 3300005543 | Bacteria | 991 |
| 51 | Ga0068855_100059111 | 3300005563 | Bacteria | 4486 |
| 52 | Ga0070664_100007940 | 3300005564 | Bacteria | 8571 |
| 53 | Ga0070664_100133833 | 3300005564 | Unclassified | 2178 |
| 54 | Ga0070664_100245091 | 3300005564 | Bacteria | 1610 |
| 55 | Ga0070664_100756052 | 3300005564 | Bacteria | 907 |
| 56 | Ga0068857_100291322 | 3300005577 | Bacteria | 1503 |
| 57 | Ga0068854_100048625 | 3300005578 | Bacteria | 3026 |
| 58 | Ga0068852_100203233 | 3300005616 | Bacteria | 1875 |
| 59 | Ga0068852_100258752 | 3300005616 | Bacteria | 1670 |
| 60 | Ga0068852_100335349 | 3300005616 | Bacteria | 1472 |
| 61 | Ga0068852_100632785 | 3300005616 | Bacteria | 1076 |
| 62 | Ga0068864_100006950 | 3300005618 | Bacteria | 9281 |
| 63 | Ga0068864_100192742 | 3300005618 | Bacteria | 1869 |
| 64 | Ga0068864_100335935 | 3300005618 | Bacteria | 1422 |
| 65 | Ga0068866_10039982 | 3300005718 | Unclassified | 2319 |
| 66 | Ga0068851_10009488 | 3300005834 | Bacteria | 4527 |
| 67 | Ga0068851_10339052 | 3300005834 | Unclassified | 872 |
| 68 | Ga0068863_100201374 | 3300005841 | Bacteria | 1915 |
| 69 | Ga0068860_100905667 | 3300005843 | Unclassified | 898 |
| 70 | Ga0070717_10338792 | 3300006028 | Unclassified | 1342 |
| 71 | Ga0068865_100022662 | 3300006881 | Bacteria | 4101 |
| 72 | Ga0105245_10137152 | 3300009098 | Bacteria | 2300 |
| 73 | Ga0105248_10042414 | 3300009177 | Bacteria | 5102 |
| 74 | Ga0105248_10224077 | 3300009177 | Bacteria | 2117 |
| 75 | Ga0105248_10315861 | 3300009177 | Bacteria | 1760 |
| 76 | Ga0105248_10548355 | 3300009177 | Bacteria | 1304 |
| 77 | Ga0105248_10675424 | 3300009177 | Bacteria | 1165 |
| 78 | Ga0105238_10211463 | 3300009551 | Bacteria | 1916 |
| 79 | Ga0157371_10147634 | 3300013102 | Unclassified | 1676 |
| 80 | Ga0157370_10209758 | 3300013104 | Unclassified | 1806 |
| 81 | Ga0157374_10049219 | 3300013296 | Bacteria | 3914 |
| 82 | Ga0157374_10252127 | 3300013296 | Bacteria | 1737 |
| 83 | Ga0157374_10435109 | 3300013296 | Bacteria | 1312 |
| 84 | Ga0157374_10692311 | 3300013296 | Bacteria | 1032 |
| 85 | Ga0157372_10136617 | 3300013307 | Unclassified | 2824 |
| 86 | Ga0157372_10146672 | 3300013307 | Bacteria | 2721 |
| 87 | Ga0157372_11798663 | 3300013307 | Unclassified | 705 |
| 88 | Ga0157375_10048094 | 3300013308 | Bacteria | 4170 |
| 89 | Ga0163163_10768298 | 3300014325 | Bacteria | 1027 |
| 90 | Ga0182008_10275220 | 3300014497 | Unclassified | 874 |
| 91 | Ga0157377_10528643 | 3300014745 | Bacteria | 829 |
| 92 | Ga0163161_10118556 | 3300017792 | Bacteria | 1986 |
| 93 | Ga0213876_10027501 | 3300021384 | Bacteria | 3000 |
| 94 | Ga0207656_10230884 | 3300025321 | Unclassified | 902 |
| 95 | Ga0207656_10325358 | 3300025321 | Bacteria | 764 |
| 96 | Ga0207682_10094333 | 3300025893 | Bacteria | 1302 |
| 97 | Ga0207642_10226588 | 3300025899 | Bacteria | 1048 |
| 98 | Ga0207647_10022432 | 3300025904 | Bacteria | 4193 |
| 99 | Ga0207647_10301550 | 3300025904 | Unclassified | 912 |
| 100 | Ga0207705_10005854 | 3300025909 | Bacteria | 9151 |
| 101 | Ga0207705_10147945 | 3300025909 | Unclassified | 1758 |
| 102 | Ga0207705_10370588 | 3300025909 | Bacteria | 1105 |
| 103 | Ga0207657_10000868 | 3300025919 | Bacteria | 31880 |
| 104 | Ga0207657_10009689 | 3300025919 | Bacteria | 9664 |
| 105 | Ga0207657_10012092 | 3300025919 | Bacteria | 8530 |
| 106 | Ga0207657_10078377 | 3300025919 | Bacteria | 2782 |
| 107 | Ga0207649_10094112 | 3300025920 | Bacteria | 1968 |
| 108 | Ga0207649_10290599 | 3300025920 | Bacteria | 1192 |
| 109 | Ga0207649_10343141 | 3300025920 | Bacteria | 1103 |
| 110 | Ga0207652_10031744 | 3300025921 | Bacteria | 4436 |
| 111 | Ga0207652_10329605 | 3300025921 | Bacteria | 1378 |
| 112 | Ga0207687_10174502 | 3300025927 | Bacteria | 1660 |
| 113 | Ga0207664_10488075 | 3300025929 | Unclassified | 1102 |
| 114 | Ga0207644_10007676 | 3300025931 | Bacteria | 7036 |
| 115 | Ga0207644_10018189 | 3300025931 | Bacteria | 4752 |
| 116 | Ga0207644_10097914 | 3300025931 | Bacteria | 2198 |
| 117 | Ga0207644_10302877 | 3300025931 | Unclassified | 1288 |
| 118 | Ga0207706_10003091 | 3300025933 | Bacteria | 15997 |
| 119 | Ga0207706_10003606 | 3300025933 | Bacteria | 14782 |
| 120 | Ga0207706_10012636 | 3300025933 | Bacteria | 7687 |
| 121 | Ga0207706_10195715 | 3300025933 | Bacteria | 1773 |
| 122 | Ga0207669_10148718 | 3300025937 | Bacteria | 1637 |
| 123 | Ga0207669_10404913 | 3300025937 | Bacteria | 1070 |
| 124 | Ga0207691_10262878 | 3300025940 | Bacteria | 1487 |
