F382768

General Info

Members Datasets Scaffolds Average Seq Length
279 134 272 209

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10002022|JGI24737J22298_100020223
Length 228
Sequence MKRSILGVSGLAVAAVVAGSIAWLGFERERAPAAATAVKGAPRAAIPSPEPAPPAAGRIMLSPAQLDEAIAAGLVDRPVKSLLDVPERMTYGQFVWNDRGVAPGPVWVRVDLGSQILSVFRSGHEIGTAVILYGTDGLPTPTGKFPILAKLKDHRSATYGDAPMPYTLRLTPDGVAIHGSNVRWGFATHGCVGVPKAFAAKIFDAVSTGDEVVIVSERAAQKNEVSAR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.96
Rhizosphere 89.61
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10002022 3300001990 Bacteria 7247
2 rootL2_10315959 3300003322 Unclassified 1199
3 rootH1_10138591 3300003323 Bacteria 5807
4 Ga0070658_10015356 3300005327 Bacteria 6129
5 Ga0070658_10018600 3300005327 Bacteria 5564
6 Ga0070658_10071184 3300005327 Bacteria 2848
7 Ga0070658_10111542 3300005327 Bacteria 2266
8 Ga0070658_10180655 3300005327 Unclassified 1775
9 Ga0070658_10472655 3300005327 Bacteria 1081
10 Ga0070658_10727901 3300005327 Bacteria 861
11 Ga0070670_100006312 3300005331 Bacteria 10037
12 Ga0070677_10016999 3300005333 Bacteria 2598
13 Ga0070666_10040709 3300005335 Bacteria 3102
14 Ga0070666_10081772 3300005335 Bacteria 2209
15 Ga0070680_100101658 3300005336 Bacteria 2386
16 Ga0068868_100006919 3300005338 Bacteria 8058
17 Ga0068868_100034449 3300005338 Bacteria 3909
18 Ga0070660_100004780 3300005339 Bacteria 9365
19 Ga0070660_100059473 3300005339 Unclassified 2963
20 Ga0070660_100228370 3300005339 Unclassified 1514
21 Ga0070661_100109738 3300005344 Bacteria 2059
22 Ga0070671_100012742 3300005355 Bacteria 6778
23 Ga0070671_100049958 3300005355 Bacteria 3479
24 Ga0070671_100186735 3300005355 Bacteria 1756
25 Ga0070674_100026769 3300005356 Bacteria 3771
26 Ga0070674_100310012 3300005356 Bacteria 1261
27 Ga0070674_100831752 3300005356 Bacteria 799
28 Ga0070673_100033421 3300005364 Bacteria 3884
29 Ga0070673_100074593 3300005364 Bacteria 2734
30 Ga0070673_100389462 3300005364 Bacteria 1244
31 Ga0070659_100002128 3300005366 Bacteria 14118
32 Ga0070659_100046016 3300005366 Bacteria 3420
33 Ga0070659_100068240 3300005366 Bacteria 2820
34 Ga0070659_100295987 3300005366 Bacteria 1348
35 Ga0070659_100474832 3300005366 Unclassified 1063
36 Ga0070667_100163804 3300005367 Bacteria 1960
37 Ga0070714_100601886 3300005435 Unclassified 1056
38 Ga0070713_100361589 3300005436 Unclassified 1349
39 Ga0070663_100205450 3300005455 Bacteria 1539
40 Ga0070678_100078953 3300005456 Bacteria 2488
41 Ga0070662_100005161 3300005457 Bacteria 8327
42 Ga0070662_100070711 3300005457 Bacteria 2571
43 Ga0070662_100295052 3300005457 Bacteria 1315
44 Ga0068867_100115041 3300005459 Unclassified 2071
45 Ga0070679_100082480 3300005530 Bacteria 3205
46 Ga0070679_100397860 3300005530 Unclassified 1323
47 Ga0070684_100999337 3300005535 Bacteria 785
48 Ga0068853_100168287 3300005539 Bacteria 1982
49 Ga0070672_100071653 3300005543 Bacteria 2757
50 Ga0070672_100561895 3300005543 Bacteria 991
51 Ga0068855_100059111 3300005563 Bacteria 4486
52 Ga0070664_100007940 3300005564 Bacteria 8571
53 Ga0070664_100133833 3300005564 Unclassified 2178
54 Ga0070664_100245091 3300005564 Bacteria 1610
55 Ga0070664_100756052 3300005564 Bacteria 907
56 Ga0068857_100291322 3300005577 Bacteria 1503
57 Ga0068854_100048625 3300005578 Bacteria 3026
58 Ga0068852_100203233 3300005616 Bacteria 1875
59 Ga0068852_100258752 3300005616 Bacteria 1670
60 Ga0068852_100335349 3300005616 Bacteria 1472
61 Ga0068852_100632785 3300005616 Bacteria 1076
62 Ga0068864_100006950 3300005618 Bacteria 9281
63 Ga0068864_100192742 3300005618 Bacteria 1869
64 Ga0068864_100335935 3300005618 Bacteria 1422
65 Ga0068866_10039982 3300005718 Unclassified 2319
66 Ga0068851_10009488 3300005834 Bacteria 4527
67 Ga0068851_10339052 3300005834 Unclassified 872
68 Ga0068863_100201374 3300005841 Bacteria 1915
69 Ga0068860_100905667 3300005843 Unclassified 898
70 Ga0070717_10338792 3300006028 Unclassified 1342
71 Ga0068865_100022662 3300006881 Bacteria 4101
72 Ga0105245_10137152 3300009098 Bacteria 2300
73 Ga0105248_10042414 3300009177 Bacteria 5102
