F382621

General Info

Members Datasets Scaffolds Average Seq Length
278 131 556 161

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0212730|Ga0496106_0212730_548_1069
Length 173
Sequence LTAVTDSNKATVTLPTDEQILITREFDAPRHLVFEAFTTPELVRRWWHAKRGEMTVAEIDLRPGGAWRYVMVTGDGTEVGFHGEYREVVPNERVVSTETYEGLPEGVTEEQGTTVNTATFAESNGRTTLTLLVQAPSKETRDAIIASGMEDGLQDALVLLEQVAQSLRQEALT

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
72 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 1.8
Rhizosphere 89.57
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0212730 3300048909 Bacteria 1540
2 JGI25407J50210_10014224 3300003373 Bacteria 2051
3 JGI25407J50210_10026007 3300003373 Bacteria 1518
4 JGI25407J50210_10040105 3300003373 Bacteria 1200
5 Ga0070666_11217610 3300005335 Bacteria 561
6 Ga0070668_100936146 3300005347 Bacteria 776
7 Ga0070659_100000003 3300005366 Bacteria 309142
8 Ga0070659_100540451 3300005366 Bacteria 997
9 Ga0070711_100139873 3300005439 Bacteria 1814
10 Ga0070704_101000370 3300005549 Unclassified 756
11 Ga0068870_10213925 3300005840 Bacteria 1176
12 Ga0081455_10006277 3300005937 Bacteria 12781
13 Ga0081455_10017821 3300005937 Bacteria 6790
14 Ga0081455_10019644 3300005937 Bacteria 6382
15 Ga0081455_10067204 3300005937 Bacteria 2988
16 Ga0081538_10000073 3300005981 Bacteria 94991
17 Ga0081538_10000902 3300005981 Bacteria 32102
18 Ga0081538_10004952 3300005981 Bacteria 12138
19 Ga0081538_10036831 3300005981 Bacteria 3184
20 Ga0081539_10067115 3300005985 Bacteria 1941
21 Ga0070717_10958262 3300006028 Bacteria 779
22 Ga0075365_10028574 3300006038 Bacteria 3557
23 Ga0075365_10106444 3300006038 Bacteria 1925
24 Ga0075363_100169476 3300006048 Bacteria 1239
25 Ga0075364_10030389 3300006051 Bacteria 3467
26 Ga0075432_10013109 3300006058 Bacteria 2817
27 Ga0075362_10048052 3300006177 Bacteria 1903
28 Ga0075428_100112070 3300006844 Bacteria 2971
29 Ga0075428_100641040 3300006844 Bacteria 1133
30 Ga0075430_100047069 3300006846 Bacteria 3641
31 Ga0075431_100174757 3300006847 Bacteria 2206
32 Ga0075433_10005757 3300006852 Bacteria 9751
33 Ga0075434_100004879 3300006871 Bacteria 12150
34 Ga0075429_100029581 3300006880 Bacteria 4757
35 Ga0075436_100079331 3300006914 Bacteria 2274
36 Ga0075435_100010937 3300007076 Bacteria 6649
37 Ga0111539_10053097 3300009094 Bacteria 4824
38 Ga0111539_10191970 3300009094 Bacteria 2383
39 Ga0114129_10084319 3300009147 Bacteria 4412
40 Ga0114129_10595265 3300009147 Bacteria 1433
41 Ga0114129_10768071 3300009147 Bacteria 1232
42 Ga0114129_10776245 3300009147 Bacteria 1225
43 Ga0114129_11267385 3300009147 Bacteria 915
44 Ga0105243_10169087 3300009148 Bacteria 1892
45 Ga0105241_10942733 3300009174 Bacteria 804
46 Ga0105242_10160481 3300009176 Bacteria 1967
47 Ga0157380_10246709 3300014326 Bacteria 1614
48 Ga0157376_10017908 3300014969 Bacteria 5417
49 Ga0213874_10082122 3300021377 Bacteria 1046
50 Ga0213876_10004167 3300021384 Bacteria 8111
51 Ga0213875_10001409 3300021388 Bacteria 15649
52 Ga0207699_10445288 3300025906 Bacteria 928
