F382686

General Info

Members Datasets Scaffolds Average Seq Length
278 102 556 258

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_615999_c1|nmdc:mga05p37_615999_c1_89_1009
Length 306
Sequence MPLLDTHAHLHFPEFADDLDAVLARARQAGVRAMVTIGTDRDTNPAAVALAERHRDIYATVGIHPHDAAEATDADLEEMERLAAASPRVVAFGEMGLDFFRNLSPPAAQVRVFRRQLELARRLGKPVVVHCRDAHAETLAILAEARVGEIGGVMHCFSGDMDVARRCLDLGLYISLAGPVTYKNARALPEVARLVPEDRLVVETDCPFLPPHPNRGQRNEPSWMALTASRIAELRGVSPEALGEMVTRNGARLFGIELSSEGGSAPLAHARGNLLDSLASPPAAARPAPDLPPESGLRGQSPRSNA

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
53 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
54 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
67 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
68 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
69 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.92
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_615999_c1 3300050507 Bacteria 1222
2 Ga0068869_100199816 3300005334 Bacteria 1576
3 Ga0070694_100029852 3300005444 Bacteria 3562
4 Ga0070708_100041545 3300005445 Bacteria 4032
5 Ga0070708_100136939 3300005445 Bacteria 2269
6 Ga0070708_100140985 3300005445 Bacteria 2235
7 Ga0070708_100437856 3300005445 Bacteria 1233
8 Ga0070708_100469316 3300005445 Bacteria 1187
9 Ga0070662_100117545 3300005457 Bacteria 2034
10 Ga0068867_100329930 3300005459 Bacteria 1267
11 Ga0070706_100004721 3300005467 Bacteria 13066
12 Ga0070706_100012919 3300005467 Bacteria 7728
13 Ga0070706_100157354 3300005467 Bacteria 2121
14 Ga0070706_100277691 3300005467 Bacteria 1563
15 Ga0070706_100383863 3300005467 Bacteria 1308
16 Ga0070706_100574866 3300005467 Unclassified 1048
17 Ga0070707_100000571 3300005468 Bacteria 37049
18 Ga0070707_100008438 3300005468 Bacteria 9571
19 Ga0070707_100018010 3300005468 Bacteria 6644
20 Ga0070707_100277120 3300005468 Bacteria 1630
21 Ga0070698_100052603 3300005471 Bacteria 4142
22 Ga0070698_100084442 3300005471 Bacteria 3163
23 Ga0070698_100400410 3300005471 Bacteria 1306
24 Ga0070699_100004775 3300005518 Bacteria 11976
25 Ga0070699_100006542 3300005518 Bacteria 10141
26 Ga0070699_100009712 3300005518 Bacteria 8328
27 Ga0070699_100176337 3300005518 Bacteria 1895
28 Ga0070699_100223357 3300005518 Bacteria 1679
29 Ga0070699_100306620 3300005518 Bacteria 1425
30 Ga0070697_100035891 3300005536 Bacteria 4001
31 Ga0070697_100048757 3300005536 Bacteria 3435
32 Ga0070697_100088104 3300005536 Bacteria 2563
33 Ga0070697_100145545 3300005536 Bacteria 1994
34 Ga0070672_100130881 3300005543 Bacteria 2062
35 Ga0070696_100139783 3300005546 Bacteria 1769
36 Ga0070704_100049809 3300005549 Bacteria 2940
37 Ga0070704_100345051 3300005549 Bacteria 1255
38 Ga0068861_100504685 3300005719 Bacteria 1094
39 Ga0068863_100080224 3300005841 Bacteria 3091