| 125 | Ga0207691_10288298 | 3300025940 | Bacteria | 1412 |
| 126 | Ga0207711_10038491 | 3300025941 | Bacteria | 4067 |
| 127 | Ga0207689_10121774 | 3300025942 | Bacteria | 2145 |
| 128 | Ga0207661_10073344 | 3300025944 | Unclassified | 2803 |
| 129 | Ga0207679_10008246 | 3300025945 | Bacteria | 6634 |
| 130 | Ga0207667_10503366 | 3300025949 | Bacteria | 1228 |
| 131 | Ga0207667_10961099 | 3300025949 | Bacteria | 843 |
| 132 | Ga0207651_10066951 | 3300025960 | Bacteria | 2526 |
| 133 | Ga0207651_10293045 | 3300025960 | Bacteria | 1350 |
| 134 | Ga0207640_10008451 | 3300025981 | Bacteria | 5720 |
| 135 | Ga0207658_10151186 | 3300025986 | Bacteria | 1892 |
| 136 | Ga0207677_10006194 | 3300026023 | Bacteria | 6539 |
| 137 | Ga0207639_10350653 | 3300026041 | Unclassified | 1318 |
| 138 | Ga0207678_10001124 | 3300026067 | Bacteria | 24510 |
| 139 | Ga0207678_10007594 | 3300026067 | Bacteria | 9580 |
| 140 | Ga0207678_10017319 | 3300026067 | Bacteria | 6325 |
| 141 | Ga0207678_10027596 | 3300026067 | Bacteria | 4954 |
| 142 | Ga0207702_10143831 | 3300026078 | Bacteria | 2161 |
| 143 | Ga0207641_10233383 | 3300026088 | Bacteria | 1711 |
| 144 | Ga0207641_10509207 | 3300026088 | Bacteria | 1170 |
| 145 | Ga0207648_10013681 | 3300026089 | Bacteria | 7534 |
| 146 | Ga0207648_10084540 | 3300026089 | Bacteria | 2768 |
| 147 | Ga0207648_10700349 | 3300026089 | Bacteria | 939 |
| 148 | Ga0207676_10020058 | 3300026095 | Bacteria | 4886 |
| 149 | Ga0207676_10124251 | 3300026095 | Bacteria | 2182 |
| 150 | Ga0207674_10003653 | 3300026116 | Bacteria | 18761 |
| 151 | Ga0207674_10011384 | 3300026116 | Bacteria | 9996 |
| 152 | Ga0207674_10115045 | 3300026116 | Unclassified | 2661 |
| 153 | Ga0207698_10438837 | 3300026142 | Bacteria | 1257 |
| 154 | Ga0207698_10495386 | 3300026142 | Bacteria | 1188 |
| 155 | Ga0307405_10543027 | 3300031731 | Bacteria | 939 |
| 156 | Ga0307410_10006913 | 3300031852 | Bacteria | 6166 |
| 157 | Ga0307410_10338874 | 3300031852 | Bacteria | 1198 |
| 158 | Ga0307406_10044326 | 3300031901 | Bacteria | 2787 |
| 159 | Ga0307407_10342501 | 3300031903 | Unclassified | 1056 |
| 160 | Ga0307409_100016717 | 3300031995 | Bacteria | 4865 |
| 161 | Ga0307416_100116479 | 3300032002 | Bacteria | 2369 |
| 162 | Ga0307414_10143342 | 3300032004 | Bacteria | 1874 |
| 163 | Ga0307411_10007041 | 3300032005 | Bacteria | 5687 |
| 164 | Ga0307411_10101250 | 3300032005 | Bacteria | 2038 |
| 165 | Ga0307415_100010002 | 3300032126 | Bacteria | 5351 |
| 166 | Ga0373961_0110634 | 3300035241 | Bacteria | 900 |
| 167 | Ga0373937_0512942 | 3300036401 | Unclassified | 1139 |
| 168 | Ga0395899_0000632 | 3300037312 | Bacteria | 36585 |
| 169 | Ga0395899_0154563 | 3300037312 | Bacteria | 1624 |
| 170 | Ga0395899_0333298 | 3300037312 | Bacteria | 1019 |
| 171 | Ga0395900_0000075 | 3300037418 | Bacteria | 183525 |
| 172 | Ga0395900_0003156 | 3300037418 | Bacteria | 17867 |
| 173 | Ga0395900_0067640 | 3300037418 | Unclassified | 3670 |
| 174 | Ga0395900_0078722 | 3300037418 | Bacteria | 3387 |
| 175 | Ga0395900_0255347 | 3300037418 | Bacteria | 1752 |
| 176 | Ga0395900_0255658 | 3300037418 | Bacteria | 1751 |
| 177 | Ga0395900_0260163 | 3300037418 | Unclassified | 1733 |
| 178 | Ga0395900_0262403 | 3300037418 | Bacteria | 1724 |
| 179 | Ga0395900_0663717 | 3300037418 | Bacteria | 978 |
| 180 | Ga0395900_0726544 | 3300037418 | Bacteria | 925 |
| 181 | Ga0395900_0906975 | 3300037418 | Bacteria | 804 |
| 182 | Ga0395898_0000055 | 3300037466 | Bacteria | 278557 |
| 183 | Ga0395898_0036770 | 3300037466 | Bacteria | 4860 |
| 184 | Ga0395898_0066006 | 3300037466 | Bacteria | 3507 |
| 185 | Ga0395898_0146424 | 3300037466 | Bacteria | 2260 |
| 186 | Ga0395898_0620564 | 3300037466 | Unclassified | 1024 |
| 187 | Ga0395905_0000067 | 3300037471 | Bacteria | 181887 |
| 188 | Ga0395905_0028242 | 3300037471 | Bacteria | 5288 |
| 189 | Ga0395905_0039213 | 3300037471 | Bacteria | 4444 |
| 190 | Ga0395905_0043629 | 3300037471 | Bacteria | 4207 |
| 191 | Ga0395905_0049531 | 3300037471 | Bacteria | 3936 |
| 192 | Ga0395905_0068011 | 3300037471 | Bacteria | 3337 |
| 193 | Ga0395905_0068966 | 3300037471 | Bacteria | 3312 |
| 194 | Ga0395905_0079312 | 3300037471 | Bacteria | 3077 |
| 195 | Ga0395905_0080481 | 3300037471 | Bacteria | 3053 |
| 196 | Ga0395905_0126166 | 3300037471 | Bacteria | 2406 |
| 197 | Ga0395905_0131860 | 3300037471 | Bacteria | 2350 |
| 198 | Ga0395905_0141760 | 3300037471 | Bacteria | 2261 |