53 Ga0207693_10556921 3300025915 Bacteria 894
54 Ga0207657_10109176 3300025919 Bacteria 2287
55 Ga0207646_10722325 3300025922 Bacteria 890
56 Ga0207700_10521508 3300025928 Bacteria 1053
57 Ga0207690_10000021 3300025932 Bacteria 217710
58 Ga0207686_10055030 3300025934 Bacteria 2494
59 Ga0207709_11408641 3300025935 Bacteria 577
60 Ga0207704_10695136 3300025938 Bacteria 841
61 Ga0207683_10031993 3300026121 Bacteria 4568
62 Ga0207428_10013175 3300027907 Bacteria 7239
63 Ga0268266_10401445 3300028379 Bacteria 1296
64 Ga0316182_1115800 3300030745 Bacteria 557
65 Ga0307405_10038900 3300031731 Bacteria 2871
66 Ga0307405_10368683 3300031731 Bacteria 1114
67 Ga0307410_10193576 3300031852 Bacteria 1548
68 Ga0307406_10015882 3300031901 Bacteria 4366
69 Ga0307406_11613034 3300031901 Bacteria 573
70 Ga0307407_10075800 3300031903 Bacteria 2018
71 Ga0307409_100492119 3300031995 Bacteria 1192
72 Ga0307409_100679620 3300031995 Bacteria 1027
73 Ga0307409_100701541 3300031995 Bacteria 1011
74 Ga0307416_100030108 3300032002 Bacteria 4069
75 Ga0307416_100180227 3300032002 Bacteria 1979
76 Ga0307414_10170193 3300032004 Bacteria 1741
77 Ga0307411_10374292 3300032005 Bacteria 1169
78 Ga0307415_100000180 3300032126 Bacteria 28325
79 Ga0307415_100994582 3300032126 Bacteria 779
80 Ga0373926_0187351 3300035083 Bacteria 794
81 Ga0373943_0013250 3300035170 Bacteria 3722
82 Ga0373935_0379549 3300035692 Bacteria 1012
83 Ga0373947_0001154 3300035725 Bacteria 16203
84 Ga0395899_0002792 3300037312 Bacteria 14071
85 Ga0395899_0066962 3300037312 Bacteria 2636
86 Ga0395899_0074309 3300037312 Bacteria 2483
87 Ga0395899_0153625 3300037312 Bacteria 1630
88 Ga0395899_0372421 3300037312 Bacteria 951
89 Ga0395900_0015059 3300037418 Bacteria 7883
90 Ga0395900_0257095 3300037418 Bacteria 1745
91 Ga0395900_0372939 3300037418 Bacteria 1396
92 Ga0395900_0605822 3300037418 Bacteria 1035
93 Ga0395900_0817638 3300037418 Bacteria 859
94 Ga0395900_1483633 3300037418 Bacteria 590
95 Ga0395898_0004598 3300037466 Bacteria 15063
96 Ga0395898_0104851 3300037466 Bacteria 2711
97 Ga0395898_0209885 3300037466 Bacteria 1857
98 Ga0395905_0011277 3300037471 Bacteria 8638
99 Ga0395905_0086946 3300037471 Bacteria 2930
100 Ga0395905_0335138 3300037471 Bacteria 1403
101 Ga0395905_0466180 3300037471 Bacteria 1162
102 Ga0395905_0677659 3300037471 Bacteria 933
103 Ga0436364_0267098 3300037853 Bacteria 21902
104 Ga0436364_0304701 3300037853 Bacteria 7228
105 Ga0436364_0382546 3300037853 Bacteria 2748
106 Ga0395901_0007686 3300038443 Bacteria 10875
107 Ga0395901_0014303 3300038443 Bacteria 8079
108 Ga0395901_0263992 3300038443 Bacteria 1791
109 Ga0395901_1098016 3300038443 Bacteria 766
110 Ga0395901_1176482 3300038443 Bacteria 734
111 Ga0395901_1233524 3300038443 Unclassified 712
112 Ga0395901_1485234 3300038443 Bacteria 634
113 Ga0436365_1590303 3300039437 Bacteria 862
114 Ga0436365_1866545 3300039437 Bacteria 18889
115 Ga0436363_0009670 3300039450 Bacteria 2397
116 Ga0436363_0506377 3300039450 Bacteria 1000
117 Ga0436363_1042552 3300039450 Bacteria 1890