40 Ga0068862_100370466 3300005844 Bacteria 1333
41 Ga0081539_10000083 3300005985 Bacteria 218881
42 Ga0075428_100084752 3300006844 Bacteria 3457
43 Ga0075428_100122378 3300006844 Bacteria 2832
44 Ga0075428_100162241 3300006844 Bacteria 2426
45 Ga0075430_100000073 3300006846 Bacteria 54632
46 Ga0075430_100001043 3300006846 Bacteria 21902
47 Ga0075430_100033501 3300006846 Bacteria 4360
48 Ga0075430_100047318 3300006846 Bacteria 3631
49 Ga0075430_100068866 3300006846 Bacteria 2969
50 Ga0075431_100001285 3300006847 Bacteria 22920
51 Ga0075431_100003691 3300006847 Bacteria 14871
52 Ga0075431_100004765 3300006847 Bacteria 13341
53 Ga0075431_100035867 3300006847 Bacteria 5106
54 Ga0075431_100050392 3300006847 Bacteria 4293
55 Ga0075431_100053779 3300006847 Bacteria 4151
56 Ga0075431_100246977 3300006847 Bacteria 1814
57 Ga0075431_100325644 3300006847 Bacteria 1549
58 Ga0075433_10017006 3300006852 Bacteria 6012
59 Ga0075433_10020663 3300006852 Bacteria 5510
60 Ga0075433_10079668 3300006852 Bacteria 2886
61 Ga0075433_10086387 3300006852 Bacteria 2770
62 Ga0075433_10257116 3300006852 Bacteria 1549
63 Ga0075434_100000103 3300006871 Bacteria 47848
64 Ga0075434_100004665 3300006871 Bacteria 12386
65 Ga0075434_100090048 3300006871 Bacteria 3069
66 Ga0075434_100107347 3300006871 Bacteria 2802
67 Ga0075429_100004222 3300006880 Bacteria 12308
68 Ga0075429_100004410 3300006880 Bacteria 12089
69 Ga0075429_100010411 3300006880 Bacteria 8048
70 Ga0075429_100310440 3300006880 Bacteria 1380
71 Ga0075429_100372917 3300006880 Bacteria 1249
72 Ga0075436_100009437 3300006914 Bacteria 6671
73 Ga0075436_100019794 3300006914 Bacteria 4615
74 Ga0075436_100023848 3300006914 Bacteria 4204
75 Ga0075436_100416827 3300006914 Bacteria 975
76 Ga0075435_100003189 3300007076 Bacteria 11100
77 Ga0075435_100030875 3300007076 Bacteria 4217
78 Ga0075435_100032400 3300007076 Bacteria 4128
79 Ga0099794_10021047 3300007265 Bacteria 2960
80 Ga0099794_10084052 3300007265 Bacteria 1573
81 Ga0111539_10002627 3300009094 Bacteria 23815
82 Ga0111539_10009111 3300009094 Bacteria 12561
83 Ga0111539_10009577 3300009094 Bacteria 12226
84 Ga0114129_10002685 3300009147 Bacteria 24746
85 Ga0114129_10004921 3300009147 Bacteria 18854
86 Ga0114129_10006016 3300009147 Bacteria 17198
87 Ga0114129_10006289 3300009147 Bacteria 16838
88 Ga0114129_10009493 3300009147 Bacteria 13872
89 Ga0114129_10046366 3300009147 Bacteria 6108
90 Ga0114129_10067184 3300009147 Bacteria 5000
91 Ga0114129_10076000 3300009147 Bacteria 4676
92 Ga0114129_10092585 3300009147 Bacteria 4188
93 Ga0114129_10115240 3300009147 Bacteria 3704
94 Ga0114129_10242344 3300009147 Bacteria 2423
95 Ga0114129_10259441 3300009147 Unclassified 2330
96 Ga0114129_10296937 3300009147 Bacteria 2155
97 Ga0114129_10429759 3300009147 Bacteria 1735
98 Ga0105249_10097865 3300009553 Bacteria 2755