| 199 | Ga0395905_0182456 | 3300037471 | Bacteria | 1970 |
| 200 | Ga0395905_0236032 | 3300037471 | Bacteria | 1709 |
| 201 | Ga0395905_0925948 | 3300037471 | Bacteria | 774 |
| 202 | Ga0395901_0000477 | 3300038443 | Bacteria | 46511 |
| 203 | Ga0395901_0020761 | 3300038443 | Bacteria | 6724 |
| 204 | Ga0395901_0064316 | 3300038443 | Bacteria | 3818 |
| 205 | Ga0395901_0122684 | 3300038443 | Bacteria | 2730 |
| 206 | Ga0395901_0122864 | 3300038443 | Bacteria | 2728 |
| 207 | Ga0395901_0124169 | 3300038443 | Bacteria | 2713 |
| 208 | Ga0395901_0141124 | 3300038443 | Bacteria | 2532 |
| 209 | Ga0395901_0168527 | 3300038443 | Bacteria | 2298 |
| 210 | Ga0395901_0264168 | 3300038443 | Bacteria | 1791 |
| 211 | Ga0395901_0604647 | 3300038443 | Bacteria | 1105 |
| 212 | Ga0395901_0636820 | 3300038443 | Unclassified | 1071 |
| 213 | Ga0395901_0686909 | 3300038443 | Unclassified | 1023 |
| 214 | Ga0436365_0635045 | 3300039437 | Bacteria | 4255 |
| 215 | Ga0439448_0002525 | 3300042005 | Bacteria | 4986 |
| 216 | Ga0439455_0015153 | 3300042012 | Unclassified | 1770 |
| 217 | Ga0439458_0003440 | 3300042157 | Bacteria | 3703 |
| 218 | Ga0466966_0029553 | 3300044684 | Unclassified | 3564 |
| 219 | Ga0466966_0089076 | 3300044684 | Bacteria | 1917 |
| 220 | Ga0466961_0105267 | 3300044693 | Unclassified | 1776 |
| 221 | Ga0466961_0245332 | 3300044693 | Bacteria | 1100 |
| 222 | Ga0466964_0006327 | 3300044706 | Bacteria | 4410 |
| 223 | Ga0466971_0160890 | 3300044719 | Unclassified | 1051 |
| 224 | Ga0466968_0003735 | 3300044735 | Bacteria | 5644 |
| 225 | Ga0466970_0024589 | 3300044765 | Bacteria | 3151 |
| 226 | Ga0466970_0038764 | 3300044765 | Bacteria | 2528 |
| 227 | Ga0466970_0378693 | 3300044765 | Bacteria | 805 |
| 228 | Ga0466957_0441827 | 3300044842 | Bacteria | 895 |
| 229 | Ga0466960_0015252 | 3300044901 | Bacteria | 3309 |
| 230 | Ga0466959_0097392 | 3300045049 | Unclassified | 2108 |
| 231 | Ga0466959_0135500 | 3300045049 | Bacteria | 1743 |
| 232 | Ga0466959_0207991 | 3300045049 | Bacteria | 1360 |
| 233 | Ga0466958_0054695 | 3300045836 | Unclassified | 2421 |
| 234 | Ga0466958_0068899 | 3300045836 | Bacteria | 2163 |
| 235 | Ga0466958_0138158 | 3300045836 | Bacteria | 1533 |
| 236 | Ga0466958_0139516 | 3300045836 | Bacteria | 1525 |
| 237 | Ga0466967_0096830 | 3300045976 | Bacteria | 2692 |
| 238 | Ga0466967_0148747 | 3300045976 | Unclassified | 2187 |
| 239 | Ga0466967_0418344 | 3300045976 | Bacteria | 1306 |
| 240 | Ga0495585_0071721 | 3300046492 | Bacteria | 1888 |
| 241 | Ga0495663_0004434 | 3300046525 | Bacteria | 3948 |
| 242 | Ga0495633_0087143 | 3300046558 | Bacteria | 1452 |
| 243 | Ga0495668_0070319 | 3300046616 | Bacteria | 1924 |
| 244 | Ga0495669_0032519 | 3300046684 | Bacteria | 2293 |
| 245 | Ga0495677_0002808 | 3300047445 | Bacteria | 6793 |
| 246 | Ga0496100_0139088 | 3300048903 | Bacteria | 1719 |
| 247 | Ga0496101_0220962 | 3300048904 | Bacteria | 1470 |
| 248 | Ga0496104_0208569 | 3300048907 | Bacteria | 1866 |
| 249 | Ga0496107_0239827 | 3300048910 | Bacteria | 1349 |
| 250 | Ga0496107_0251001 | 3300048910 | Bacteria | 1316 |
| 251 | Ga0496108_0033816 | 3300048911 | Bacteria | 4246 |
| 252 | Ga0496108_0155088 | 3300048911 | Unclassified | 1977 |
| 253 | Ga0496109_0029444 | 3300048912 | Bacteria | 4917 |
| 254 | Ga0496110_0053715 | 3300048913 | Bacteria | 3542 |
| 255 | Ga0496110_0168786 | 3300048913 | Unclassified | 1985 |
| 256 | Ga0496111_0012878 | 3300048914 | Bacteria | 5675 |
| 257 | Ga0496111_0069288 | 3300048914 | Unclassified | 2565 |
| 258 | Ga0496112_0024353 | 3300048915 | Bacteria | 5793 |
| 259 | Ga0496112_0290759 | 3300048915 | Bacteria | 1580 |
| 260 | Ga0496112_0547151 | 3300048915 | Unclassified | 1091 |
| 261 | Ga0496112_0683174 | 3300048915 | Bacteria | 955 |
| 262 | Ga0496113_0036829 | 3300048916 | Bacteria | 3586 |
| 263 | Ga0496113_0107124 | 3300048916 | Unclassified | 2171 |
| 264 | Ga0496113_0156656 | 3300048916 | Unclassified | 1799 |
| 265 | Ga0496114_0000162 | 3300048917 | Bacteria | 47188 |
| 266 | Ga0496115_0019503 | 3300048918 | Bacteria | 5219 |
| 267 | Ga0501067_0025250 | 3300049583 | Bacteria | 3294 |
| 268 | Ga0501067_0175770 | 3300049583 | Bacteria | 1192 |
| 269 | Ga0501069_0105699 | 3300049585 | Unclassified | 1600 |
| 270 | Ga0466962_0071321 | 3300061719 | Bacteria | 1660 |
| 271 | Ga0466962_0157726 | 3300061719 | Bacteria | 1102 |
| 272 | Ga0466962_0198921 | 3300061719 | Bacteria | 979 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_10174502 | Ga0207687_101745022 | 176 |
