F382630

General Info

Members Datasets Scaffolds Average Seq Length
278 185 556 177

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0012686|Ga0496119_0012686_217_822
Length 201
Sequence MAPDEHQWYFGVLDGGCMAILKIARMGHPVLLQRCATVEDPGSPEIRRLVADMMETMEDAPGVGLAAPQVHVPLRLFVFRVPGERAVTEPDDVPVANSVLINPTLELLGEERVLGWEGCLSIPGLRAAIPRAPRVRYRGVDCDGNVVEREVSGFHARVVQHEYDHLDGILYTMRLTDFGLFGFNEELNRVAAAQQASEDGR

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
184 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
185 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 3.6
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0012686 3300048922 Bacteria 6816
2 Ga0070658_10393430 3300005327 Bacteria 1190
3 Ga0070674_100006050 3300005356 Bacteria 7037
4 Ga0070688_100263300 3300005365 Bacteria 1232
5 Ga0070713_100739126 3300005436 Bacteria 941
6 Ga0070713_101060049 3300005436 Bacteria 783
7 Ga0070710_10105094 3300005437 Bacteria 1688
8 Ga0070711_100949115 3300005439 Bacteria 736
9 Ga0070705_100109925 3300005440 Bacteria 1759
10 Ga0070700_101486893 3300005441 Bacteria 575
11 Ga0070694_100894834 3300005444 Unclassified 732
12 Ga0070708_100002842 3300005445 Bacteria 13447
13 Ga0070708_100779943 3300005445 Bacteria 899
14 Ga0070678_100058467 3300005456 Bacteria 2830
15 Ga0070685_10095059 3300005466 Bacteria 1811
16 Ga0070706_100001699 3300005467 Bacteria 22913
17 Ga0070707_100001721 3300005468 Bacteria 21114
18 Ga0070698_100001084 3300005471 Bacteria 29926
19 Ga0070698_100078878 3300005471 Bacteria 3291
20 Ga0070698_100133830 3300005471 Bacteria 2433
21 Ga0070699_100027827 3300005518 Bacteria 4876
22 Ga0070699_100392480 3300005518 Bacteria 1254
23 Ga0070679_100126789 3300005530 Bacteria 2535
24 Ga0070684_101244039 3300005535 Bacteria 700
25 Ga0070697_100167848 3300005536 Bacteria 1856
26 Ga0070695_100130276 3300005545 Bacteria 1733
27 Ga0070696_100024463 3300005546 Bacteria 4105
28 Ga0070704_100334090 3300005549 Bacteria 1274
29 Ga0070704_100844644 3300005549 Bacteria 821
30 Ga0070664_101495744 3300005564 Bacteria 639
31 Ga0068856_100036435 3300005614 Bacteria 4823
32 Ga0068856_100173774 3300005614 Bacteria 2167
33 Ga0068856_100320631 3300005614 Bacteria 1567
34 Ga0068856_100383885 3300005614 Bacteria 1424
35 Ga0070702_100966566 3300005615 Unclassified 672
36 Ga0068852_100508763 3300005616 Bacteria 1200
37 Ga0068866_10058425 3300005718 Bacteria 1992
38 Ga0081455_10212239 3300005937 Bacteria 1441
39 Ga0081455_10296177 3300005937 Bacteria 1163
40 Ga0081539_10064931 3300005985 Bacteria 1984
41 Ga0070717_10085018 3300006028 Bacteria 2662
42 Ga0070717_10307424 3300006028 Bacteria 1410
43 Ga0070716_100290459 3300006173 Bacteria 1132
44 Ga0070712_100009771 3300006175 Bacteria 6046
45 Ga0070712_100306928 3300006175 Bacteria 1286
46 Ga0075369_10048352 3300006186 Bacteria 1835
47 Ga0075428_100052933 3300006844 Bacteria 4448
48 Ga0075428_100156288 3300006844 Bacteria 2477
49 Ga0075431_100433731 3300006847 Bacteria 1312
50 Ga0075429_100188224 3300006880 Bacteria 1809
51 Ga0068865_100173348 3300006881 Bacteria 1655
52 Ga0105240_10866654 3300009093 Bacteria 974