99 Ga0157378_10203491 3300013297 Bacteria 1873
100 Ga0157378_10357858 3300013297 Bacteria 1428
101 Ga0163162_11742439 3300013306 Bacteria 712
102 Ga0157375_10650019 3300013308 Bacteria 1211
103 Ga0207645_10043671 3300025907 Bacteria 2869
104 Ga0207684_10001030 3300025910 Bacteria 31256
105 Ga0207684_10001423 3300025910 Bacteria 25890
106 Ga0207684_10065496 3300025910 Bacteria 3085
107 Ga0207684_10089147 3300025910 Bacteria 2628
108 Ga0207660_10074901 3300025917 Bacteria 2471
109 Ga0207662_10184289 3300025918 Bacteria 1345
110 Ga0207646_10002299 3300025922 Bacteria 22693
111 Ga0207646_10004526 3300025922 Bacteria 15055
112 Ga0207646_10018933 3300025922 Bacteria 6409
113 Ga0207646_10049709 3300025922 Bacteria 3755
114 Ga0207646_10378811 3300025922 Bacteria 1278
115 Ga0207646_10622885 3300025922 Bacteria 968
116 Ga0207706_10276590 3300025933 Bacteria 1465
117 Ga0207709_10524556 3300025935 Bacteria 928
118 Ga0207691_10049382 3300025940 Bacteria 3855
119 Ga0207712_10408638 3300025961 Bacteria 1143
120 Ga0207678_10374959 3300026067 Bacteria 1229
121 Ga0207641_10227371 3300026088 Bacteria 1733
122 Ga0207648_10301773 3300026089 Bacteria 1436
123 Ga0207648_10338304 3300026089 Bacteria 1355
124 Ga0207428_10000362 3300027907 Bacteria 58443
125 Ga0307408_100005530 3300031548 Bacteria 8443
126 Ga0307408_100269818 3300031548 Unclassified 1412
127 Ga0307410_10166735 3300031852 Bacteria 1656
128 Ga0307409_100030849 3300031995 Bacteria 3859
129 Ga0307416_100004656 3300032002 Bacteria 8307
130 Ga0307416_100031484 3300032002 Unclassified 3994
131 Ga0307411_10159098 3300032005 Unclassified 1689
132 Ga0373940_0033043 3300035088 Bacteria 1390
133 Ga0373939_0002297 3300035114 Bacteria 4519
134 Ga0373941_0030800 3300035115 Bacteria 1593
135 Ga0373931_0019324 3300035691 Bacteria 3400
136 Ga0395899_0400498 3300037312 Bacteria 908
137 Ga0395900_0003243 3300037418 Bacteria 17615
138 Ga0395898_0062525 3300037466 Bacteria 3615
139 Ga0395905_0433020 3300037471 Unclassified 1212
140 Ga0395901_0019665 3300038443 Bacteria 6903
141 Ga0451577_0007380 3300042876 Bacteria 10794
142 Ga0453683_0117515 3300044673 Bacteria 1674
143 Ga0453684_0000041 3300044712 Bacteria 690022
144 Ga0453684_0050788 3300044712 Bacteria 5448
145 Ga0451576_0414196 3300045051 Bacteria 1413
146 Ga0495580_0000155 3300046472 Bacteria 49988
147 Ga0495642_0040406 3300046528 Bacteria 1895
148 Ga0495656_0046361 3300046615 Bacteria 1839
149 Ga0495669_0077786 3300046684 Bacteria 1519
150 Ga0495670_0296052 3300046691 Bacteria 867
151 Ga0496102_0011970 3300048905 Bacteria 7493
152 Ga0496106_0227868 3300048909 Bacteria 1487
153 Ga0496106_0254142 3300048909 Bacteria 1406
154 Ga0501033_0126268 3300049570 Bacteria 1855
155 Ga0501033_0365158 3300049570 Bacteria 1010
156 Ga0501036_0066189 3300049572 Bacteria 3057