74 Ga0105248_10224077 3300009177 Bacteria 2117
75 Ga0105248_10315861 3300009177 Bacteria 1760
76 Ga0105248_10548355 3300009177 Bacteria 1304
77 Ga0105248_10675424 3300009177 Bacteria 1165
78 Ga0105238_10211463 3300009551 Bacteria 1916
79 Ga0157371_10147634 3300013102 Unclassified 1676
80 Ga0157370_10209758 3300013104 Unclassified 1806
81 Ga0157374_10049219 3300013296 Bacteria 3914
82 Ga0157374_10252127 3300013296 Bacteria 1737
83 Ga0157374_10435109 3300013296 Bacteria 1312
84 Ga0157374_10692311 3300013296 Bacteria 1032
85 Ga0157372_10136617 3300013307 Unclassified 2824
86 Ga0157372_10146672 3300013307 Bacteria 2721
87 Ga0157372_11798663 3300013307 Unclassified 705
88 Ga0157375_10048094 3300013308 Bacteria 4170
89 Ga0163163_10768298 3300014325 Bacteria 1027
90 Ga0182008_10275220 3300014497 Unclassified 874
91 Ga0157377_10528643 3300014745 Bacteria 829
92 Ga0163161_10118556 3300017792 Bacteria 1986
93 Ga0213876_10027501 3300021384 Bacteria 3000
94 Ga0207656_10230884 3300025321 Unclassified 902
95 Ga0207656_10325358 3300025321 Bacteria 764
96 Ga0207682_10094333 3300025893 Bacteria 1302
97 Ga0207642_10226588 3300025899 Bacteria 1048
98 Ga0207647_10022432 3300025904 Bacteria 4193
99 Ga0207647_10301550 3300025904 Unclassified 912
100 Ga0207705_10005854 3300025909 Bacteria 9151
101 Ga0207705_10147945 3300025909 Unclassified 1758
102 Ga0207705_10370588 3300025909 Bacteria 1105
103 Ga0207657_10000868 3300025919 Bacteria 31880
104 Ga0207657_10009689 3300025919 Bacteria 9664
105 Ga0207657_10012092 3300025919 Bacteria 8530
106 Ga0207657_10078377 3300025919 Bacteria 2782
107 Ga0207649_10094112 3300025920 Bacteria 1968
108 Ga0207649_10290599 3300025920 Bacteria 1192
109 Ga0207649_10343141 3300025920 Bacteria 1103
110 Ga0207652_10031744 3300025921 Bacteria 4436
111 Ga0207652_10329605 3300025921 Bacteria 1378
112 Ga0207687_10174502 3300025927 Bacteria 1660
113 Ga0207664_10488075 3300025929 Unclassified 1102
114 Ga0207644_10007676 3300025931 Bacteria 7036
115 Ga0207644_10018189 3300025931 Bacteria 4752
116 Ga0207644_10097914 3300025931 Bacteria 2198
117 Ga0207644_10302877 3300025931 Unclassified 1288
118 Ga0207706_10003091 3300025933 Bacteria 15997
119 Ga0207706_10003606 3300025933 Bacteria 14782
120 Ga0207706_10012636 3300025933 Bacteria 7687
121 Ga0207706_10195715 3300025933 Bacteria 1773
122 Ga0207669_10148718 3300025937 Bacteria 1637
123 Ga0207669_10404913 3300025937 Bacteria 1070
124 Ga0207691_10262878 3300025940 Bacteria 1487
125 Ga0207691_10288298 3300025940 Bacteria 1412
126 Ga0207711_10038491 3300025941 Bacteria 4067
127 Ga0207689_10121774 3300025942 Bacteria 2145
128 Ga0207661_10073344 3300025944 Unclassified 2803
129 Ga0207679_10008246 3300025945 Bacteria 6634
130 Ga0207667_10503366 3300025949 Bacteria 1228
131 Ga0207667_10961099 3300025949 Bacteria 843
132 Ga0207651_10066951 3300025960 Bacteria 2526
133 Ga0207651_10293045 3300025960 Bacteria 1350
134 Ga0207640_10008451 3300025981 Bacteria 5720
135 Ga0207658_10151186 3300025986 Bacteria 1892
136 Ga0207677_10006194 3300026023 Bacteria 6539
137 Ga0207639_10350653 3300026041 Unclassified 1318
138 Ga0207678_10001124 3300026067 Bacteria 24510
139 Ga0207678_10007594 3300026067 Bacteria 9580
140 Ga0207678_10017319 3300026067 Bacteria 6325
141 Ga0207678_10027596 3300026067 Bacteria 4954
142 Ga0207702_10143831 3300026078 Bacteria 2161
143 Ga0207641_10233383 3300026088 Bacteria 1711
144 Ga0207641_10509207 3300026088 Bacteria 1170
145 Ga0207648_10013681 3300026089 Bacteria 7534
146 Ga0207648_10084540 3300026089 Bacteria 2768
147 Ga0207648_10700349 3300026089 Bacteria 939
148 Ga0207676_10020058 3300026095 Bacteria 4886
149 Ga0207676_10124251 3300026095 Bacteria 2182
150 Ga0207674_10003653 3300026116 Bacteria 18761
151 Ga0207674_10011384 3300026116 Bacteria 9996
152 Ga0207674_10115045 3300026116 Unclassified 2661
153 Ga0207698_10438837 3300026142 Bacteria 1257
154 Ga0207698_10495386 3300026142 Bacteria 1188
155 Ga0307405_10543027 3300031731 Bacteria 939
156 Ga0307410_10006913 3300031852 Bacteria 6166
157 Ga0307410_10338874 3300031852 Bacteria 1198