53 Ga0111539_10355800 3300009094 Bacteria 1704
54 Ga0105245_10456546 3300009098 Bacteria 1287
55 Ga0114129_10000651 3300009147 Bacteria 43431
56 Ga0114129_10143183 3300009147 Bacteria 3276
57 Ga0114129_10241695 3300009147 Bacteria 2427
58 Ga0114129_10273458 3300009147 Bacteria 2259
59 Ga0114129_11485332 3300009147 Bacteria 833
60 Ga0105243_10004841 3300009148 Bacteria 10575
61 Ga0105242_10002756 3300009176 Bacteria 13755
62 Ga0105248_10096973 3300009177 Bacteria 3322
63 Ga0105239_10861234 3300010375 Bacteria 1039
64 Ga0157369_10223827 3300013105 Bacteria 1969
65 Ga0157378_10371603 3300013297 Bacteria 1402
66 Ga0163162_10149482 3300013306 Bacteria 2453
67 Ga0157375_11223416 3300013308 Bacteria 881
68 Ga0157375_11473825 3300013308 Bacteria 803
69 Ga0163163_10118525 3300014325 Bacteria 2680
70 Ga0163163_11033635 3300014325 Bacteria 885
71 Ga0182008_10004538 3300014497 Bacteria 8102
72 Ga0157379_10678403 3300014968 Bacteria 966
73 Ga0157376_10202001 3300014969 Bacteria 1829
74 Ga0213874_10061055 3300021377 Bacteria 1180
75 Ga0213875_10003592 3300021388 Bacteria 8785
76 Ga0213875_10014581 3300021388 Bacteria 3832
77 Ga0213875_10110527 3300021388 Bacteria 1283
78 Ga0213871_10016263 3300021441 Bacteria 1790
79 Ga0207653_10000138 3300025885 Bacteria 52395
80 Ga0207642_10050310 3300025899 Bacteria 1879
81 Ga0207645_10195684 3300025907 Bacteria 1329
82 Ga0207684_10000761 3300025910 Bacteria 37560
83 Ga0207707_10932264 3300025912 Bacteria 716
84 Ga0207693_10005420 3300025915 Bacteria 10651
85 Ga0207693_10104840 3300025915 Bacteria 2217
86 Ga0207663_10019801 3300025916 Bacteria 3799
87 Ga0207663_10174463 3300025916 Bacteria 1530
88 Ga0207652_10424436 3300025921 Bacteria 1199
89 Ga0207646_10006389 3300025922 Bacteria 12186
90 Ga0207646_10159024 3300025922 Bacteria 2038
91 Ga0207687_10407824 3300025927 Bacteria 1119
92 Ga0207700_10058896 3300025928 Bacteria 2903
93 Ga0207700_10293160 3300025928 Bacteria 1403
94 Ga0207700_10541379 3300025928 Bacteria 1033
95 Ga0207700_11288850 3300025928 Bacteria 651
96 Ga0207664_10010059 3300025929 Bacteria 6666
97 Ga0207709_10087668 3300025935 Bacteria 2024
98 Ga0207669_10009215 3300025937 Bacteria 4687
99 Ga0207665_10334997 3300025939 Bacteria 1139
100 Ga0207651_11144497 3300025960 Bacteria 698
101 Ga0207658_11525147 3300025986 Bacteria 611
102 Ga0207703_10221307 3300026035 Bacteria 1693
103 Ga0207702_10163691 3300026078 Bacteria 2033
104 Ga0207702_10620708 3300026078 Bacteria 1062
105 Ga0207676_10303046 3300026095 Bacteria 1460
106 Ga0207675_100382229 3300026118 Bacteria 1385
107 Ga0207683_10152095 3300026121 Bacteria 2089
108 Ga0265338_10197556 3300028800 Bacteria 1519
109 Ga0307409_101525095 3300031995 Bacteria 696
110 Ga0373923_0005311 3300035111 Bacteria 4369
111 Ga0373953_0054983 3300035117 Bacteria 1615
112 Ga0373953_0104009 3300035117 Bacteria 1197
113 Ga0373956_0029240 3300035119 Bacteria 2402
114 Ga0373956_0282497 3300035119 Bacteria 790
115 Ga0373943_0042738 3300035170 Bacteria 2198
116 Ga0373955_0028709 3300035172 Bacteria 2887
117 Ga0373924_0046918 3300035410 Bacteria 1781