157 Ga0501040_0214827 3300049576 Bacteria 1368
158 Ga0501041_0007167 3300049577 Bacteria 6541
159 Ga0501041_0052775 3300049577 Bacteria 2479
160 Ga0501041_0097450 3300049577 Bacteria 1818
161 Ga0501041_0189099 3300049577 Bacteria 1289
162 Ga0501042_0074630 3300049578 Bacteria 2427
163 Ga0501042_0228532 3300049578 Bacteria 1342
164 Ga0501046_0048786 3300049580 Bacteria 3352
165 Ga0501046_0114557 3300049580 Bacteria 2056
166 Ga0501046_0229279 3300049580 Bacteria 1373
167 Ga0501048_0048738 3300049582 Bacteria 3021
168 Ga0501048_0118874 3300049582 Bacteria 1867
169 Ga0501068_0019203 3300049584 Bacteria 3966
170 Ga0501068_0031699 3300049584 Bacteria 3140
171 Ga0501069_0031111 3300049585 Bacteria 2934
172 Ga0501071_0075233 3300049587 Bacteria 2465
173 Ga0501071_0170529 3300049587 Bacteria 1629
174 Ga0501071_0298584 3300049587 Bacteria 1221
175 Ga0501072_0049068 3300049588 Bacteria 3323
176 Ga0501072_0066106 3300049588 Bacteria 2852
177 Ga0501072_0149113 3300049588 Bacteria 1865
178 Ga0501072_0232641 3300049588 Bacteria 1468
179 Ga0501074_0397600 3300049590 Bacteria 977
180 Ga0501074_0526656 3300049590 Bacteria 837
181 Ga0501074_0551418 3300049590 Bacteria 816
182 Ga0501075_0015042 3300049591 Bacteria 5551
183 Ga0501075_0027482 3300049591 Bacteria 4193
184 Ga0501075_0039324 3300049591 Bacteria 3540
185 Ga0501075_0496333 3300049591 Bacteria 931
186 Ga0501076_0005008 3300049592 Bacteria 9482
187 Ga0501076_0017295 3300049592 Bacteria 5477
188 Ga0501076_0082287 3300049592 Bacteria 2584
189 Ga0501076_0097158 3300049592 Bacteria 2373
190 Ga0501076_0505440 3300049592 Bacteria 996
191 Ga0501077_0006606 3300049593 Bacteria 7119
192 Ga0501077_0397880 3300049593 Bacteria 880
193 Ga0501079_0033378 3300049741 Bacteria 3959
194 Ga0501079_0039834 3300049741 Bacteria 3625
195 Ga0501079_0448221 3300049741 Bacteria 1013
196 Ga0501080_0036329 3300049742 Bacteria 4600
197 Ga0501081_0013581 3300049743 Bacteria 5356
198 Ga0501081_0038179 3300049743 Bacteria 3279
199 Ga0501081_0049932 3300049743 Bacteria 2881
200 Ga0501081_0090744 3300049743 Bacteria 2148
201 Ga0501081_0151365 3300049743 Bacteria 1667
202 Ga0501081_0321028 3300049743 Bacteria 1138
203 Ga0501083_0105012 3300049744 Bacteria 1861
204 Ga0501045_0040037 3300049824 Bacteria 3410
205 Ga0501045_0041383 3300049824 Bacteria 3353
206 nmdc:mga05p37_119041_c1 3300050507 Bacteria 3245
207 nmdc:mga05p37_132217_c1 3300050507 Bacteria 3062
208 nmdc:mga05p37_1607_c1 3300050507 Bacteria 26171
209 nmdc:mga05p37_166387_c1 3300050507 Unclassified 2691
210 nmdc:mga05p37_232597_c1 3300050507 Bacteria 2220
211 nmdc:mga05p37_30899_c1 3300050507 Bacteria 6538
212 nmdc:mga05p37_32275_c1 3300050507 Bacteria 6403
213 nmdc:mga05p37_327880_c1 3300050507 Bacteria 1809
214 nmdc:mga05p37_349056_c1 3300050507 Bacteria 1742