158 Ga0307406_10044326 3300031901 Bacteria 2787
159 Ga0307407_10342501 3300031903 Unclassified 1056
160 Ga0307409_100016717 3300031995 Bacteria 4865
161 Ga0307416_100116479 3300032002 Bacteria 2369
162 Ga0307414_10143342 3300032004 Bacteria 1874
163 Ga0307411_10007041 3300032005 Bacteria 5687
164 Ga0307411_10101250 3300032005 Bacteria 2038
165 Ga0307415_100010002 3300032126 Bacteria 5351
166 Ga0373961_0110634 3300035241 Bacteria 900
167 Ga0373937_0512942 3300036401 Unclassified 1139
168 Ga0395899_0000632 3300037312 Bacteria 36585
169 Ga0395899_0154563 3300037312 Bacteria 1624
170 Ga0395899_0333298 3300037312 Bacteria 1019
171 Ga0395900_0000075 3300037418 Bacteria 183525
172 Ga0395900_0003156 3300037418 Bacteria 17867
173 Ga0395900_0067640 3300037418 Unclassified 3670
174 Ga0395900_0078722 3300037418 Bacteria 3387
175 Ga0395900_0255347 3300037418 Bacteria 1752
176 Ga0395900_0255658 3300037418 Bacteria 1751
177 Ga0395900_0260163 3300037418 Unclassified 1733
178 Ga0395900_0262403 3300037418 Bacteria 1724
179 Ga0395900_0663717 3300037418 Bacteria 978
180 Ga0395900_0726544 3300037418 Bacteria 925
181 Ga0395900_0906975 3300037418 Bacteria 804
182 Ga0395898_0000055 3300037466 Bacteria 278557
183 Ga0395898_0036770 3300037466 Bacteria 4860
184 Ga0395898_0066006 3300037466 Bacteria 3507
185 Ga0395898_0146424 3300037466 Bacteria 2260
186 Ga0395898_0620564 3300037466 Unclassified 1024
187 Ga0395905_0000067 3300037471 Bacteria 181887
188 Ga0395905_0028242 3300037471 Bacteria 5288
189 Ga0395905_0039213 3300037471 Bacteria 4444
190 Ga0395905_0043629 3300037471 Bacteria 4207
191 Ga0395905_0049531 3300037471 Bacteria 3936
192 Ga0395905_0068011 3300037471 Bacteria 3337
193 Ga0395905_0068966 3300037471 Bacteria 3312
194 Ga0395905_0079312 3300037471 Bacteria 3077
195 Ga0395905_0080481 3300037471 Bacteria 3053
196 Ga0395905_0126166 3300037471 Bacteria 2406
197 Ga0395905_0131860 3300037471 Bacteria 2350
198 Ga0395905_0141760 3300037471 Bacteria 2261
199 Ga0395905_0182456 3300037471 Bacteria 1970
200 Ga0395905_0236032 3300037471 Bacteria 1709
201 Ga0395905_0925948 3300037471 Bacteria 774
202 Ga0395901_0000477 3300038443 Bacteria 46511
203 Ga0395901_0020761 3300038443 Bacteria 6724
204 Ga0395901_0064316 3300038443 Bacteria 3818
205 Ga0395901_0122684 3300038443 Bacteria 2730
206 Ga0395901_0122864 3300038443 Bacteria 2728
207 Ga0395901_0124169 3300038443 Bacteria 2713
208 Ga0395901_0141124 3300038443 Bacteria 2532
209 Ga0395901_0168527 3300038443 Bacteria 2298
210 Ga0395901_0264168 3300038443 Bacteria 1791
211 Ga0395901_0604647 3300038443 Bacteria 1105
212 Ga0395901_0636820 3300038443 Unclassified 1071
213 Ga0395901_0686909 3300038443 Unclassified 1023
214 Ga0436365_0635045 3300039437 Bacteria 4255
215 Ga0439448_0002525 3300042005 Bacteria 4986
216 Ga0439455_0015153 3300042012 Unclassified 1770
217 Ga0439458_0003440 3300042157 Bacteria 3703
218 Ga0466966_0029553 3300044684 Unclassified 3564
219 Ga0466966_0089076 3300044684 Bacteria 1917
220 Ga0466961_0105267 3300044693 Unclassified 1776
221 Ga0466961_0245332 3300044693 Bacteria 1100
222 Ga0466964_0006327 3300044706 Bacteria 4410
223 Ga0466971_0160890 3300044719 Unclassified 1051
224 Ga0466968_0003735 3300044735 Bacteria 5644
225 Ga0466970_0024589 3300044765 Bacteria 3151
226 Ga0466970_0038764 3300044765 Bacteria 2528
227 Ga0466970_0378693 3300044765 Bacteria 805
228 Ga0466957_0441827 3300044842 Bacteria 895
229 Ga0466960_0015252 3300044901 Bacteria 3309
230 Ga0466959_0097392 3300045049 Unclassified 2108
231 Ga0466959_0135500 3300045049 Bacteria 1743
232 Ga0466959_0207991 3300045049 Bacteria 1360
233 Ga0466958_0054695 3300045836 Unclassified 2421
234 Ga0466958_0068899 3300045836 Bacteria 2163
235 Ga0466958_0138158 3300045836 Bacteria 1533
236 Ga0466958_0139516 3300045836 Bacteria 1525
237 Ga0466967_0096830 3300045976 Bacteria 2692
238 Ga0466967_0148747 3300045976 Unclassified 2187
239 Ga0466967_0418344 3300045976 Bacteria 1306
240 Ga0495585_0071721 3300046492 Bacteria 1888
241 Ga0495663_0004434 3300046525 Bacteria 3948
242 Ga0495633_0087143 3300046558 Bacteria 1452