118 Ga0373924_0249702 3300035410 Bacteria 785
119 Ga0373927_0102935 3300035695 Bacteria 1858
120 Ga0373933_0028022 3300035724 Bacteria 3247
121 Ga0373933_0045362 3300035724 Bacteria 2606
122 Ga0373947_0012788 3300035725 Bacteria 4810
123 Ga0373947_0592973 3300035725 Bacteria 755
124 Ga0373937_0023498 3300036401 Bacteria 5551
125 Ga0373937_0049632 3300036401 Bacteria 3842
126 Ga0373937_0100563 3300036401 Bacteria 2683
127 Ga0373937_0373590 3300036401 Bacteria 1352
128 Ga0373937_0437223 3300036401 Bacteria 1242
129 Ga0373937_0553526 3300036401 Bacteria 1093
130 Ga0373925_0011514 3300037068 Bacteria 6400
131 Ga0373925_0025362 3300037068 Bacteria 4331
132 Ga0373925_0346080 3300037068 Bacteria 1206
133 Ga0395899_0117752 3300037312 Bacteria 1905
134 Ga0395900_0087235 3300037418 Bacteria 3207
135 Ga0395900_0247937 3300037418 Bacteria 1783
136 Ga0395898_0134728 3300037466 Bacteria 2365
137 Ga0395898_0190914 3300037466 Bacteria 1957
138 Ga0395898_1126654 3300037466 Bacteria 717
139 Ga0395898_1333776 3300037466 Bacteria 646
140 Ga0395905_0027050 3300037471 Bacteria 5409
141 Ga0395905_0052016 3300037471 Bacteria 3836
142 Ga0395905_0083882 3300037471 Bacteria 2985
143 Ga0395905_0845572 3300037471 Bacteria 818
144 Ga0436364_0020762 3300037853 Bacteria 874
145 Ga0436364_0171560 3300037853 Bacteria 1346
146 Ga0436364_0230488 3300037853 Bacteria 11773
147 Ga0436364_0246126 3300037853 Bacteria 2756
148 Ga0436364_0553632 3300037853 Bacteria 19657
149 Ga0436364_0715555 3300037853 Bacteria 818
150 Ga0436364_0822870 3300037853 Bacteria 3033
151 Ga0436364_0826024 3300037853 Bacteria 856
152 Ga0436364_1437492 3300037853 Bacteria 11636
153 Ga0436364_1457317 3300037853 Bacteria 5209
154 Ga0395901_0006273 3300038443 Bacteria 12047
155 Ga0395901_0073150 3300038443 Bacteria 3574
156 Ga0395901_0190748 3300038443 Bacteria 2149
157 Ga0436365_1315270 3300039437 Bacteria 5088
158 Ga0436365_1711461 3300039437 Bacteria 1167
159 Ga0436360_0181322 3300039438 Bacteria 4888
160 Ga0436360_0839671 3300039438 Bacteria 4042
161 Ga0436360_1186590 3300039438 Bacteria 1177
162 Ga0436360_1373027 3300039438 Bacteria 6852
163 Ga0436361_0889778 3300039447 Bacteria 1144
164 Ga0436363_0367588 3300039450 Bacteria 2933
165 Ga0436363_0871525 3300039450 Bacteria 3082
166 Ga0436362_0187737 3300039453 Bacteria 783
167 Ga0436362_1166074 3300039453 Bacteria 2758
168 Ga0495592_0080246 3300046454 Bacteria 2361
169 Ga0495603_0018147 3300046455 Bacteria 4256
170 Ga0495629_0227810 3300046459 Bacteria 1285
171 Ga0495629_0372299 3300046459 Bacteria 973
172 Ga0495651_0022890 3300046462 Bacteria 4859
173 Ga0495653_0105849 3300046463 Bacteria 2030
174 Ga0495580_0427849 3300046472 Bacteria 890
175 Ga0495582_0188710 3300046473 Bacteria 1176
176 Ga0495662_0122005 3300046476 Bacteria 1280
177 Ga0495594_0421657 3300046499 Bacteria 759
178 Ga0495596_0180318 3300046500 Bacteria 821
179 Ga0495608_0038369 3300046511 Bacteria 3217
180 Ga0495608_0200869 3300046511 Bacteria 1256
181 Ga0495608_0738875 3300046511 Bacteria 584
182 Ga0495618_0052551 3300046514 Bacteria 2576
183 Ga0495628_0075066 3300046516 Bacteria 2633