| 2 | 3300026023 | Ga0207677_10006194 | Ga0207677_100061942 | 176 |
| 3 | 3300046492 | Ga0495585_0071721 | Ga0495585_0071721_1328_1861 | 177 |
| 4 | 3300005327 | Ga0070658_10111542 | Ga0070658_101115423 | 179 |
| 5 | 3300005344 | Ga0070661_100109738 | Ga0070661_1001097382 | 179 |
| 6 | 3300005355 | Ga0070671_100012742 | Ga0070671_1000127426 | 179 |
| 7 | 3300005355 | Ga0070671_100049958 | Ga0070671_1000499583 | 179 |
| 8 | 3300005364 | Ga0070673_100074593 | Ga0070673_1000745931 | 179 |
| 9 | 3300005616 | Ga0068852_100632785 | Ga0068852_1006327852 | 179 |
| 10 | 3300009177 | Ga0105248_10548355 | Ga0105248_105483552 | 179 |
| 11 | 3300013296 | Ga0157374_10435109 | Ga0157374_104351092 | 179 |
| 12 | 3300025920 | Ga0207649_10290599 | Ga0207649_102905992 | 179 |
| 13 | 3300026078 | Ga0207702_10143831 | Ga0207702_101438313 | 179 |
| 14 | 3300026095 | Ga0207676_10124251 | Ga0207676_101242513 | 179 |
| 15 | 3300026142 | Ga0207698_10438837 | Ga0207698_104388372 | 179 |
| 16 | 3300048913 | Ga0496110_0053715 | Ga0496110_0053715_165_722 | 179 |
| 17 | 3300037466 | Ga0395898_0066006 | Ga0395898_0066006_1811_2449 | 180 |
| 18 | 3300038443 | Ga0395901_0020761 | Ga0395901_0020761_3124_3762 | 180 |
| 19 | 3300013296 | Ga0157374_10252127 | Ga0157374_102521272 | 183 |
| 20 | 3300025893 | Ga0207682_10094333 | Ga0207682_100943332 | 183 |
| 21 | 3300025931 | Ga0207644_10302877 | Ga0207644_103028772 | 183 |
| 22 | 3300044684 | Ga0466966_0029553 | Ga0466966_0029553_1574_2221 | 183 |
| 23 | 3300045836 | Ga0466958_0054695 | Ga0466958_0054695_223_870 | 183 |
| 24 | 3300048918 | Ga0496115_0019503 | Ga0496115_0019503_3946_4578 | 183 |
| 25 | 3300005535 | Ga0070684_100999337 | Ga0070684_1009993371 | 184 |
| 26 | 3300014497 | Ga0182008_10275220 | Ga0182008_102752201 | 185 |
| 27 | 3300037418 | Ga0395900_0067640 | Ga0395900_0067640_2651_3286 | 185 |
| 28 | 3300013296 | Ga0157374_10692311 | Ga0157374_106923111 | 188 |
| 29 | 3300048903 | Ga0496100_0139088 | Ga0496100_0139088_547_1188 | 188 |
| 30 | 3300048904 | Ga0496101_0220962 | Ga0496101_0220962_430_1071 | 188 |
| 31 | 3300048915 | Ga0496112_0683174 | Ga0496112_0683174_289_930 | 188 |
| 32 | 3300037471 | Ga0395905_0141760 | Ga0395905_0141760_402_989 | 189 |
| 33 | 3300037312 | Ga0395899_0000632 | Ga0395899_0000632_19945_20592 | 191 |
| 34 | 3300037418 | Ga0395900_0000075 | Ga0395900_0000075_60429_61076 | 191 |
| 35 | 3300037466 | Ga0395898_0000055 | Ga0395898_0000055_125762_126409 | 191 |
| 36 | 3300037471 | Ga0395905_0000067 | Ga0395905_0000067_152149_152796 | 191 |
| 37 | 3300038443 | Ga0395901_0000477 | Ga0395901_0000477_33517_34164 | 191 |
| 38 | 3300005327 | Ga0070658_10018600 | Ga0070658_100186005 | 192 |
| 39 | 3300005339 | Ga0070660_100004780 | Ga0070660_1000047805 | 192 |
| 40 | 3300005539 | Ga0068853_100168287 | Ga0068853_1001682872 | 192 |
| 41 | 3300005834 | Ga0068851_10339052 | Ga0068851_103390522 | 192 |
| 42 | 3300009177 | Ga0105248_10675424 | Ga0105248_106754242 | 192 |
| 43 | 3300025321 | Ga0207656_10230884 | Ga0207656_102308841 | 192 |
| 44 | 3300025919 | Ga0207657_10000868 | Ga0207657_1000086829 | 192 |
| 45 | 3300026067 | Ga0207678_10017319 | Ga0207678_100173196 | 192 |
| 46 | 3300026089 | Ga0207648_10700349 | Ga0207648_107003492 | 192 |
| 47 | 3300037471 | Ga0395905_0080481 | Ga0395905_0080481_717_1316 | 192 |
| 48 | 3300048911 | Ga0496108_0033816 | Ga0496108_0033816_1276_1875 | 192 |
| 49 | 3300048915 | Ga0496112_0024353 | Ga0496112_0024353_1347_1946 | 192 |
| 50 | 3300048916 | Ga0496113_0036829 | Ga0496113_0036829_1370_1969 | 192 |
| 51 | 3300048918 | Ga0496115_0019503 | Ga0496115_0019503_2407_3048 | 192 |
| 52 | 3300037418 | Ga0395900_0262403 | Ga0395900_0262403_52_702 | 193 |
| 53 | 3300037466 | Ga0395898_0036770 | Ga0395898_0036770_1570_2220 | 193 |
| 54 | 3300037471 | Ga0395905_0028242 | Ga0395905_0028242_1872_2522 | 193 |
| 55 | 3300045836 | Ga0466958_0068899 | Ga0466958_0068899_56_694 | 193 |
| 56 | 3300046616 | Ga0495668_0070319 | Ga0495668_0070319_1119_1814 | 193 |
| 57 | 3300061719 | Ga0466962_0157726 | Ga0466962_0157726_138_776 | 193 |
| 58 | 3300003322 | rootL2_10315959 | rootL2_103159591 | 194 |
| 59 | 3300037312 | Ga0395899_0333298 | Ga0395899_0333298_308_916 | 194 |
| 60 | 3300037471 | Ga0395905_0068966 | Ga0395905_0068966_497_1105 | 194 |
| 61 | 3300038443 | Ga0395901_0264168 | Ga0395901_0264168_1007_1615 | 194 |
| 62 | 3300044693 | Ga0466961_0105267 | Ga0466961_0105267_318_989 | 194 |