215 nmdc:mga05p37_445602_c1 3300050507 Bacteria 1500
216 nmdc:mga05p37_524173_c1 3300050507 Bacteria 1355
217 nmdc:mga05p37_52601_c1 3300050507 Bacteria 5007
218 nmdc:mga05p37_98468_c1 3300050507 Bacteria 3602
219 nmdc:mga09592_12522_c1 3300050508 Bacteria 6912
220 nmdc:mga09592_144396_c1 3300050508 Bacteria 2052
221 nmdc:mga09592_1882_c1 3300050508 Bacteria 16891
222 nmdc:mga09592_20995_c1 3300050508 Bacteria 5377
223 nmdc:mga09592_43104_c1 3300050508 Bacteria 3797
224 nmdc:mga09592_49731_c1 3300050508 Bacteria 3535
225 nmdc:mga09592_53812_c1 3300050508 Bacteria 3399
226 nmdc:mga09592_678820_c1 3300050508 Unclassified 878
227 nmdc:mga0qj67_100994_c1 3300050509 Bacteria 2325
228 nmdc:mga0qj67_10850_c1 3300050509 Bacteria 6815
229 nmdc:mga0qj67_1117_c1 3300050509 Bacteria 18591
230 nmdc:mga0qj67_317_c1 3300050509 Bacteria 33316
231 nmdc:mga0qj67_6158_c1 3300050509 Bacteria 8793
232 nmdc:mga06r32_11660_c1 3300050510 Bacteria 7913
233 nmdc:mga06r32_118103_c1 3300050510 Bacteria 2614
234 nmdc:mga06r32_1845_c1 3300050510 Bacteria 18887
235 nmdc:mga06r32_203999_c1 3300050510 Bacteria 1965
236 nmdc:mga06r32_482696_c1 3300050510 Bacteria 1217
237 nmdc:mga06r32_537583_c1 3300050510 Bacteria 1143
238 nmdc:mga06r32_6272_c1 3300050510 Bacteria 10676
239 nmdc:mga06r32_716111_c1 3300050510 Bacteria 966
240 nmdc:mga08y16_248605_c1 3300050511 Bacteria 1838
241 nmdc:mga08y16_58908_c1 3300050511 Unclassified 4013
242 nmdc:mga08y16_7382_c1 3300050511 Bacteria 11521
243 nmdc:mga0n895_10508_c1 3300050512 Bacteria 8188
244 nmdc:mga0n895_118110_c1 3300050512 Bacteria 2672
245 nmdc:mga0n895_132138_c1 3300050512 Bacteria 2522
246 nmdc:mga0n895_173213_c1 3300050512 Bacteria 2190
247 nmdc:mga0n895_206_c1 3300050512 Bacteria 36895
248 nmdc:mga0n895_258967_c1 3300050512 Bacteria 1766
249 nmdc:mga0n895_5815_c1 3300050512 Bacteria 10361
250 nmdc:mga0rr50_18832_c1 3300050513 Bacteria 4646
251 nmdc:mga0rr50_246044_c1 3300050513 Bacteria 1484
252 nmdc:mga0rr50_4482_c1 3300050513 Bacteria 8222
253 nmdc:mga0rr50_74570_c1 3300050513 Bacteria 2598
254 nmdc:mga0rr50_7883_c1 3300050513 Bacteria 6605
255 nmdc:mga08x19_94090_c1 3300050514 Bacteria 1981
256 nmdc:mga0a205_117564_c1 3300050515 Bacteria 2557
257 nmdc:mga0a205_21723_c1 3300050515 Bacteria 6068
258 nmdc:mga0a205_22556_c1 3300050515 Bacteria 5965
259 nmdc:mga0a205_44612_c1 3300050515 Bacteria 4275
260 nmdc:mga0a205_462745_c1 3300050515 Bacteria 1128
261 nmdc:mga0a205_75880_c1 3300050515 Bacteria 3248
262 Ga0501084_0000835 3300054114 Bacteria 23752
263 Ga0501084_0010599 3300054114 Bacteria 7625
264 Ga0501084_0028168 3300054114 Bacteria 4694
265 Ga0501084_0030516 3300054114 Bacteria 4507
266 Ga0501084_0214196 3300054114 Bacteria 1625
267 Ga0501082_0004733 3300060353 Bacteria 11868
268 Ga0501082_0025162 3300060353 Bacteria 5129