184 Ga0495628_0186420 3300046516 Bacteria 1568
185 Ga0495630_0127974 3300046517 Bacteria 1928
186 Ga0495652_0511133 3300046529 Bacteria 831
187 Ga0495640_0078710 3300046533 Bacteria 2196
188 Ga0495609_0048722 3300046538 Bacteria 1893
189 Ga0495645_0181080 3300046543 Bacteria 1444
190 Ga0495656_0246410 3300046615 Bacteria 901
191 Ga0495588_0253219 3300046674 Bacteria 928
192 Ga0495657_0258738 3300046675 Bacteria 1046
193 Ga0495599_0012670 3300046678 Bacteria 5201
194 Ga0495623_0057954 3300046679 Bacteria 2436
195 Ga0495623_0365109 3300046679 Bacteria 784
196 Ga0495600_0041697 3300046809 Bacteria 2992
197 Ga0495604_0006770 3300047317 Bacteria 9093
198 Ga0495677_0198040 3300047445 Bacteria 781
199 Ga0495684_0195030 3300047471 Bacteria 1495
200 Ga0495602_0960263 3300048088 Bacteria 566
201 Ga0496100_0101315 3300048903 Bacteria 1985
202 Ga0496101_0115426 3300048904 Bacteria 2025
203 Ga0496104_0765974 3300048907 Bacteria 872
204 Ga0496106_0002332 3300048909 Bacteria 14155
205 Ga0496107_0077924 3300048910 Bacteria 2414
206 Ga0496108_0875086 3300048911 Bacteria 772
207 Ga0496111_0341756 3300048914 Bacteria 1108
208 Ga0496112_0163095 3300048915 Bacteria 2195
209 Ga0496112_0597943 3300048915 Bacteria 1035
210 Ga0496114_0418453 3300048917 Bacteria 1187
211 Ga0501032_0029460 3300049569 Bacteria 3766
212 Ga0501033_0009221 3300049570 Bacteria 7598
213 Ga0501034_0006387 3300049571 Bacteria 12696
214 Ga0501036_0011915 3300049572 Bacteria 7207
215 Ga0501036_0914558 3300049572 Bacteria 720
216 Ga0501037_0035404 3300049573 Bacteria 3682
217 Ga0501037_0037600 3300049573 Bacteria 3568
218 Ga0501038_0005897 3300049574 Bacteria 11323
219 Ga0501039_0016155 3300049575 Bacteria 5718
220 Ga0501040_0094274 3300049576 Bacteria 2082
221 Ga0501040_0127870 3300049576 Bacteria 1785
222 Ga0501041_0018704 3300049577 Bacteria 4126
223 Ga0501042_0010505 3300049578 Bacteria 6211
224 Ga0501042_0719454 3300049578 Bacteria 726
225 Ga0501043_0011560 3300049579 Bacteria 6909
226 Ga0501046_0022880 3300049580 Bacteria 5146
227 Ga0501047_0216504 3300049581 Bacteria 1772
228 Ga0501048_0059630 3300049582 Bacteria 2704
229 Ga0501068_0004295 3300049584 Bacteria 7740
230 Ga0501069_0071186 3300049585 Bacteria 1948
231 Ga0501070_0011735 3300049586 Bacteria 7400
232 Ga0501071_0029250 3300049587 Bacteria 3887
233 Ga0501072_0027145 3300049588 Bacteria 4467
234 Ga0501072_0563442 3300049588 Bacteria 899
235 Ga0501073_0003005 3300049589 Bacteria 12638
236 Ga0501073_0227464 3300049589 Bacteria 1288
237 Ga0501074_0041230 3300049590 Bacteria 3342
238 Ga0501074_0202173 3300049590 Bacteria 1416
239 Ga0501075_0055182 3300049591 Bacteria 2989
240 Ga0501075_0303581 3300049591 Bacteria 1216
241 Ga0501076_0042384 3300049592 Bacteria 3582
242 Ga0501076_0292377 3300049592 Bacteria 1335
243 Ga0501077_0071037 3300049593 Bacteria 2206
244 Ga0501077_0097353 3300049593 Bacteria 1864
245 Ga0501079_0098627 3300049741 Bacteria 2264
246 Ga0501079_0239609 3300049741 Bacteria 1417
247 Ga0501080_0172304 3300049742 Bacteria 1995
248 Ga0501081_0084642 3300049743 Bacteria 2224
249 Ga0501081_0191054 3300049743 Bacteria 1483