243 Ga0495668_0070319 3300046616 Bacteria 1924
244 Ga0495669_0032519 3300046684 Bacteria 2293
245 Ga0495677_0002808 3300047445 Bacteria 6793
246 Ga0496100_0139088 3300048903 Bacteria 1719
247 Ga0496101_0220962 3300048904 Bacteria 1470
248 Ga0496104_0208569 3300048907 Bacteria 1866
249 Ga0496107_0239827 3300048910 Bacteria 1349
250 Ga0496107_0251001 3300048910 Bacteria 1316
251 Ga0496108_0033816 3300048911 Bacteria 4246
252 Ga0496108_0155088 3300048911 Unclassified 1977
253 Ga0496109_0029444 3300048912 Bacteria 4917
254 Ga0496110_0053715 3300048913 Bacteria 3542
255 Ga0496110_0168786 3300048913 Unclassified 1985
256 Ga0496111_0012878 3300048914 Bacteria 5675
257 Ga0496111_0069288 3300048914 Unclassified 2565
258 Ga0496112_0024353 3300048915 Bacteria 5793
259 Ga0496112_0290759 3300048915 Bacteria 1580
260 Ga0496112_0547151 3300048915 Unclassified 1091
261 Ga0496112_0683174 3300048915 Bacteria 955
262 Ga0496113_0036829 3300048916 Bacteria 3586
263 Ga0496113_0107124 3300048916 Unclassified 2171
264 Ga0496113_0156656 3300048916 Unclassified 1799
265 Ga0496114_0000162 3300048917 Bacteria 47188
266 Ga0496115_0019503 3300048918 Bacteria 5219
267 Ga0501067_0025250 3300049583 Bacteria 3294
268 Ga0501067_0175770 3300049583 Bacteria 1192
269 Ga0501069_0105699 3300049585 Unclassified 1600
270 Ga0466962_0071321 3300061719 Bacteria 1660
271 Ga0466962_0157726 3300061719 Bacteria 1102
272 Ga0466962_0198921 3300061719 Bacteria 979

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10174502 Ga0207687_101745022 176
2 3300026023 Ga0207677_10006194 Ga0207677_100061942 176
3 3300046492 Ga0495585_0071721 Ga0495585_0071721_1328_1861 177
4 3300005327 Ga0070658_10111542 Ga0070658_101115423 179
5 3300005344 Ga0070661_100109738 Ga0070661_1001097382 179
6 3300005355 Ga0070671_100012742 Ga0070671_1000127426 179
7 3300005355 Ga0070671_100049958 Ga0070671_1000499583 179
8 3300005364 Ga0070673_100074593 Ga0070673_1000745931 179
9 3300005616 Ga0068852_100632785 Ga0068852_1006327852 179
10 3300009177 Ga0105248_10548355 Ga0105248_105483552 179
11 3300013296 Ga0157374_10435109 Ga0157374_104351092 179
12 3300025920 Ga0207649_10290599 Ga0207649_102905992 179
13 3300026078 Ga0207702_10143831 Ga0207702_101438313 179
14 3300026095 Ga0207676_10124251 Ga0207676_101242513 179
15 3300026142 Ga0207698_10438837 Ga0207698_104388372 179
16 3300048913 Ga0496110_0053715 Ga0496110_0053715_165_722 179
17 3300037466 Ga0395898_0066006 Ga0395898_0066006_1811_2449 180
18 3300038443 Ga0395901_0020761 Ga0395901_0020761_3124_3762 180
19 3300013296 Ga0157374_10252127 Ga0157374_102521272 183
20 3300025893 Ga0207682_10094333 Ga0207682_100943332 183
21 3300025931 Ga0207644_10302877 Ga0207644_103028772 183
22 3300044684 Ga0466966_0029553 Ga0466966_0029553_1574_2221 183
23 3300045836 Ga0466958_0054695 Ga0466958_0054695_223_870 183
24 3300048918 Ga0496115_0019503 Ga0496115_0019503_3946_4578 183
25 3300005535 Ga0070684_100999337 Ga0070684_1009993371 184
26 3300014497 Ga0182008_10275220 Ga0182008_102752201 185
27 3300037418 Ga0395900_0067640 Ga0395900_0067640_2651_3286 185
28 3300013296 Ga0157374_10692311 Ga0157374_106923111 188
29 3300048903 Ga0496100_0139088 Ga0496100_0139088_547_1188 188
30 3300048904 Ga0496101_0220962 Ga0496101_0220962_430_1071 188
31 3300048915 Ga0496112_0683174 Ga0496112_0683174_289_930 188
32 3300037471 Ga0395905_0141760 Ga0395905_0141760_402_989 189
33 3300037312 Ga0395899_0000632 Ga0395899_0000632_19945_20592 191
34 3300037418 Ga0395900_0000075 Ga0395900_0000075_60429_61076 191
35 3300037466 Ga0395898_0000055 Ga0395898_0000055_125762_126409 191
36 3300037471 Ga0395905_0000067 Ga0395905_0000067_152149_152796 191
37 3300038443 Ga0395901_0000477 Ga0395901_0000477_33517_34164 191
38 3300005327 Ga0070658_10018600 Ga0070658_100186005 192
39 3300005339 Ga0070660_100004780 Ga0070660_1000047805 192
40 3300005539 Ga0068853_100168287 Ga0068853_1001682872 192
41 3300005834 Ga0068851_10339052 Ga0068851_103390522 192
42 3300009177 Ga0105248_10675424 Ga0105248_106754242 192
43 3300025321 Ga0207656_10230884 Ga0207656_102308841 192