269 Ga0501082_0070532 3300060353 Bacteria 3008
270 Ga0501082_0088362 3300060353 Bacteria 2674
271 Ga0501082_0385972 3300060353 Bacteria 1222
272 Ga0530510_0001325 3300061734 Bacteria 16554
273 Ga0530510_0006118 3300061734 Bacteria 8356
274 Ga0530510_0021025 3300061734 Bacteria 4642
275 Ga0530510_0038768 3300061734 Bacteria 3441
276 Ga0530510_0084294 3300061734 Unclassified 2315
277 Ga0530510_0128128 3300061734 Bacteria 1866
278 Ga0530510_0319687 3300061734 Bacteria 1163
279 nmdc:mga05p37_615999_c1
280 Ga0068869_100199816
281 Ga0070694_100029852
282 Ga0070708_100041545
283 Ga0070708_100136939
284 Ga0070708_100140985
285 Ga0070708_100437856
286 Ga0070708_100469316
287 Ga0070662_100117545
288 Ga0068867_100329930
289 Ga0070706_100004721
290 Ga0070706_100012919
291 Ga0070706_100157354
292 Ga0070706_100277691
293 Ga0070706_100383863
294 Ga0070706_100574866
295 Ga0070707_100000571
296 Ga0070707_100008438
297 Ga0070707_100018010
298 Ga0070707_100277120
299 Ga0070698_100052603
300 Ga0070698_100084442
301 Ga0070698_100400410
302 Ga0070699_100004775
303 Ga0070699_100006542
304 Ga0070699_100009712
305 Ga0070699_100176337
306 Ga0070699_100223357
307 Ga0070699_100306620
308 Ga0070697_100035891
309 Ga0070697_100048757
310 Ga0070697_100088104
311 Ga0070697_100145545
312 Ga0070672_100130881
313 Ga0070696_100139783
314 Ga0070704_100049809
315 Ga0070704_100345051
316 Ga0068861_100504685
317 Ga0068863_100080224
318 Ga0068862_100370466
319 Ga0081539_10000083
320 Ga0075428_100084752
321 Ga0075428_100122378
322 Ga0075428_100162241
323 Ga0075430_100000073
324 Ga0075430_100001043
325 Ga0075430_100033501
326 Ga0075430_100047318
327 Ga0075430_100068866
328 Ga0075431_100001285
329 Ga0075431_100003691
330 Ga0075431_100004765
331 Ga0075431_100035867
332 Ga0075431_100050392
333 Ga0075431_100053779
334 Ga0075431_100246977
335 Ga0075431_100325644
336 Ga0075433_10017006
337 Ga0075433_10020663
338 Ga0075433_10079668
339 Ga0075433_10086387
340 Ga0075433_10257116
341 Ga0075434_100000103
342 Ga0075434_100004665
343 Ga0075434_100090048
344 Ga0075434_100107347
345 Ga0075429_100004222
346 Ga0075429_100004410
347 Ga0075429_100010411
348 Ga0075429_100310440
349 Ga0075429_100372917
350 Ga0075436_100009437
351 Ga0075436_100019794
352 Ga0075436_100023848
353 Ga0075436_100416827
354 Ga0075435_100003189
355 Ga0075435_100030875
356 Ga0075435_100032400
357 Ga0099794_10021047
358 Ga0099794_10084052
359 Ga0111539_10002627
360 Ga0111539_10009111
361 Ga0111539_10009577
362 Ga0114129_10002685
363 Ga0114129_10004921
364 Ga0114129_10006016
365 Ga0114129_10006289
366 Ga0114129_10009493
367 Ga0114129_10046366
368 Ga0114129_10067184
369 Ga0114129_10076000
370 Ga0114129_10092585
371 Ga0114129_10115240
372 Ga0114129_10242344
373 Ga0114129_10259441
374 Ga0114129_10296937
375 Ga0114129_10429759