250 Ga0501083_0013616 3300049744 Bacteria 5685
251 Ga0501035_0020462 3300049822 Bacteria 6076
252 Ga0501035_0274126 3300049822 Bacteria 1427
253 Ga0501044_0008056 3300049823 Bacteria 11572
254 Ga0501044_0189471 3300049823 Bacteria 2020
255 Ga0501044_0606072 3300049823 Bacteria 988
256 Ga0501044_0995583 3300049823 Bacteria 710
257 Ga0501045_0091273 3300049824 Bacteria 2251
258 Ga0501045_0276370 3300049824 Bacteria 1250
259 nmdc:mga0yw44_810855_c1 3300050492 Bacteria 635
260 nmdc:mga05p37_177052_c1 3300050507 Bacteria 2598
261 nmdc:mga05p37_18317_c1 3300050507 Bacteria 8457
262 nmdc:mga05p37_282628_c1 3300050507 Bacteria 1978
263 nmdc:mga08y16_177533_c1 3300050511 Bacteria 2212
264 nmdc:mga0sz30_25744_c2 3300050516 Bacteria 2092
265 Ga0495601_0061756 3300053077 Bacteria 2379
266 Ga0495595_0029527 3300053084 Bacteria 2454
267 Ga0495619_0082855 3300053085 Bacteria 2162
268 Ga0495619_0212229 3300053085 Bacteria 1341
269 Ga0501084_0017126 3300054114 Bacteria 6020
270 Ga0501084_0306161 3300054114 Bacteria 1342
271 Ga0590075_045290 3300059424 Bacteria 1127
272 Ga0501082_0176704 3300060353 Bacteria 1856
273 Ga0530510_0082658 3300061734 Bacteria 2338
274 Ga0530510_0342658 3300061734 Bacteria 1122
275 Ga0530510_0366888 3300061734 Bacteria 1083
276 2883578478 2883577096 Bacteria 4709178
277 2929204168 2929199973 Bacteria 7260745
278 8055911304 8055909800 Bacteria 7278581
279 Ga0496119_0012686
280 Ga0070658_10393430
281 Ga0070674_100006050
282 Ga0070688_100263300
283 Ga0070713_100739126
284 Ga0070713_101060049
285 Ga0070710_10105094
286 Ga0070711_100949115
287 Ga0070705_100109925
288 Ga0070700_101486893
289 Ga0070694_100894834
290 Ga0070708_100002842
291 Ga0070708_100779943
292 Ga0070678_100058467
293 Ga0070685_10095059
294 Ga0070706_100001699
295 Ga0070707_100001721
296 Ga0070698_100001084
297 Ga0070698_100078878
298 Ga0070698_100133830
299 Ga0070699_100027827
300 Ga0070699_100392480
301 Ga0070679_100126789
302 Ga0070684_101244039
303 Ga0070697_100167848
304 Ga0070695_100130276
305 Ga0070696_100024463
306 Ga0070704_100334090
307 Ga0070704_100844644
308 Ga0070664_101495744
309 Ga0068856_100036435
310 Ga0068856_100173774
311 Ga0068856_100320631
312 Ga0068856_100383885
313 Ga0070702_100966566
314 Ga0068852_100508763
315 Ga0068866_10058425
316 Ga0081455_10212239
317 Ga0081455_10296177
318 Ga0081539_10064931
319 Ga0070717_10085018
320 Ga0070717_10307424
321 Ga0070716_100290459
322 Ga0070712_100009771
323 Ga0070712_100306928
324 Ga0075369_10048352
325 Ga0075428_100052933
326 Ga0075428_100156288
327 Ga0075431_100433731
328 Ga0075429_100188224
329 Ga0068865_100173348
330 Ga0105240_10866654
331 Ga0111539_10355800
332 Ga0105245_10456546
333 Ga0114129_10000651
334 Ga0114129_10143183
335 Ga0114129_10241695
336 Ga0114129_10273458
337 Ga0114129_11485332
338 Ga0105243_10004841
339 Ga0105242_10002756
340 Ga0105248_10096973
341 Ga0105239_10861234
342 Ga0157369_10223827
343 Ga0157378_10371603
344 Ga0163162_10149482
345 Ga0157375_11223416
346 Ga0157375_11473825
347 Ga0163163_10118525
348 Ga0163163_11033635
349 Ga0182008_10004538
350 Ga0157379_10678403