| 63 | 3300044719 | Ga0466971_0160890 | Ga0466971_0160890_246_863 | 194 |
| 64 | 3300045049 | Ga0466959_0097392 | Ga0466959_0097392_514_1185 | 194 |
| 65 | 3300045836 | Ga0466958_0138158 | Ga0466958_0138158_498_1115 | 194 |
| 66 | 3300061719 | Ga0466962_0198921 | Ga0466962_0198921_147_818 | 194 |
| 67 | 3300005355 | Ga0070671_100186735 | Ga0070671_1001867352 | 195 |
| 68 | 3300005364 | Ga0070673_100389462 | Ga0070673_1003894622 | 195 |
| 69 | 3300005367 | Ga0070667_100163804 | Ga0070667_1001638043 | 195 |
| 70 | 3300005457 | Ga0070662_100295052 | Ga0070662_1002950522 | 195 |
| 71 | 3300005841 | Ga0068863_100201374 | Ga0068863_1002013741 | 195 |
| 72 | 3300014325 | Ga0163163_10768298 | Ga0163163_107682981 | 195 |
| 73 | 3300025931 | Ga0207644_10007676 | Ga0207644_100076764 | 195 |
| 74 | 3300025941 | Ga0207711_10038491 | Ga0207711_100384914 | 195 |
| 75 | 3300025960 | Ga0207651_10293045 | Ga0207651_102930452 | 195 |
| 76 | 3300048911 | Ga0496108_0155088 | Ga0496108_0155088_708_1382 | 195 |
| 77 | 3300048914 | Ga0496111_0069288 | Ga0496111_0069288_33_707 | 195 |
| 78 | 3300005366 | Ga0070659_100046016 | Ga0070659_1000460164 | 196 |
| 79 | 3300005564 | Ga0070664_100007940 | Ga0070664_10000794012 | 196 |
| 80 | 3300005564 | Ga0070664_100245091 | Ga0070664_1002450912 | 196 |
| 81 | 3300005577 | Ga0068857_100291322 | Ga0068857_1002913223 | 196 |
| 82 | 3300005618 | Ga0068864_100335935 | Ga0068864_1003359353 | 196 |
| 83 | 3300021384 | Ga0213876_10027501 | Ga0213876_100275014 | 196 |
| 84 | 3300025919 | Ga0207657_10078377 | Ga0207657_100783772 | 196 |
| 85 | 3300025931 | Ga0207644_10097914 | Ga0207644_100979143 | 196 |
| 86 | 3300025945 | Ga0207679_10008246 | Ga0207679_100082463 | 196 |
| 87 | 3300025981 | Ga0207640_10008451 | Ga0207640_100084515 | 196 |
| 88 | 3300026067 | Ga0207678_10007594 | Ga0207678_100075949 | 196 |
| 89 | 3300026089 | Ga0207648_10084540 | Ga0207648_100845403 | 196 |
| 90 | 3300026116 | Ga0207674_10115045 | Ga0207674_101150453 | 196 |
| 91 | 3300032002 | Ga0307416_100116479 | Ga0307416_1001164792 | 196 |
| 92 | 3300032126 | Ga0307415_100010002 | Ga0307415_1000100024 | 196 |
| 93 | 3300037418 | Ga0395900_0255347 | Ga0395900_0255347_1056_1727 | 196 |
| 94 | 3300039437 | Ga0436365_0635045 | Ga0436365_0635045_2743_3384 | 196 |
| 95 | 3300049583 | Ga0501067_0175770 | Ga0501067_0175770_287_937 | 196 |
| 96 | 3300049585 | Ga0501069_0105699 | Ga0501069_0105699_534_1184 | 196 |
| 97 | 3300037418 | Ga0395900_0078722 | Ga0395900_0078722_1365_1982 | 197 |
| 98 | 3300037471 | Ga0395905_0043629 | Ga0395905_0043629_866_1483 | 197 |
| 99 | 3300038443 | Ga0395901_0141124 | Ga0395901_0141124_1168_1785 | 197 |
| 100 | 3300037312 | Ga0395899_0154563 | Ga0395899_0154563_373_1056 | 198 |
| 101 | 3300037418 | Ga0395900_0003156 | Ga0395900_0003156_10772_11455 | 198 |
| 102 | 3300038443 | Ga0395901_0604647 | Ga0395901_0604647_123_806 | 198 |
| 103 | 3300044693 | Ga0466961_0245332 | Ga0466961_0245332_163_780 | 198 |
| 104 | 3300005327 | Ga0070658_10472655 | Ga0070658_104726551 | 199 |
| 105 | 3300005339 | Ga0070660_100059473 | Ga0070660_1000594735 | 199 |
| 106 | 3300005616 | Ga0068852_100203233 | Ga0068852_1002032334 | 199 |
| 107 | 3300025909 | Ga0207705_10147945 | Ga0207705_101479453 | 199 |
| 108 | 3300025919 | Ga0207657_10012092 | Ga0207657_100120924 | 199 |
| 109 | 3300026142 | Ga0207698_10495386 | Ga0207698_104953862 | 199 |
| 110 | 3300013308 | Ga0157375_10048094 | Ga0157375_100480945 | 200 |
| 111 | 3300031731 | Ga0307405_10543027 | Ga0307405_105430272 | 200 |
| 112 | 3300031901 | Ga0307406_10044326 | Ga0307406_100443264 | 200 |
| 113 | 3300032004 | Ga0307414_10143342 | Ga0307414_101433422 | 200 |
| 114 | 3300032005 | Ga0307411_10101250 | Ga0307411_101012501 | 200 |
| 115 | 3300035241 | Ga0373961_0110634 | Ga0373961_0110634_20_661 | 200 |
| 116 | 3300003323 | rootH1_10138591 | rootH1_101385918 | 201 |
| 117 | 3300005530 | Ga0070679_100082480 | Ga0070679_1000824804 | 201 |
| 118 | 3300005564 | Ga0070664_100133833 | Ga0070664_1001338333 | 201 |
| 119 | 3300013104 | Ga0157370_10209758 | Ga0157370_102097583 | 201 |
| 120 | 3300013307 | Ga0157372_10146672 | Ga0157372_101466722 | 201 |
| 121 | 3300025920 | Ga0207649_10094112 | Ga0207649_100941123 | 201 |
| 122 | 3300026116 | Ga0207674_10003653 | Ga0207674_100036532 | 201 |
| 123 | 3300044765 | Ga0466970_0378693 | Ga0466970_0378693_68_700 | 201 |
| 124 | 3300061719 | Ga0466962_0071321 | Ga0466962_0071321_806_1435 | 201 |