44 3300025919 Ga0207657_10000868 Ga0207657_1000086829 192
45 3300026067 Ga0207678_10017319 Ga0207678_100173196 192
46 3300026089 Ga0207648_10700349 Ga0207648_107003492 192
47 3300037471 Ga0395905_0080481 Ga0395905_0080481_717_1316 192
48 3300048911 Ga0496108_0033816 Ga0496108_0033816_1276_1875 192
49 3300048915 Ga0496112_0024353 Ga0496112_0024353_1347_1946 192
50 3300048916 Ga0496113_0036829 Ga0496113_0036829_1370_1969 192
51 3300048918 Ga0496115_0019503 Ga0496115_0019503_2407_3048 192
52 3300037418 Ga0395900_0262403 Ga0395900_0262403_52_702 193
53 3300037466 Ga0395898_0036770 Ga0395898_0036770_1570_2220 193
54 3300037471 Ga0395905_0028242 Ga0395905_0028242_1872_2522 193
55 3300045836 Ga0466958_0068899 Ga0466958_0068899_56_694 193
56 3300046616 Ga0495668_0070319 Ga0495668_0070319_1119_1814 193
57 3300061719 Ga0466962_0157726 Ga0466962_0157726_138_776 193
58 3300003322 rootL2_10315959 rootL2_103159591 194
59 3300037312 Ga0395899_0333298 Ga0395899_0333298_308_916 194
60 3300037471 Ga0395905_0068966 Ga0395905_0068966_497_1105 194
61 3300038443 Ga0395901_0264168 Ga0395901_0264168_1007_1615 194
62 3300044693 Ga0466961_0105267 Ga0466961_0105267_318_989 194
63 3300044719 Ga0466971_0160890 Ga0466971_0160890_246_863 194
64 3300045049 Ga0466959_0097392 Ga0466959_0097392_514_1185 194
65 3300045836 Ga0466958_0138158 Ga0466958_0138158_498_1115 194
66 3300061719 Ga0466962_0198921 Ga0466962_0198921_147_818 194
67 3300005355 Ga0070671_100186735 Ga0070671_1001867352 195
68 3300005364 Ga0070673_100389462 Ga0070673_1003894622 195
69 3300005367 Ga0070667_100163804 Ga0070667_1001638043 195
70 3300005457 Ga0070662_100295052 Ga0070662_1002950522 195
71 3300005841 Ga0068863_100201374 Ga0068863_1002013741 195
72 3300014325 Ga0163163_10768298 Ga0163163_107682981 195
73 3300025931 Ga0207644_10007676 Ga0207644_100076764 195
74 3300025941 Ga0207711_10038491 Ga0207711_100384914 195
75 3300025960 Ga0207651_10293045 Ga0207651_102930452 195
76 3300048911 Ga0496108_0155088 Ga0496108_0155088_708_1382 195
77 3300048914 Ga0496111_0069288 Ga0496111_0069288_33_707 195
78 3300005366 Ga0070659_100046016 Ga0070659_1000460164 196
79 3300005564 Ga0070664_100007940 Ga0070664_10000794012 196
80 3300005564 Ga0070664_100245091 Ga0070664_1002450912 196
81 3300005577 Ga0068857_100291322 Ga0068857_1002913223 196
82 3300005618 Ga0068864_100335935 Ga0068864_1003359353 196
83 3300021384 Ga0213876_10027501 Ga0213876_100275014 196
84 3300025919 Ga0207657_10078377 Ga0207657_100783772 196
85 3300025931 Ga0207644_10097914 Ga0207644_100979143 196
86 3300025945 Ga0207679_10008246 Ga0207679_100082463 196
87 3300025981 Ga0207640_10008451 Ga0207640_100084515 196
88 3300026067 Ga0207678_10007594 Ga0207678_100075949 196
89 3300026089 Ga0207648_10084540 Ga0207648_100845403 196
90 3300026116 Ga0207674_10115045 Ga0207674_101150453 196
91 3300032002 Ga0307416_100116479 Ga0307416_1001164792 196
92 3300032126 Ga0307415_100010002 Ga0307415_1000100024 196
93 3300037418 Ga0395900_0255347 Ga0395900_0255347_1056_1727 196
94 3300039437 Ga0436365_0635045 Ga0436365_0635045_2743_3384 196
95 3300049583 Ga0501067_0175770 Ga0501067_0175770_287_937 196
96 3300049585 Ga0501069_0105699 Ga0501069_0105699_534_1184 196
97 3300037418 Ga0395900_0078722 Ga0395900_0078722_1365_1982 197
98 3300037471 Ga0395905_0043629 Ga0395905_0043629_866_1483 197
99 3300038443 Ga0395901_0141124 Ga0395901_0141124_1168_1785 197
100 3300037312 Ga0395899_0154563 Ga0395899_0154563_373_1056 198
101 3300037418 Ga0395900_0003156 Ga0395900_0003156_10772_11455 198
102 3300038443 Ga0395901_0604647 Ga0395901_0604647_123_806 198
103 3300044693 Ga0466961_0245332 Ga0466961_0245332_163_780 198
104 3300005327 Ga0070658_10472655 Ga0070658_104726551 199
105 3300005339 Ga0070660_100059473 Ga0070660_1000594735 199
106 3300005616 Ga0068852_100203233 Ga0068852_1002032334 199
107 3300025909 Ga0207705_10147945 Ga0207705_101479453 199
108 3300025919 Ga0207657_10012092 Ga0207657_100120924 199
109 3300026142 Ga0207698_10495386 Ga0207698_104953862 199
110 3300013308 Ga0157375_10048094 Ga0157375_100480945 200
111 3300031731 Ga0307405_10543027 Ga0307405_105430272 200
112 3300031901 Ga0307406_10044326 Ga0307406_100443264 200
113 3300032004 Ga0307414_10143342 Ga0307414_101433422 200
114 3300032005 Ga0307411_10101250 Ga0307411_101012501 200
115 3300035241 Ga0373961_0110634 Ga0373961_0110634_20_661 200
116 3300003323 rootH1_10138591 rootH1_101385918 201
117 3300005530 Ga0070679_100082480 Ga0070679_1000824804 201
118 3300005564 Ga0070664_100133833 Ga0070664_1001338333 201
119 3300013104 Ga0157370_10209758 Ga0157370_102097583 201
120 3300013307 Ga0157372_10146672 Ga0157372_101466722 201
121 3300025920 Ga0207649_10094112 Ga0207649_100941123 201
122 3300026116 Ga0207674_10003653 Ga0207674_100036532 201
123 3300044765 Ga0466970_0378693 Ga0466970_0378693_68_700 201
124 3300061719 Ga0466962_0071321 Ga0466962_0071321_806_1435 201
125 3300005366 Ga0070659_100474832 Ga0070659_1004748321 202
126 3300005564 Ga0070664_100756052 Ga0070664_1007560522 202
127 3300005616 Ga0068852_100258752 Ga0068852_1002587522 202
128 3300025920 Ga0207649_10343141 Ga0207649_103431411 202
129 3300026041 Ga0207639_10350653 Ga0207639_103506532 202
130 3300037471 Ga0395905_0925948 Ga0395905_0925948_87_761 202
131 3300042005 Ga0439448_0002525 Ga0439448_0002525_714_1379 202
132 3300048915 Ga0496112_0290759 Ga0496112_0290759_167_799 202
133 3300037471 Ga0395905_0182456 Ga0395905_0182456_1320_1955 203
134 3300038443 Ga0395901_0020761 Ga0395901_0020761_4663_5298 203
135 3300044684 Ga0466966_0089076 Ga0466966_0089076_1134_1775 203
136 3300044842 Ga0466957_0441827 Ga0466957_0441827_221_856 203
137 3300045976 Ga0466967_0148747 Ga0466967_0148747_916_1551 203
138 3300048910 Ga0496107_0239827 Ga0496107_0239827_475_1107 203
139 3300049583 Ga0501067_0025250 Ga0501067_0025250_287_922 203
140 3300005327 Ga0070658_10015356 Ga0070658_100153565 204
141 3300036401 Ga0373937_0512942 Ga0373937_0512942_100_735 204
142 3300037471 Ga0395905_0039213 Ga0395905_0039213_2617_3252 204
143 3300037471 Ga0395905_0079312 Ga0395905_0079312_1727_2359 204
144 3300038443 Ga0395901_0168527 Ga0395901_0168527_74_706 204
145 3300038443 Ga0395901_0686909 Ga0395901_0686909_310_945 204
146 3300044765 Ga0466970_0024589 Ga0466970_0024589_2443_3081 204
147 3300048917 Ga0496114_0000162 Ga0496114_0000162_34494_35138 204
148 3300005327 Ga0070658_10071184 Ga0070658_100711844 205
149 3300005336 Ga0070680_100101658 Ga0070680_1001016582 205
150 3300005355 Ga0070671_100049958 Ga0070671_1000499585 205
151 3300005364 Ga0070673_100074593 Ga0070673_1000745933 205
152 3300005543 Ga0070672_100561895 Ga0070672_1005618952 205
153 3300005616 Ga0068852_100335349 Ga0068852_1003353492 205
154 3300005618 Ga0068864_100192742 Ga0068864_1001927421 205
155 3300005834 Ga0068851_10009488 Ga0068851_100094883 205
156 3300009177 Ga0105248_10042414 Ga0105248_100424142 205
157 3300025321 Ga0207656_10325358 Ga0207656_103253581 205
158 3300025909 Ga0207705_10005854 Ga0207705_100058545 205
159 3300025931 Ga0207644_10018189 Ga0207644_100181893 205
160 3300025944 Ga0207661_10073344 Ga0207661_100733441 205
161 3300025960 Ga0207651_10066951 Ga0207651_100669513 205
162 3300026067 Ga0207678_10027596 Ga0207678_100275965 205
163 3300026088 Ga0207641_10509207 Ga0207641_105092072 205
164 3300026116 Ga0207674_10011384 Ga0207674_1001138411 205
165 3300031852 Ga0307410_10338874 Ga0307410_103388742 205
166 3300037471 Ga0395905_0236032 Ga0395905_0236032_365_1000 205
167 3300044901 Ga0466960_0015252 Ga0466960_0015252_1510_2154 205
168 3300045976 Ga0466967_0418344 Ga0466967_0418344_352_1023 205
169 3300046558 Ga0495633_0087143 Ga0495633_0087143_304_942 205
170 3300048907 Ga0496104_0208569 Ga0496104_0208569_46_681 205
171 3300048910 Ga0496107_0251001 Ga0496107_0251001_661_1296 205
172 3300048912 Ga0496109_0029444 Ga0496109_0029444_568_1203 205
173 3300048913 Ga0496110_0053715 Ga0496110_0053715_1620_2255 205
174 3300048914 Ga0496111_0012878 Ga0496111_0012878_1092_1727 205
175 3300048915 Ga0496112_0024353 Ga0496112_0024353_2844_3479 205
176 3300048916 Ga0496113_0036829 Ga0496113_0036829_2867_3502 205
177 3300005327 Ga0070658_10180655 Ga0070658_101806551 206
178 3300005366 Ga0070659_100295987 Ga0070659_1002959872 206
179 3300025933 Ga0207706_10195715 Ga0207706_101957154 206
180 3300031852 Ga0307410_10006913 Ga0307410_100069136 206
181 3300031903 Ga0307407_10342501 Ga0307407_103425011 206
182 3300031995 Ga0307409_100016717 Ga0307409_1000167174 206
183 3300032005 Ga0307411_10007041 Ga0307411_100070414 206
184 3300037418 Ga0395900_0260163 Ga0395900_0260163_18_686 206
185 3300037418 Ga0395900_0663717 Ga0395900_0663717_275_961 206
186 3300037466 Ga0395898_0146424 Ga0395898_0146424_1136_1774 206
187 3300037471 Ga0395905_0049531 Ga0395905_0049531_1089_1757 206
188 3300037471 Ga0395905_0126166 Ga0395905_0126166_14_700 206
189 3300038443 Ga0395901_0122684 Ga0395901_0122684_1928_2614 206
190 3300038443 Ga0395901_0122864 Ga0395901_0122864_1048_1716 206
191 3300048916 Ga0496113_0156656 Ga0496113_0156656_305_946 206
192 3300025921 Ga0207652_10031744 Ga0207652_100317448 207
193 3300005356 Ga0070674_100310012 Ga0070674_1003100122 208
194 3300005530 Ga0070679_100397860 Ga0070679_1003978602 208
195 3300005618 Ga0068864_100006950 Ga0068864_1000069509 208
196 3300009551 Ga0105238_10211463 Ga0105238_102114634 208
197 3300025909 Ga0207705_10370588 Ga0207705_103705882 208
198 3300025921 Ga0207652_10329605 Ga0207652_103296052 208
199 3300025937 Ga0207669_10404913 Ga0207669_104049132 208
200 3300025949 Ga0207667_10503366 Ga0207667_105033662 208
201 3300026095 Ga0207676_10020058 Ga0207676_100200583 208
202 3300037471 Ga0395905_0068011 Ga0395905_0068011_787_1446 208
203 3300045049 Ga0466959_0207991 Ga0466959_0207991_293_946 208
204 3300046525 Ga0495663_0004434 Ga0495663_0004434_2926_3606 208
205 3300046684 Ga0495669_0032519 Ga0495669_0032519_389_1069 208
206 3300047445 Ga0495677_0002808 Ga0495677_0002808_1239_1919 208
207 3300048913 Ga0496110_0168786 Ga0496110_0168786_881_1555 208
208 3300048916 Ga0496113_0107124 Ga0496113_0107124_468_1142 208
209 3300005338 Ga0068868_100006919 Ga0068868_1000069192 209
210 3300009098 Ga0105245_10137152 Ga0105245_101371522 209
211 3300013296 Ga0157374_10049219 Ga0157374_100492192 209
212 3300005435 Ga0070714_100601886 Ga0070714_1006018862 212
213 3300005436 Ga0070713_100361589 Ga0070713_1003615892 212
214 3300006028 Ga0070717_10338792 Ga0070717_103387922 212
215 3300025929 Ga0207664_10488075 Ga0207664_104880751 212
216 3300005327 Ga0070658_10727901 Ga0070658_107279012 214
217 3300005331 Ga0070670_100006312 Ga0070670_1000063126 214
218 3300005333 Ga0070677_10016999 Ga0070677_100169995 214
219 3300005335 Ga0070666_10081772 Ga0070666_100817722 214
220 3300005338 Ga0068868_100034449 Ga0068868_1000344495 214
221 3300005356 Ga0070674_100026769 Ga0070674_1000267693 214
222 3300005455 Ga0070663_100205450 Ga0070663_1002054503 214
223 3300005459 Ga0068867_100115041 Ga0068867_1001150411 214
224 3300005563 Ga0068855_100059111 Ga0068855_1000591117 214
225 3300005578 Ga0068854_100048625 Ga0068854_1000486253 214
226 3300005718 Ga0068866_10039982 Ga0068866_100399823 214
227 3300013307 Ga0157372_11798663 Ga0157372_117986631 214
228 3300014745 Ga0157377_10528643 Ga0157377_105286432 214
229 3300025899 Ga0207642_10226588 Ga0207642_102265882 214
230 3300025904 Ga0207647_10301550 Ga0207647_103015501 214
231 3300025919 Ga0207657_10009689 Ga0207657_1000968910 214
232 3300025933 Ga0207706_10003606 Ga0207706_100036063 214
233 3300025937 Ga0207669_10148718 Ga0207669_101487182 214
234 3300025940 Ga0207691_10288298 Ga0207691_102882982 214
235 3300025942 Ga0207689_10121774 Ga0207689_101217741 214
236 3300025949 Ga0207667_10961099 Ga0207667_109610991 214
237 3300025986 Ga0207658_10151186 Ga0207658_101511861 214
238 3300026067 Ga0207678_10001124 Ga0207678_1000112423 214
239 3300026088 Ga0207641_10233383 Ga0207641_102333832 214
240 3300026089 Ga0207648_10013681 Ga0207648_100136814 214
241 3300037466 Ga0395898_0620564 Ga0395898_0620564_192_875 214
242 3300042157 Ga0439458_0003440 Ga0439458_0003440_2257_2922 216
243 3300009177 Ga0105248_10224077 Ga0105248_102240772 217
244 3300038443 Ga0395901_0124169 Ga0395901_0124169_238_921 217
245 3300044706 Ga0466964_0006327 Ga0466964_0006327_2569_3240 217
246 3300044735 Ga0466968_0003735 Ga0466968_0003735_4811_5482 217
247 3300044765 Ga0466970_0038764 Ga0466970_0038764_903_1574 217
248 3300045049 Ga0466959_0135500 Ga0466959_0135500_129_800 217
249 3300045836 Ga0466958_0139516 Ga0466958_0139516_793_1464 217
250 3300045976 Ga0466967_0096830 Ga0466967_0096830_1983_2654 217
251 3300048915 Ga0496112_0547151 Ga0496112_0547151_18_692 217
252 3300037418 Ga0395900_0255658 Ga0395900_0255658_196_858 218
253 3300037418 Ga0395900_0906975 Ga0395900_0906975_76_741 219
254 3300038443 Ga0395901_0064316 Ga0395901_0064316_2744_3409 219
255 3300037471 Ga0395905_0131860 Ga0395905_0131860_834_1502 221
256 3300038443 Ga0395901_0636820 Ga0395901_0636820_105_773 221
257 3300005335 Ga0070666_10040709 Ga0070666_100407093 222
258 3300005364 Ga0070673_100033421 Ga0070673_1000334214 222
259 3300005356 Ga0070674_100831752 Ga0070674_1008317521 223
260 3300005456 Ga0070678_100078953 Ga0070678_1000789533 223
261 3300005457 Ga0070662_100070711 Ga0070662_1000707113 223
262 3300005543 Ga0070672_100071653 Ga0070672_1000716534 223
263 3300006881 Ga0068865_100022662 Ga0068865_1000226624 223
264 3300009177 Ga0105248_10315861 Ga0105248_103158611 223
265 3300017792 Ga0163161_10118556 Ga0163161_101185562 223
266 3300025933 Ga0207706_10012636 Ga0207706_100126369 223
267 3300025940 Ga0207691_10262878 Ga0207691_102628782 223
268 3300037418 Ga0395900_0726544 Ga0395900_0726544_220_894 223
269 3300005366 Ga0070659_100068240 Ga0070659_1000682405 227
270 3300005843 Ga0068860_100905667 Ga0068860_1009056671 227
271 3300001990 JGI24737J22298_10002022 JGI24737J22298_100020223 228
272 3300005339 Ga0070660_100228370 Ga0070660_1002283701 228
273 3300005366 Ga0070659_100002128 Ga0070659_1000021284 228
274 3300005457 Ga0070662_100005161 Ga0070662_10000516110 228
275 3300013102 Ga0157371_10147634 Ga0157371_101476341 228
276 3300013307 Ga0157372_10136617 Ga0157372_101366173 228
277 3300025904 Ga0207647_10022432 Ga0207647_100224324 228
278 3300025933 Ga0207706_10003091 Ga0207706_1000309111 228
279 3300042012 Ga0439455_0015153 Ga0439455_0015153_816_1502 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

105

214

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e5l-assembly3.cif.gz_C crystal structure of mycobacterium tuberculosis l,d-transpeptidase 1 at 1.89 angstrom 0.8788 105 215
4z7a-assembly1.cif.gz_A structural and biochemical characterization of a non-functionally redundant m. tuberculosis (3,3) l,d-transpeptidase, ldtmt5. 0.8772 106 215
5e5l-assembly4.cif.gz_D crystal structure of mycobacterium tuberculosis l,d-transpeptidase 1 at 1.89 angstrom 0.877 105 215
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.8761 106 215
6d51-assembly1.cif.gz_A crystal structure of l,d-transpeptidase 3 from mycobacterium tuberculosis in complex with a faropenem-derived adduct 0.8756 106 214
ID Description Score Start End Superfamily
6d51A02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8756 106 214 2.40.440.10
af_M9PB21_880_1122_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.86 106 130 3.10.129.110
4jmxA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.851 106 215 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8473 106 215 2.40.440.10
6iywC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8361 106 215 2.40.440.10
ID Description Score Start End GO Terms
AF-M4S8H1-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9512 89 214 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A0Q8RT77-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.948 69 216 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A0Q4LAG3-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.942 83 216 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A147IZZ4-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9415 83 216 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A0Q4K0S9-F1-model_v4 deleted 0.94 89 215

Feature Viewer

pLDDT pTM Quality
76.72 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map