376 Ga0105249_10097865
377 Ga0157378_10203491
378 Ga0157378_10357858
379 Ga0163162_11742439
380 Ga0157375_10650019
381 Ga0207645_10043671
382 Ga0207684_10001030
383 Ga0207684_10001423
384 Ga0207684_10065496
385 Ga0207684_10089147
386 Ga0207660_10074901
387 Ga0207662_10184289
388 Ga0207646_10002299
389 Ga0207646_10004526
390 Ga0207646_10018933
391 Ga0207646_10049709
392 Ga0207646_10378811
393 Ga0207646_10622885
394 Ga0207706_10276590
395 Ga0207709_10524556
396 Ga0207691_10049382
397 Ga0207712_10408638
398 Ga0207678_10374959
399 Ga0207641_10227371
400 Ga0207648_10301773
401 Ga0207648_10338304
402 Ga0207428_10000362
403 Ga0307408_100005530
404 Ga0307408_100269818
405 Ga0307410_10166735
406 Ga0307409_100030849
407 Ga0307416_100004656
408 Ga0307416_100031484
409 Ga0307411_10159098
410 Ga0373940_0033043
411 Ga0373939_0002297
412 Ga0373941_0030800
413 Ga0373931_0019324
414 Ga0395899_0400498
415 Ga0395900_0003243
416 Ga0395898_0062525
417 Ga0395905_0433020
418 Ga0395901_0019665
419 Ga0451577_0007380
420 Ga0453683_0117515
421 Ga0453684_0000041
422 Ga0453684_0050788
423 Ga0451576_0414196
424 Ga0495580_0000155
425 Ga0495642_0040406
426 Ga0495656_0046361
427 Ga0495669_0077786
428 Ga0495670_0296052
429 Ga0496102_0011970
430 Ga0496106_0227868
431 Ga0496106_0254142
432 Ga0501033_0126268
433 Ga0501033_0365158
434 Ga0501036_0066189
435 Ga0501040_0214827
436 Ga0501041_0007167
437 Ga0501041_0052775
438 Ga0501041_0097450
439 Ga0501041_0189099
440 Ga0501042_0074630
441 Ga0501042_0228532
442 Ga0501046_0048786
443 Ga0501046_0114557
444 Ga0501046_0229279
445 Ga0501048_0048738
446 Ga0501048_0118874
447 Ga0501068_0019203
448 Ga0501068_0031699
449 Ga0501069_0031111
450 Ga0501071_0075233
451 Ga0501071_0170529
452 Ga0501071_0298584
453 Ga0501072_0049068
454 Ga0501072_0066106
455 Ga0501072_0149113
456 Ga0501072_0232641
457 Ga0501074_0397600
458 Ga0501074_0526656
459 Ga0501074_0551418
460 Ga0501075_0015042
461 Ga0501075_0027482
462 Ga0501075_0039324
463 Ga0501075_0496333
464 Ga0501076_0005008
465 Ga0501076_0017295
466 Ga0501076_0082287
467 Ga0501076_0097158
468 Ga0501076_0505440
469 Ga0501077_0006606
470 Ga0501077_0397880
471 Ga0501079_0033378
472 Ga0501079_0039834
473 Ga0501079_0448221
474 Ga0501080_0036329
475 Ga0501081_0013581
476 Ga0501081_0038179
477 Ga0501081_0049932
478 Ga0501081_0090744
479 Ga0501081_0151365
480 Ga0501081_0321028
481 Ga0501083_0105012
482 Ga0501045_0040037
483 Ga0501045_0041383
484 nmdc:mga05p37_119041_c1
485 nmdc:mga05p37_132217_c1
486 nmdc:mga05p37_1607_c1
487 nmdc:mga05p37_166387_c1
488 nmdc:mga05p37_232597_c1
489 nmdc:mga05p37_30899_c1
490 nmdc:mga05p37_32275_c1
491 nmdc:mga05p37_327880_c1
492 nmdc:mga05p37_349056_c1
493 nmdc:mga05p37_445602_c1
494 nmdc:mga05p37_524173_c1
495 nmdc:mga05p37_52601_c1
496 nmdc:mga05p37_98468_c1