| 125 | 3300005366 | Ga0070659_100474832 | Ga0070659_1004748321 | 202 |
| 126 | 3300005564 | Ga0070664_100756052 | Ga0070664_1007560522 | 202 |
| 127 | 3300005616 | Ga0068852_100258752 | Ga0068852_1002587522 | 202 |
| 128 | 3300025920 | Ga0207649_10343141 | Ga0207649_103431411 | 202 |
| 129 | 3300026041 | Ga0207639_10350653 | Ga0207639_103506532 | 202 |
| 130 | 3300037471 | Ga0395905_0925948 | Ga0395905_0925948_87_761 | 202 |
| 131 | 3300042005 | Ga0439448_0002525 | Ga0439448_0002525_714_1379 | 202 |
| 132 | 3300048915 | Ga0496112_0290759 | Ga0496112_0290759_167_799 | 202 |
| 133 | 3300037471 | Ga0395905_0182456 | Ga0395905_0182456_1320_1955 | 203 |
| 134 | 3300038443 | Ga0395901_0020761 | Ga0395901_0020761_4663_5298 | 203 |
| 135 | 3300044684 | Ga0466966_0089076 | Ga0466966_0089076_1134_1775 | 203 |
| 136 | 3300044842 | Ga0466957_0441827 | Ga0466957_0441827_221_856 | 203 |
| 137 | 3300045976 | Ga0466967_0148747 | Ga0466967_0148747_916_1551 | 203 |
| 138 | 3300048910 | Ga0496107_0239827 | Ga0496107_0239827_475_1107 | 203 |
| 139 | 3300049583 | Ga0501067_0025250 | Ga0501067_0025250_287_922 | 203 |
| 140 | 3300005327 | Ga0070658_10015356 | Ga0070658_100153565 | 204 |
| 141 | 3300036401 | Ga0373937_0512942 | Ga0373937_0512942_100_735 | 204 |
| 142 | 3300037471 | Ga0395905_0039213 | Ga0395905_0039213_2617_3252 | 204 |
| 143 | 3300037471 | Ga0395905_0079312 | Ga0395905_0079312_1727_2359 | 204 |
| 144 | 3300038443 | Ga0395901_0168527 | Ga0395901_0168527_74_706 | 204 |
| 145 | 3300038443 | Ga0395901_0686909 | Ga0395901_0686909_310_945 | 204 |
| 146 | 3300044765 | Ga0466970_0024589 | Ga0466970_0024589_2443_3081 | 204 |
| 147 | 3300048917 | Ga0496114_0000162 | Ga0496114_0000162_34494_35138 | 204 |
| 148 | 3300005327 | Ga0070658_10071184 | Ga0070658_100711844 | 205 |
| 149 | 3300005336 | Ga0070680_100101658 | Ga0070680_1001016582 | 205 |
| 150 | 3300005355 | Ga0070671_100049958 | Ga0070671_1000499585 | 205 |
| 151 | 3300005364 | Ga0070673_100074593 | Ga0070673_1000745933 | 205 |
| 152 | 3300005543 | Ga0070672_100561895 | Ga0070672_1005618952 | 205 |
| 153 | 3300005616 | Ga0068852_100335349 | Ga0068852_1003353492 | 205 |
| 154 | 3300005618 | Ga0068864_100192742 | Ga0068864_1001927421 | 205 |
| 155 | 3300005834 | Ga0068851_10009488 | Ga0068851_100094883 | 205 |
| 156 | 3300009177 | Ga0105248_10042414 | Ga0105248_100424142 | 205 |
| 157 | 3300025321 | Ga0207656_10325358 | Ga0207656_103253581 | 205 |
| 158 | 3300025909 | Ga0207705_10005854 | Ga0207705_100058545 | 205 |
| 159 | 3300025931 | Ga0207644_10018189 | Ga0207644_100181893 | 205 |
| 160 | 3300025944 | Ga0207661_10073344 | Ga0207661_100733441 | 205 |
| 161 | 3300025960 | Ga0207651_10066951 | Ga0207651_100669513 | 205 |
| 162 | 3300026067 | Ga0207678_10027596 | Ga0207678_100275965 | 205 |
| 163 | 3300026088 | Ga0207641_10509207 | Ga0207641_105092072 | 205 |
| 164 | 3300026116 | Ga0207674_10011384 | Ga0207674_1001138411 | 205 |
| 165 | 3300031852 | Ga0307410_10338874 | Ga0307410_103388742 | 205 |
| 166 | 3300037471 | Ga0395905_0236032 | Ga0395905_0236032_365_1000 | 205 |
| 167 | 3300044901 | Ga0466960_0015252 | Ga0466960_0015252_1510_2154 | 205 |
| 168 | 3300045976 | Ga0466967_0418344 | Ga0466967_0418344_352_1023 | 205 |
| 169 | 3300046558 | Ga0495633_0087143 | Ga0495633_0087143_304_942 | 205 |
| 170 | 3300048907 | Ga0496104_0208569 | Ga0496104_0208569_46_681 | 205 |
| 171 | 3300048910 | Ga0496107_0251001 | Ga0496107_0251001_661_1296 | 205 |
| 172 | 3300048912 | Ga0496109_0029444 | Ga0496109_0029444_568_1203 | 205 |
| 173 | 3300048913 | Ga0496110_0053715 | Ga0496110_0053715_1620_2255 | 205 |
| 174 | 3300048914 | Ga0496111_0012878 | Ga0496111_0012878_1092_1727 | 205 |
| 175 | 3300048915 | Ga0496112_0024353 | Ga0496112_0024353_2844_3479 | 205 |
| 176 | 3300048916 | Ga0496113_0036829 | Ga0496113_0036829_2867_3502 | 205 |
| 177 | 3300005327 | Ga0070658_10180655 | Ga0070658_101806551 | 206 |
| 178 | 3300005366 | Ga0070659_100295987 | Ga0070659_1002959872 | 206 |
| 179 | 3300025933 | Ga0207706_10195715 | Ga0207706_101957154 | 206 |
| 180 | 3300031852 | Ga0307410_10006913 | Ga0307410_100069136 | 206 |
| 181 | 3300031903 | Ga0307407_10342501 | Ga0307407_103425011 | 206 |
| 182 | 3300031995 | Ga0307409_100016717 | Ga0307409_1000167174 | 206 |
| 183 | 3300032005 | Ga0307411_10007041 | Ga0307411_100070414 | 206 |
| 184 | 3300037418 | Ga0395900_0260163 | Ga0395900_0260163_18_686 | 206 |
| 185 | 3300037418 | Ga0395900_0663717 | Ga0395900_0663717_275_961 | 206 |