351 Ga0157376_10202001
352 Ga0213874_10061055
353 Ga0213875_10003592
354 Ga0213875_10014581
355 Ga0213875_10110527
356 Ga0213871_10016263
357 Ga0207653_10000138
358 Ga0207642_10050310
359 Ga0207645_10195684
360 Ga0207684_10000761
361 Ga0207707_10932264
362 Ga0207693_10005420
363 Ga0207693_10104840
364 Ga0207663_10019801
365 Ga0207663_10174463
366 Ga0207652_10424436
367 Ga0207646_10006389
368 Ga0207646_10159024
369 Ga0207687_10407824
370 Ga0207700_10058896
371 Ga0207700_10293160
372 Ga0207700_10541379
373 Ga0207700_11288850
374 Ga0207664_10010059
375 Ga0207709_10087668
376 Ga0207669_10009215
377 Ga0207665_10334997
378 Ga0207651_11144497
379 Ga0207658_11525147
380 Ga0207703_10221307
381 Ga0207702_10163691
382 Ga0207702_10620708
383 Ga0207676_10303046
384 Ga0207675_100382229
385 Ga0207683_10152095
386 Ga0265338_10197556
387 Ga0307409_101525095
388 Ga0373923_0005311
389 Ga0373953_0054983
390 Ga0373953_0104009
391 Ga0373956_0029240
392 Ga0373956_0282497
393 Ga0373943_0042738
394 Ga0373955_0028709
395 Ga0373924_0046918
396 Ga0373924_0249702
397 Ga0373927_0102935
398 Ga0373933_0028022
399 Ga0373933_0045362
400 Ga0373947_0012788
401 Ga0373947_0592973
402 Ga0373937_0023498
403 Ga0373937_0049632
404 Ga0373937_0100563
405 Ga0373937_0373590
406 Ga0373937_0437223
407 Ga0373937_0553526
408 Ga0373925_0011514
409 Ga0373925_0025362
410 Ga0373925_0346080
411 Ga0395899_0117752
412 Ga0395900_0087235
413 Ga0395900_0247937
414 Ga0395898_0134728
415 Ga0395898_0190914
416 Ga0395898_1126654
417 Ga0395898_1333776
418 Ga0395905_0027050
419 Ga0395905_0052016
420 Ga0395905_0083882
421 Ga0395905_0845572
422 Ga0436364_0020762
423 Ga0436364_0171560
424 Ga0436364_0230488
425 Ga0436364_0246126
426 Ga0436364_0553632
427 Ga0436364_0715555
428 Ga0436364_0822870
429 Ga0436364_0826024
430 Ga0436364_1437492
431 Ga0436364_1457317
432 Ga0395901_0006273
433 Ga0395901_0073150
434 Ga0395901_0190748
435 Ga0436365_1315270
436 Ga0436365_1711461
437 Ga0436360_0181322
438 Ga0436360_0839671
439 Ga0436360_1186590
440 Ga0436360_1373027
441 Ga0436361_0889778
442 Ga0436363_0367588
443 Ga0436363_0871525
444 Ga0436362_0187737
445 Ga0436362_1166074
446 Ga0495592_0080246
447 Ga0495603_0018147
448 Ga0495629_0227810
449 Ga0495629_0372299
450 Ga0495651_0022890
451 Ga0495653_0105849
452 Ga0495580_0427849
453 Ga0495582_0188710
454 Ga0495662_0122005
455 Ga0495594_0421657
456 Ga0495596_0180318
457 Ga0495608_0038369
458 Ga0495608_0200869
459 Ga0495608_0738875
460 Ga0495618_0052551
461 Ga0495628_0075066
462 Ga0495628_0186420
463 Ga0495630_0127974
464 Ga0495652_0511133
465 Ga0495640_0078710
466 Ga0495609_0048722
467 Ga0495645_0181080
468 Ga0495656_0246410
469 Ga0495588_0253219
470 Ga0495657_0258738
471 Ga0495599_0012670
472 Ga0495623_0057954
473 Ga0495623_0365109
474 Ga0495600_0041697
475 Ga0495604_0006770
476 Ga0495677_0198040
477 Ga0495684_0195030
478 Ga0495602_0960263
479 Ga0496100_0101315
480 Ga0496101_0115426
481 Ga0496104_0765974
482 Ga0496106_0002332
483 Ga0496107_0077924
484 Ga0496108_0875086
485 Ga0496111_0341756
486 Ga0496112_0163095
487 Ga0496112_0597943
488 Ga0496114_0418453