497 nmdc:mga09592_12522_c1
498 nmdc:mga09592_144396_c1
499 nmdc:mga09592_1882_c1
500 nmdc:mga09592_20995_c1
501 nmdc:mga09592_43104_c1
502 nmdc:mga09592_49731_c1
503 nmdc:mga09592_53812_c1
504 nmdc:mga09592_678820_c1
505 nmdc:mga0qj67_100994_c1
506 nmdc:mga0qj67_10850_c1
507 nmdc:mga0qj67_1117_c1
508 nmdc:mga0qj67_317_c1
509 nmdc:mga0qj67_6158_c1
510 nmdc:mga06r32_11660_c1
511 nmdc:mga06r32_118103_c1
512 nmdc:mga06r32_1845_c1
513 nmdc:mga06r32_203999_c1
514 nmdc:mga06r32_482696_c1
515 nmdc:mga06r32_537583_c1
516 nmdc:mga06r32_6272_c1
517 nmdc:mga06r32_716111_c1
518 nmdc:mga08y16_248605_c1
519 nmdc:mga08y16_58908_c1
520 nmdc:mga08y16_7382_c1
521 nmdc:mga0n895_10508_c1
522 nmdc:mga0n895_118110_c1
523 nmdc:mga0n895_132138_c1
524 nmdc:mga0n895_173213_c1
525 nmdc:mga0n895_206_c1
526 nmdc:mga0n895_258967_c1
527 nmdc:mga0n895_5815_c1
528 nmdc:mga0rr50_18832_c1
529 nmdc:mga0rr50_246044_c1
530 nmdc:mga0rr50_4482_c1
531 nmdc:mga0rr50_74570_c1
532 nmdc:mga0rr50_7883_c1
533 nmdc:mga08x19_94090_c1
534 nmdc:mga0a205_117564_c1
535 nmdc:mga0a205_21723_c1
536 nmdc:mga0a205_22556_c1
537 nmdc:mga0a205_44612_c1
538 nmdc:mga0a205_462745_c1
539 nmdc:mga0a205_75880_c1
540 Ga0501084_0000835
541 Ga0501084_0010599
542 Ga0501084_0028168
543 Ga0501084_0030516
544 Ga0501084_0214196
545 Ga0501082_0004733
546 Ga0501082_0025162
547 Ga0501082_0070532
548 Ga0501082_0088362
549 Ga0501082_0385972
550 Ga0530510_0001325
551 Ga0530510_0006118
552 Ga0530510_0021025
553 Ga0530510_0038768
554 Ga0530510_0084294
555 Ga0530510_0128128
556 Ga0530510_0319687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

4

255

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9783 11 261
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9687 10 261
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9669 11 261
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9643 10 264
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9595 11 264
ID Description Score Start End Superfamily
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9699 11 261 3.20.20.140
1j6oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9676 11 261 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9622 11 261 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9595 11 264 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9565 10 264 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V6XIK1-F1-model_v4 Hydrolase TatD 0.9974 96 263 GO:0005829
GO:0016788
AF-A0A3N5I4J7-F1-model_v4 TatD family deoxyribonuclease 0.9932 7 235 GO:0004536
GO:0005829
GO:0046872
AF-A0A538RE81-F1-model_v4 TatD family deoxyribonuclease 0.9926 9 264 GO:0004536
GO:0005829
GO:0046872
AF-A0A2V6RIN6-F1-model_v4 Hydrolase TatD 0.9919 11 260 GO:0004536
GO:0005829
AF-A0A2V6XIK1-F1-model_v4 Hydrolase TatD 0.9915 96 263 GO:0005829
GO:0016788

Map