| 186 | 3300037466 | Ga0395898_0146424 | Ga0395898_0146424_1136_1774 | 206 |
| 187 | 3300037471 | Ga0395905_0049531 | Ga0395905_0049531_1089_1757 | 206 |
| 188 | 3300037471 | Ga0395905_0126166 | Ga0395905_0126166_14_700 | 206 |
| 189 | 3300038443 | Ga0395901_0122684 | Ga0395901_0122684_1928_2614 | 206 |
| 190 | 3300038443 | Ga0395901_0122864 | Ga0395901_0122864_1048_1716 | 206 |
| 191 | 3300048916 | Ga0496113_0156656 | Ga0496113_0156656_305_946 | 206 |
| 192 | 3300025921 | Ga0207652_10031744 | Ga0207652_100317448 | 207 |
| 193 | 3300005356 | Ga0070674_100310012 | Ga0070674_1003100122 | 208 |
| 194 | 3300005530 | Ga0070679_100397860 | Ga0070679_1003978602 | 208 |
| 195 | 3300005618 | Ga0068864_100006950 | Ga0068864_1000069509 | 208 |
| 196 | 3300009551 | Ga0105238_10211463 | Ga0105238_102114634 | 208 |
| 197 | 3300025909 | Ga0207705_10370588 | Ga0207705_103705882 | 208 |
| 198 | 3300025921 | Ga0207652_10329605 | Ga0207652_103296052 | 208 |
| 199 | 3300025937 | Ga0207669_10404913 | Ga0207669_104049132 | 208 |
| 200 | 3300025949 | Ga0207667_10503366 | Ga0207667_105033662 | 208 |
| 201 | 3300026095 | Ga0207676_10020058 | Ga0207676_100200583 | 208 |
| 202 | 3300037471 | Ga0395905_0068011 | Ga0395905_0068011_787_1446 | 208 |
| 203 | 3300045049 | Ga0466959_0207991 | Ga0466959_0207991_293_946 | 208 |
| 204 | 3300046525 | Ga0495663_0004434 | Ga0495663_0004434_2926_3606 | 208 |
| 205 | 3300046684 | Ga0495669_0032519 | Ga0495669_0032519_389_1069 | 208 |
| 206 | 3300047445 | Ga0495677_0002808 | Ga0495677_0002808_1239_1919 | 208 |
| 207 | 3300048913 | Ga0496110_0168786 | Ga0496110_0168786_881_1555 | 208 |
| 208 | 3300048916 | Ga0496113_0107124 | Ga0496113_0107124_468_1142 | 208 |
| 209 | 3300005338 | Ga0068868_100006919 | Ga0068868_1000069192 | 209 |
| 210 | 3300009098 | Ga0105245_10137152 | Ga0105245_101371522 | 209 |
| 211 | 3300013296 | Ga0157374_10049219 | Ga0157374_100492192 | 209 |
| 212 | 3300005435 | Ga0070714_100601886 | Ga0070714_1006018862 | 212 |
| 213 | 3300005436 | Ga0070713_100361589 | Ga0070713_1003615892 | 212 |
| 214 | 3300006028 | Ga0070717_10338792 | Ga0070717_103387922 | 212 |
| 215 | 3300025929 | Ga0207664_10488075 | Ga0207664_104880751 | 212 |
| 216 | 3300005327 | Ga0070658_10727901 | Ga0070658_107279012 | 214 |
| 217 | 3300005331 | Ga0070670_100006312 | Ga0070670_1000063126 | 214 |
| 218 | 3300005333 | Ga0070677_10016999 | Ga0070677_100169995 | 214 |
| 219 | 3300005335 | Ga0070666_10081772 | Ga0070666_100817722 | 214 |
| 220 | 3300005338 | Ga0068868_100034449 | Ga0068868_1000344495 | 214 |
| 221 | 3300005356 | Ga0070674_100026769 | Ga0070674_1000267693 | 214 |
| 222 | 3300005455 | Ga0070663_100205450 | Ga0070663_1002054503 | 214 |
| 223 | 3300005459 | Ga0068867_100115041 | Ga0068867_1001150411 | 214 |
| 224 | 3300005563 | Ga0068855_100059111 | Ga0068855_1000591117 | 214 |
| 225 | 3300005578 | Ga0068854_100048625 | Ga0068854_1000486253 | 214 |
| 226 | 3300005718 | Ga0068866_10039982 | Ga0068866_100399823 | 214 |
| 227 | 3300013307 | Ga0157372_11798663 | Ga0157372_117986631 | 214 |
| 228 | 3300014745 | Ga0157377_10528643 | Ga0157377_105286432 | 214 |
| 229 | 3300025899 | Ga0207642_10226588 | Ga0207642_102265882 | 214 |
| 230 | 3300025904 | Ga0207647_10301550 | Ga0207647_103015501 | 214 |
| 231 | 3300025919 | Ga0207657_10009689 | Ga0207657_1000968910 | 214 |
| 232 | 3300025933 | Ga0207706_10003606 | Ga0207706_100036063 | 214 |
| 233 | 3300025937 | Ga0207669_10148718 | Ga0207669_101487182 | 214 |
| 234 | 3300025940 | Ga0207691_10288298 | Ga0207691_102882982 | 214 |
| 235 | 3300025942 | Ga0207689_10121774 | Ga0207689_101217741 | 214 |
| 236 | 3300025949 | Ga0207667_10961099 | Ga0207667_109610991 | 214 |
| 237 | 3300025986 | Ga0207658_10151186 | Ga0207658_101511861 | 214 |
| 238 | 3300026067 | Ga0207678_10001124 | Ga0207678_1000112423 | 214 |
| 239 | 3300026088 | Ga0207641_10233383 | Ga0207641_102333832 | 214 |
| 240 | 3300026089 | Ga0207648_10013681 | Ga0207648_100136814 | 214 |
| 241 | 3300037466 | Ga0395898_0620564 | Ga0395898_0620564_192_875 | 214 |
| 242 | 3300042157 | Ga0439458_0003440 | Ga0439458_0003440_2257_2922 | 216 |
| 243 | 3300009177 | Ga0105248_10224077 | Ga0105248_102240772 | 217 |
| 244 | 3300038443 | Ga0395901_0124169 | Ga0395901_0124169_238_921 | 217 |
| 245 | 3300044706 | Ga0466964_0006327 | Ga0466964_0006327_2569_3240 | 217 |
| 246 | 3300044735 | Ga0466968_0003735 | Ga0466968_0003735_4811_5482 | 217 |
| 247 | 3300044765 | Ga0466970_0038764 | Ga0466970_0038764_903_1574 | 217 |