489 Ga0501032_0029460
490 Ga0501033_0009221
491 Ga0501034_0006387
492 Ga0501036_0011915
493 Ga0501036_0914558
494 Ga0501037_0035404
495 Ga0501037_0037600
496 Ga0501038_0005897
497 Ga0501039_0016155
498 Ga0501040_0094274
499 Ga0501040_0127870
500 Ga0501041_0018704
501 Ga0501042_0010505
502 Ga0501042_0719454
503 Ga0501043_0011560
504 Ga0501046_0022880
505 Ga0501047_0216504
506 Ga0501048_0059630
507 Ga0501068_0004295
508 Ga0501069_0071186
509 Ga0501070_0011735
510 Ga0501071_0029250
511 Ga0501072_0027145
512 Ga0501072_0563442
513 Ga0501073_0003005
514 Ga0501073_0227464
515 Ga0501074_0041230
516 Ga0501074_0202173
517 Ga0501075_0055182
518 Ga0501075_0303581
519 Ga0501076_0042384
520 Ga0501076_0292377
521 Ga0501077_0071037
522 Ga0501077_0097353
523 Ga0501079_0098627
524 Ga0501079_0239609
525 Ga0501080_0172304
526 Ga0501081_0084642
527 Ga0501081_0191054
528 Ga0501083_0013616
529 Ga0501035_0020462
530 Ga0501035_0274126
531 Ga0501044_0008056
532 Ga0501044_0189471
533 Ga0501044_0606072
534 Ga0501044_0995583
535 Ga0501045_0091273
536 Ga0501045_0276370
537 nmdc:mga0yw44_810855_c1
538 nmdc:mga05p37_177052_c1
539 nmdc:mga05p37_18317_c1
540 nmdc:mga05p37_282628_c1
541 nmdc:mga08y16_177533_c1
542 nmdc:mga0sz30_25744_c2
543 Ga0495601_0061756
544 Ga0495595_0029527
545 Ga0495619_0082855
546 Ga0495619_0212229
547 Ga0501084_0017126
548 Ga0501084_0306161
549 Ga0590075_045290
550 Ga0501082_0176704
551 Ga0530510_0082658
552 Ga0530510_0342658
553 Ga0530510_0366888
554 2883578478
555 2929204168
556 8055911304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

20

179

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vcp-assembly2.cif.gz_D crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9722 2 170
5vcp-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9722 3 170
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.9705 2 168
5vcp-assembly1.cif.gz_C crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9704 3 170
5cwx-assembly1.cif.gz_A structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv oryzae, in complex with fragment 134 0.9703 2 169
ID Description Score Start End Superfamily
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9723 3 170 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9672 1 160 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9608 1 160 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9543 3 170 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9445 4 153 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A3C0FJ56-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9823 10 141 GO:0042586
GO:0043686
AF-A0A285TW63-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9813 1 172 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-K2M3J6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9797 1 172 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A6J4J603-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9795 1 176 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2E3QCD6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9794 1 172 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map