118 Ga0436363_1506635 3300039450 Bacteria 1085
119 Ga0436362_0857944 3300039453 Bacteria 1366
120 Ga0451802_1405635 3300041460 Unclassified 1013
121 Ga0450916_021686 3300042530 Bacteria 886
122 Ga0453683_0386167 3300044673 Bacteria 902
123 Ga0466960_0945068 3300044901 Bacteria 527
124 Ga0466959_0590664 3300045049 Bacteria 747
125 Ga0495584_0190652 3300046491 Bacteria 1042
126 Ga0495658_0320658 3300046683 Bacteria 982
127 Ga0495672_0010560 3300047320 Bacteria 6568
128 Ga0495676_0327787 3300047321 Bacteria 1027
129 Ga0496101_0079190 3300048904 Bacteria 2425
130 Ga0496112_0040871 3300048915 Bacteria 4535
131 Ga0496114_0134839 3300048917 Bacteria 2134
132 Ga0501031_0001046 3300049568 Bacteria 16796
133 Ga0501032_0001481 3300049569 Bacteria 18719
134 Ga0501032_0034768 3300049569 Bacteria 3447
135 Ga0501033_0000208 3300049570 Bacteria 56046
136 Ga0501033_0012494 3300049570 Bacteria 6479
137 Ga0501034_0003348 3300049571 Bacteria 18285
138 Ga0501034_0030627 3300049571 Bacteria 5469
139 Ga0501036_0000195 3300049572 Bacteria 40369
140 Ga0501036_0002160 3300049572 Bacteria 15353
141 Ga0501036_0100124 3300049572 Bacteria 2451
142 Ga0501036_0352343 3300049572 Bacteria 1229
143 Ga0501036_0578452 3300049572 Bacteria 932
144 Ga0501037_0000878 3300049573 Bacteria 22466
145 Ga0501037_0004037 3300049573 Bacteria 10645
146 Ga0501038_0001148 3300049574 Bacteria 23997
147 Ga0501038_0003497 3300049574 Bacteria 14626
148 Ga0501038_0011446 3300049574 Bacteria 8094
149 Ga0501038_0964984 3300049574 Bacteria 627
150 Ga0501039_0000171 3300049575 Bacteria 45473
151 Ga0501039_0436776 3300049575 Bacteria 1028
152 Ga0501040_0000094 3300049576 Bacteria 44554
153 Ga0501040_0005869 3300049576 Bacteria 7948
154 Ga0501040_0016175 3300049576 Bacteria 4933
155 Ga0501040_0386495 3300049576 Bacteria 1004
156 Ga0501041_0000319 3300049577 Bacteria 23508
157 Ga0501041_0006403 3300049577 Bacteria 6890
158 Ga0501041_0013890 3300049577 Bacteria 4775
159 Ga0501041_0800916 3300049577 Bacteria 604
160 Ga0501042_0000315 3300049578 Bacteria 24225
161 Ga0501042_0014292 3300049578 Bacteria 5417
162 Ga0501042_0042303 3300049578 Bacteria 3242
163 Ga0501042_0138830 3300049578 Bacteria 1752
164 Ga0501042_0427616 3300049578 Bacteria 960
165 Ga0501043_0000295 3300049579 Bacteria 45082
166 Ga0501043_0025120 3300049579 Bacteria 4674
167 Ga0501043_0073741 3300049579 Bacteria 2680
168 Ga0501046_0003469 3300049580 Bacteria 14475
169 Ga0501046_0004494 3300049580 Bacteria 12643
170 Ga0501046_0010625 3300049580 Bacteria 7898
171 Ga0501046_0303088 3300049580 Bacteria 1166
172 Ga0501047_0001126 3300049581 Bacteria 26549
173 Ga0501047_0005665 3300049581 Bacteria 11758
174 Ga0501047_1211182 3300049581 Bacteria 569
175 Ga0501048_0001207 3300049582 Bacteria 19578
176 Ga0501048_0002790 3300049582 Bacteria 13342
177 Ga0501048_0027593 3300049582 Bacteria 4124
178 Ga0501048_0190923 3300049582 Bacteria 1451
179 Ga0501048_0776002 3300049582 Bacteria 688
180 Ga0501067_0441974 3300049583 Bacteria 726
181 Ga0501068_0000052 3300049584 Bacteria 45484
182 Ga0501068_0235584 3300049584 Bacteria 1164
183 Ga0501069_0006120 3300049585 Bacteria 6282
184 Ga0501069_0040943 3300049585 Bacteria 2560
185 Ga0501070_0007329 3300049586 Bacteria 9365
186 Ga0501070_0057283 3300049586 Bacteria 3230
187 Ga0501070_0164988 3300049586 Bacteria 1825
188 Ga0501071_0001321 3300049587 Bacteria 14134
189 Ga0501071_0048503 3300049587 Bacteria 3054
190 Ga0501071_0428789 3300049587 Bacteria 1011
191 Ga0501072_0000892 3300049588 Bacteria 21902
192 Ga0501072_0000942 3300049588 Bacteria 21417
193 Ga0501072_0102088 3300049588 Bacteria 2279
194 Ga0501072_0592506 3300049588 Bacteria 874
195 Ga0501073_0001135 3300049589 Bacteria 19358
196 Ga0501073_0040982 3300049589 Bacteria 3273
197 Ga0501074_0000118 3300049590 Bacteria 40043
198 Ga0501074_0006569 3300049590 Bacteria 8406
199 Ga0501074_0044433 3300049590 Bacteria 3216
200 Ga0501074_0562133 3300049590 Bacteria 807
201 Ga0501075_0000109 3300049591 Bacteria 38985
202 Ga0501075_0003818 3300049591 Bacteria 10142
203 Ga0501075_0039591 3300049591 Bacteria 3527
204 Ga0501075_0084061 3300049591 Bacteria 2410
205 Ga0501075_0425079 3300049591 Bacteria 1013
206 Ga0501076_0000940 3300049592 Bacteria 18997
207 Ga0501076_0001616 3300049592 Bacteria 15195
208 Ga0501076_0030840 3300049592 Bacteria 4178
209 Ga0501076_0045201 3300049592 Bacteria 3476
210 Ga0501076_0092938 3300049592 Bacteria 2427
211 Ga0501076_0273370 3300049592 Bacteria 1384
212 Ga0501076_0442068 3300049592 Bacteria 1070
213 Ga0501076_0450239 3300049592 Bacteria 1060
214 Ga0501076_1045736 3300049592 Bacteria 673
215 Ga0501077_0001852 3300049593 Bacteria 12782
216 Ga0501077_0007186 3300049593 Bacteria 6866
217 Ga0501077_0188468 3300049593 Bacteria 1310
218 Ga0501077_0484526 3300049593 Bacteria 793
219 Ga0501079_0000086 3300049741 Bacteria 44783
220 Ga0501079_0000099 3300049741 Bacteria 43513
221 Ga0501079_0007181 3300049741 Bacteria 8408
222 Ga0501079_0036321 3300049741 Bacteria 3796
223 Ga0501079_0084430 3300049741 Bacteria 2456
224 Ga0501080_0000768 3300049742 Bacteria 26067
225 Ga0501080_0019696 3300049742 Bacteria 6249
226 Ga0501080_0328429 3300049742 Bacteria 1383
227 Ga0501080_0442722 3300049742 Bacteria 1165
228 Ga0501081_0000235 3300049743 Bacteria 28089
229 Ga0501081_0000839 3300049743 Bacteria 18170
230 Ga0501081_0010109 3300049743 Bacteria 6156
231 Ga0501081_0083618 3300049743 Bacteria 2237
232 Ga0501081_0778745 3300049743 Bacteria 719
233 Ga0501081_0940703 3300049743 Bacteria 652
234 Ga0501083_0000227 3300049744 Bacteria 36195
235 Ga0501083_0195360 3300049744 Bacteria 1320
236 Ga0501035_0001709 3300049822 Bacteria 22177
237 Ga0501035_0004658 3300049822 Bacteria 13017
238 Ga0501035_0004918 3300049822 Bacteria 12674
239 Ga0501044_0000984 3300049823 Bacteria 34240
240 Ga0501045_0001187 3300049824 Bacteria 17323
241 Ga0501045_0009252 3300049824 Bacteria 6890
242 Ga0501045_0012847 3300049824 Bacteria 5902
243 Ga0501045_0039898 3300049824 Bacteria 3416
244 Ga0501045_0601756 3300049824 Bacteria 814
245 nmdc:mga03683_171977_c1 3300050489 Bacteria 985
246 nmdc:mga03n38_105033_c1 3300050490 Bacteria 1367
247 nmdc:mga00v17_121425_c1 3300050491 Bacteria 1664
248 nmdc:mga0yw44_46678_c1 3300050492 Bacteria 2602
249 nmdc:mga0yw44_52923_c1 3300050492 Bacteria 2463
250 nmdc:mga05p37_481764_c1 3300050507 Bacteria 1429
251 nmdc:mga05p37_601183_c1 3300050507 Bacteria 1241
252 nmdc:mga05p37_608902_c1 3300050507 Bacteria 1232
253 nmdc:mga05p37_957529_c1 3300050507 Bacteria 915
254 nmdc:mga0qj67_39719_c1 3300050509 Bacteria 3697
255 nmdc:mga06r32_22448_c1 3300050510 Bacteria 5835
256 nmdc:mga08y16_156584_c1 3300050511 Bacteria 2367
257 nmdc:mga08y16_230790_c1 3300050511 Bacteria 1914
258 nmdc:mga08y16_671752_c1 3300050511 Bacteria 1038
259 nmdc:mga08y16_82903_c1 3300050511 Bacteria 3343
260 nmdc:mga0rr50_39899_c1 3300050513 Bacteria 3409
261 nmdc:mga0a205_3354_c1 3300050515 Bacteria 12991
262 Ga0500644_0169685 3300053088 Bacteria 887
263 Ga0501084_0001163 3300054114 Bacteria 20525
264 Ga0501084_0010624 3300054114 Bacteria 7617
265 Ga0501084_0026551 3300054114 Bacteria 4833
266 Ga0501084_0473562 3300054114 Bacteria 1058
267 Ga0590071_050352 3300059421 Bacteria 1009
268 Ga0501082_0000563 3300060353 Bacteria 32925
269 Ga0501082_0000584 3300060353 Bacteria 32310
270 Ga0501082_0029653 3300060353 Bacteria 4713
271 Ga0501082_0194534 3300060353 Bacteria 1764
272 Ga0501082_1045873 3300060353 Bacteria 714
273 Ga0501082_1259003 3300060353 Bacteria 646
274 Ga0530510_0001857 3300061734 Bacteria 14439
275 Ga0530510_0021940 3300061734 Bacteria 4545
276 Ga0530510_0098455 3300061734 Bacteria 2138
277 Ga0530510_0948196 3300061734 Bacteria 658
278 8047718644 8047710418 Bacteria 11023148
279 Ga0496106_0212730
280 JGI25407J50210_10014224
281 JGI25407J50210_10026007
282 JGI25407J50210_10040105
283 Ga0070666_11217610
284 Ga0070668_100936146
285 Ga0070659_100000003
286 Ga0070659_100540451
287 Ga0070711_100139873
288 Ga0070704_101000370
289 Ga0068870_10213925
290 Ga0081455_10006277
291 Ga0081455_10017821
292 Ga0081455_10019644
293 Ga0081455_10067204
294 Ga0081538_10000073
295 Ga0081538_10000902
296 Ga0081538_10004952
297 Ga0081538_10036831
298 Ga0081539_10067115
299 Ga0070717_10958262
300 Ga0075365_10028574
301 Ga0075365_10106444
302 Ga0075363_100169476
303 Ga0075364_10030389
304 Ga0075432_10013109
305 Ga0075362_10048052
306 Ga0075428_100112070
307 Ga0075428_100641040
308 Ga0075430_100047069
309 Ga0075431_100174757
310 Ga0075433_10005757
311 Ga0075434_100004879
312 Ga0075429_100029581
313 Ga0075436_100079331
314 Ga0075435_100010937
315 Ga0111539_10053097
316 Ga0111539_10191970
317 Ga0114129_10084319
318 Ga0114129_10595265
319 Ga0114129_10768071
320 Ga0114129_10776245
321 Ga0114129_11267385
322 Ga0105243_10169087
323 Ga0105241_10942733
324 Ga0105242_10160481
325 Ga0157380_10246709
326 Ga0157376_10017908
327 Ga0213874_10082122
328 Ga0213876_10004167
329 Ga0213875_10001409
330 Ga0207699_10445288
331 Ga0207693_10556921
332 Ga0207657_10109176
333 Ga0207646_10722325
334 Ga0207700_10521508
335 Ga0207690_10000021
336 Ga0207686_10055030
337 Ga0207709_11408641
338 Ga0207704_10695136
339 Ga0207683_10031993
340 Ga0207428_10013175
341 Ga0268266_10401445
342 Ga0316182_1115800
343 Ga0307405_10038900
344 Ga0307405_10368683
345 Ga0307410_10193576
346 Ga0307406_10015882
347 Ga0307406_11613034
348 Ga0307407_10075800
349 Ga0307409_100492119
350 Ga0307409_100679620
351 Ga0307409_100701541
352 Ga0307416_100030108
353 Ga0307416_100180227
354 Ga0307414_10170193
355 Ga0307411_10374292
356 Ga0307415_100000180
357 Ga0307415_100994582
358 Ga0373926_0187351
359 Ga0373943_0013250
360 Ga0373935_0379549
361 Ga0373947_0001154
362 Ga0395899_0002792
363 Ga0395899_0066962
364 Ga0395899_0074309
365 Ga0395899_0153625
366 Ga0395899_0372421
367 Ga0395900_0015059
368 Ga0395900_0257095
369 Ga0395900_0372939
370 Ga0395900_0605822
371 Ga0395900_0817638
372 Ga0395900_1483633
373 Ga0395898_0004598
374 Ga0395898_0104851
375 Ga0395898_0209885
376 Ga0395905_0011277
377 Ga0395905_0086946
378 Ga0395905_0335138
379 Ga0395905_0466180
380 Ga0395905_0677659
381 Ga0436364_0267098
382 Ga0436364_0304701
383 Ga0436364_0382546
384 Ga0395901_0007686
385 Ga0395901_0014303
386 Ga0395901_0263992
387 Ga0395901_1098016
388 Ga0395901_1176482
389 Ga0395901_1233524
390 Ga0395901_1485234
391 Ga0436365_1590303
392 Ga0436365_1866545
393 Ga0436363_0009670
394 Ga0436363_0506377
395 Ga0436363_1042552
396 Ga0436363_1506635
397 Ga0436362_0857944
398 Ga0451802_1405635
399 Ga0450916_021686
400 Ga0453683_0386167
401 Ga0466960_0945068
402 Ga0466959_0590664
403 Ga0495584_0190652
404 Ga0495658_0320658
405 Ga0495672_0010560
406 Ga0495676_0327787
407 Ga0496101_0079190
408 Ga0496112_0040871
409 Ga0496114_0134839
410 Ga0501031_0001046
411 Ga0501032_0001481
412 Ga0501032_0034768
413 Ga0501033_0000208
414 Ga0501033_0012494
415 Ga0501034_0003348
416 Ga0501034_0030627
417 Ga0501036_0000195
418 Ga0501036_0002160
419 Ga0501036_0100124
420 Ga0501036_0352343
421 Ga0501036_0578452
422 Ga0501037_0000878
423 Ga0501037_0004037
424 Ga0501038_0001148
425 Ga0501038_0003497
426 Ga0501038_0011446
427 Ga0501038_0964984
428 Ga0501039_0000171
429 Ga0501039_0436776
430 Ga0501040_0000094
431 Ga0501040_0005869
432 Ga0501040_0016175
433 Ga0501040_0386495
434 Ga0501041_0000319
435 Ga0501041_0006403
436 Ga0501041_0013890
437 Ga0501041_0800916
438 Ga0501042_0000315
439 Ga0501042_0014292
440 Ga0501042_0042303
441 Ga0501042_0138830
442 Ga0501042_0427616
443 Ga0501043_0000295
444 Ga0501043_0025120
445 Ga0501043_0073741
446 Ga0501046_0003469
447 Ga0501046_0004494
448 Ga0501046_0010625
449 Ga0501046_0303088
450 Ga0501047_0001126
451 Ga0501047_0005665
452 Ga0501047_1211182
453 Ga0501048_0001207
454 Ga0501048_0002790
455 Ga0501048_0027593
456 Ga0501048_0190923
457 Ga0501048_0776002
458 Ga0501067_0441974
459 Ga0501068_0000052
460 Ga0501068_0235584
461 Ga0501069_0006120
462 Ga0501069_0040943
463 Ga0501070_0007329
464 Ga0501070_0057283
465 Ga0501070_0164988
466 Ga0501071_0001321
467 Ga0501071_0048503
468 Ga0501071_0428789
469 Ga0501072_0000892
470 Ga0501072_0000942
471 Ga0501072_0102088
472 Ga0501072_0592506
473 Ga0501073_0001135
474 Ga0501073_0040982
475 Ga0501074_0000118
476 Ga0501074_0006569
477 Ga0501074_0044433
478 Ga0501074_0562133
479 Ga0501075_0000109
480 Ga0501075_0003818
481 Ga0501075_0039591
482 Ga0501075_0084061
483 Ga0501075_0425079
484 Ga0501076_0000940
485 Ga0501076_0001616
486 Ga0501076_0030840
487 Ga0501076_0045201
488 Ga0501076_0092938
489 Ga0501076_0273370
490 Ga0501076_0442068
491 Ga0501076_0450239
492 Ga0501076_1045736
493 Ga0501077_0001852
494 Ga0501077_0007186
495 Ga0501077_0188468
496 Ga0501077_0484526
497 Ga0501079_0000086
498 Ga0501079_0000099
499 Ga0501079_0007181
500 Ga0501079_0036321
501 Ga0501079_0084430
502 Ga0501080_0000768
503 Ga0501080_0019696
504 Ga0501080_0328429
505 Ga0501080_0442722
506 Ga0501081_0000235
507 Ga0501081_0000839
508 Ga0501081_0010109
509 Ga0501081_0083618
510 Ga0501081_0778745
511 Ga0501081_0940703
512 Ga0501083_0000227
513 Ga0501083_0195360
514 Ga0501035_0001709
515 Ga0501035_0004658
516 Ga0501035_0004918
517 Ga0501044_0000984
518 Ga0501045_0001187
519 Ga0501045_0009252
520 Ga0501045_0012847
521 Ga0501045_0039898
522 Ga0501045_0601756
523 nmdc:mga03683_171977_c1
524 nmdc:mga03n38_105033_c1
525 nmdc:mga00v17_121425_c1
526 nmdc:mga0yw44_46678_c1
527 nmdc:mga0yw44_52923_c1
528 nmdc:mga05p37_481764_c1
529 nmdc:mga05p37_601183_c1
530 nmdc:mga05p37_608902_c1
531 nmdc:mga05p37_957529_c1
532 nmdc:mga0qj67_39719_c1
533 nmdc:mga06r32_22448_c1
534 nmdc:mga08y16_156584_c1
535 nmdc:mga08y16_230790_c1
536 nmdc:mga08y16_671752_c1
537 nmdc:mga08y16_82903_c1
538 nmdc:mga0rr50_39899_c1
539 nmdc:mga0a205_3354_c1
540 Ga0500644_0169685
541 Ga0501084_0001163
542 Ga0501084_0010624
543 Ga0501084_0026551
544 Ga0501084_0473562
545 Ga0590071_050352
546 Ga0501082_0000563
547 Ga0501082_0000584
548 Ga0501082_0029653
549 Ga0501082_0194534
550 Ga0501082_1045873
551 Ga0501082_1259003
552 Ga0530510_0001857
553 Ga0530510_0021940
554 Ga0530510_0098455
555 Ga0530510_0948196
556 8047718644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

27

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9411 10 164
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9395 10 166
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9388 10 165
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9368 9 164
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9362 11 166
ID Description Score Start End Superfamily
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9331 10 163 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9256 10 163 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9012 10 163 3.30.530.20
3ni8A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8853 18 132 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8824 10 163 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A518AGI0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9783 9 162
AF-A0A537FJU4-F1-model_v4 ATPase 0.9782 11 166
AF-A0A2V8UFI6-F1-model_v4 ATPase 0.9767 8 165
AF-A0A0N9I7Y6-F1-model_v4 ATPase 0.975 11 165
AF-A0A193CCJ2-F1-model_v4 ATPase 0.9746 11 165

Map