| 248 | 3300045049 | Ga0466959_0135500 | Ga0466959_0135500_129_800 | 217 |
| 249 | 3300045836 | Ga0466958_0139516 | Ga0466958_0139516_793_1464 | 217 |
| 250 | 3300045976 | Ga0466967_0096830 | Ga0466967_0096830_1983_2654 | 217 |
| 251 | 3300048915 | Ga0496112_0547151 | Ga0496112_0547151_18_692 | 217 |
| 252 | 3300037418 | Ga0395900_0255658 | Ga0395900_0255658_196_858 | 218 |
| 253 | 3300037418 | Ga0395900_0906975 | Ga0395900_0906975_76_741 | 219 |
| 254 | 3300038443 | Ga0395901_0064316 | Ga0395901_0064316_2744_3409 | 219 |
| 255 | 3300037471 | Ga0395905_0131860 | Ga0395905_0131860_834_1502 | 221 |
| 256 | 3300038443 | Ga0395901_0636820 | Ga0395901_0636820_105_773 | 221 |
| 257 | 3300005335 | Ga0070666_10040709 | Ga0070666_100407093 | 222 |
| 258 | 3300005364 | Ga0070673_100033421 | Ga0070673_1000334214 | 222 |
| 259 | 3300005356 | Ga0070674_100831752 | Ga0070674_1008317521 | 223 |
| 260 | 3300005456 | Ga0070678_100078953 | Ga0070678_1000789533 | 223 |
| 261 | 3300005457 | Ga0070662_100070711 | Ga0070662_1000707113 | 223 |
| 262 | 3300005543 | Ga0070672_100071653 | Ga0070672_1000716534 | 223 |
| 263 | 3300006881 | Ga0068865_100022662 | Ga0068865_1000226624 | 223 |
| 264 | 3300009177 | Ga0105248_10315861 | Ga0105248_103158611 | 223 |
| 265 | 3300017792 | Ga0163161_10118556 | Ga0163161_101185562 | 223 |
| 266 | 3300025933 | Ga0207706_10012636 | Ga0207706_100126369 | 223 |
| 267 | 3300025940 | Ga0207691_10262878 | Ga0207691_102628782 | 223 |
| 268 | 3300037418 | Ga0395900_0726544 | Ga0395900_0726544_220_894 | 223 |
| 269 | 3300005366 | Ga0070659_100068240 | Ga0070659_1000682405 | 227 |
| 270 | 3300005843 | Ga0068860_100905667 | Ga0068860_1009056671 | 227 |
| 271 | 3300001990 | JGI24737J22298_10002022 | JGI24737J22298_100020223 | 228 |
| 272 | 3300005339 | Ga0070660_100228370 | Ga0070660_1002283701 | 228 |
| 273 | 3300005366 | Ga0070659_100002128 | Ga0070659_1000021284 | 228 |
| 274 | 3300005457 | Ga0070662_100005161 | Ga0070662_10000516110 | 228 |
| 275 | 3300013102 | Ga0157371_10147634 | Ga0157371_101476341 | 228 |
| 276 | 3300013307 | Ga0157372_10136617 | Ga0157372_101366173 | 228 |
| 277 | 3300025904 | Ga0207647_10022432 | Ga0207647_100224324 | 228 |
| 278 | 3300025933 | Ga0207706_10003091 | Ga0207706_1000309111 | 228 |
| 279 | 3300042012 | Ga0439455_0015153 | Ga0439455_0015153_816_1502 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5e5l-assembly3.cif.gz_C | crystal structure of mycobacterium tuberculosis l,d-transpeptidase 1 at 1.89 angstrom | 0.8788 | 105 | 215 |
| 4z7a-assembly1.cif.gz_A | structural and biochemical characterization of a non-functionally redundant m. tuberculosis (3,3) l,d-transpeptidase, ldtmt5. | 0.8772 | 106 | 215 |
| 5e5l-assembly4.cif.gz_D | crystal structure of mycobacterium tuberculosis l,d-transpeptidase 1 at 1.89 angstrom | 0.877 | 105 | 215 |
| 6fj1-assembly2.cif.gz_B | structure of the ldtfm-avibactam carbamoyl enzyme | 0.8761 | 106 | 215 |
| 6d51-assembly1.cif.gz_A | crystal structure of l,d-transpeptidase 3 from mycobacterium tuberculosis in complex with a faropenem-derived adduct | 0.8756 | 106 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6d51A02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8756 | 106 | 214 | 2.40.440.10 |
| af_M9PB21_880_1122_3.10.129.110 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase | 0.86 | 106 | 130 | 3.10.129.110 |
| 4jmxA02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.851 | 106 | 215 | 2.40.440.10 |
| 5uwvD03 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8473 | 106 | 215 | 2.40.440.10 |
| 6iywC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8361 | 106 | 215 | 2.40.440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M4S8H1-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.9512 | 89 | 214 |
GO:0005576
GO:0008360 GO:0016740 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A0Q8RT77-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.948 | 69 | 216 |
GO:0005576
GO:0008360 GO:0016740 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A0Q4LAG3-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.942 | 83 | 216 |
GO:0005576
GO:0008360 GO:0016740 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A147IZZ4-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.9415 | 83 | 216 |
GO:0005576
GO:0008360 GO:0016740 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A0Q4K0S9-F1-model_v4 | deleted | 0.94 | 89 | 215 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar