F382292
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 278 | 194 | 556 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100362588|Ga0068858_1003625882 |
| Length | 257 |
| Sequence | MQAYLDLLSLVLDQGRFKPDRTGTGTYSVFGAQARFDLSAGFPLLTTKKLHLKSIIHELLWFLAGDTNVRYLQENGVTIWNEWADAEGNLGRVYGAQDGRRVDQIDDVIAAIKKNPDSRRLIVSAWNPGEVSSMALPPCHALFQFFVLDGRLSCQLYQRSADLFLGVPFNVASYALLTMMVAQVTGLAPGDFVHTFGDLHLYANHLDQAREQLTRAPRALPTMTLNPAIRDIHGFRYEDFTLGGYDPYPAIKAPIAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 64 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 104 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 120 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 121 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 122 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 123 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 126 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 127 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 130 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 131 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 132 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 133 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 134 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 135 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 136 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 137 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 147 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 148 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 149 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 165 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 166 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 174 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 175 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 176 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 179 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 180 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 181 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 182 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 183 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 184 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 185 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 186 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 187 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 188 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 189 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 190 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 191 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 192 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 193 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 194 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.45 |
| Metatranscriptomes | 1.44 |
| Isolates | 6.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.95 |
| Nodule | 0 |
| Rhizoplane | 1.08 |
| Rhizosphere | 80.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068858_100362588 | 3300005842 | Bacteria | 1389 |
| 2 | JGI24741J21665_1004973 | 3300001915 | Bacteria | 2852 |
| 3 | JGI24740J21852_10023256 | 3300001979 | Bacteria | 2120 |
| 4 | JGI25150J39212_1000139 | 3300002774 | Bacteria | 41082 |
| 5 | JGI25151J46595_10000286 | 3300003187 | Bacteria | 57223 |
| 6 | JGI25153J46596_10000185 | 3300003215 | Bacteria | 60646 |
| 7 | Ga0055536_1006798 | 3300003781 | Bacteria | 5235 |
| 8 | Ga0055534_1008697 | 3300003784 | Bacteria | 2276 |
| 9 | Ga0055531_10010756 | 3300003794 | Bacteria | 4504 |
| 10 | Ga0055531_10020448 | 3300003794 | Bacteria | 2617 |
| 11 | Ga0055531_10023853 | 3300003794 | Bacteria | 2277 |
| 12 | Ga0065715_10128137 | 3300005293 | Bacteria | 2072 |
| 13 | Ga0070658_10017120 | 3300005327 | Bacteria | 5800 |
| 14 | Ga0070658_10022634 | 3300005327 | Bacteria | 5043 |
| 15 | Ga0070676_10223395 | 3300005328 | Bacteria | 1245 |
| 16 | Ga0070683_100427031 | 3300005329 | Bacteria | 1264 |
| 17 | Ga0070680_100004423 | 3300005336 | Bacteria | 10579 |
| 18 | Ga0070680_100159799 | 3300005336 | Bacteria | 1893 |
| 19 | Ga0070682_100133947 | 3300005337 | Bacteria | 1680 |
| 20 | Ga0070660_100100423 | 3300005339 | Bacteria | 2292 |
| 21 | Ga0070661_100006488 | 3300005344 | Bacteria | 8069 |
| 22 | Ga0070661_100173157 | 3300005344 | Bacteria | 1640 |
| 23 | Ga0070661_100268150 | 3300005344 | Bacteria | 1321 |
| 24 | Ga0070692_10060056 | 3300005345 | Bacteria | 2000 |
| 25 | Ga0070675_100507935 | 3300005354 | Bacteria | 1087 |
| 26 | Ga0070671_100114667 | 3300005355 | Bacteria | 2265 |
| 27 | Ga0070667_100071570 | 3300005367 | Bacteria | 2953 |
| 28 | Ga0070705_100298557 | 3300005440 | Bacteria | 1153 |
| 29 | Ga0070700_100000060 | 3300005441 | Bacteria | 82198 |
| 30 | Ga0070694_100072794 | 3300005444 | Bacteria | 2371 |
| 31 | Ga0070662_100174075 | 3300005457 | Bacteria | 1692 |
| 32 | Ga0070681_10002611 | 3300005458 | Bacteria | 16539 |
| 33 | Ga0070681_10309026 | 3300005458 | Bacteria | 1490 |
| 34 | Ga0070679_100007492 | 3300005530 | Bacteria | 10207 |
| 35 | Ga0070697_100001447 | 3300005536 | Bacteria | 18057 |
| 36 | Ga0070697_100111780 | 3300005536 | Bacteria | 2277 |
| 37 | Ga0068853_100291498 | 3300005539 | Bacteria | 1506 |
| 38 | Ga0068853_100463036 | 3300005539 | Bacteria | 1193 |
| 39 | Ga0070695_100027525 | 3300005545 | Bacteria | 3522 |
| 40 | Ga0070696_100008693 | 3300005546 | Bacteria | 6795 |
| 41 | Ga0070696_100054133 | 3300005546 | Bacteria | 2795 |
| 42 | Ga0070693_100006800 | 3300005547 | Bacteria | 5554 |
| 43 | Ga0068855_100012259 | 3300005563 | Bacteria | 10360 |
| 44 | Ga0068855_100013476 | 3300005563 | Bacteria | 9855 |
| 45 | Ga0070664_100368317 | 3300005564 | Bacteria | 1309 |
| 46 | Ga0068854_100009218 | 3300005578 | Bacteria | 6369 |
| 47 | Ga0068854_100056654 | 3300005578 | Bacteria | 2825 |
| 48 | Ga0068854_100194106 | 3300005578 | Bacteria | 1592 |
| 49 | Ga0068856_100272881 | 3300005614 | Bacteria | 1707 |
| 50 | Ga0068852_100200937 | 3300005616 | Bacteria | 1886 |
| 51 | Ga0068852_100506748 | 3300005616 | Bacteria | 1202 |
| 52 | Ga0068864_100313561 | 3300005618 | Bacteria | 1471 |
| 53 | Ga0068851_10034049 | 3300005834 | Bacteria | 2541 |
| 54 | Ga0068863_100012080 | 3300005841 | Bacteria | 8342 |
| 55 | Ga0075367_10308225 | 3300006178 | Bacteria | 997 |
| 56 | Ga0075366_10001410 | 3300006195 | Bacteria | 11989 |
| 57 | Ga0075366_10016351 | 3300006195 | Bacteria | 4264 |
| 58 | Ga0075436_100065464 | 3300006914 | Bacteria | 2512 |
| 59 | Ga0075435_100059757 | 3300007076 | Bacteria | 3090 |
| 60 | Ga0105240_10854559 | 3300009093 | Bacteria | 982 |
| 61 | Ga0111539_10021888 | 3300009094 | Bacteria | 7860 |
| 62 | Ga0105248_10086974 | 3300009177 | Bacteria | 3517 |
| 63 | Ga0105237_10028708 | 3300009545 | Bacteria | 5663 |
| 64 | Ga0105237_10288507 | 3300009545 | Bacteria | 1644 |
| 65 | Ga0105238_10074559 | 3300009551 | Bacteria | 3386 |
| 66 | Ga0105246_10123402 | 3300011119 | Bacteria | 1923 |
| 67 | Ga0157373_10107373 | 3300013100 | Bacteria | 1962 |
| 68 | Ga0157373_10123165 | 3300013100 | Bacteria | 1823 |
| 69 | Ga0157370_10015907 | 3300013104 | Bacteria | 7633 |
| 70 | Ga0157370_10040803 | 3300013104 | Bacteria | 4480 |
| 71 | Ga0157370_10076225 | 3300013104 | Bacteria | 3159 |
| 72 | Ga0157369_10074352 | 3300013105 | Bacteria | 3644 |
| 73 | Ga0157369_10397809 | 3300013105 | Bacteria | 1429 |
| 74 | Ga0157372_10053301 | 3300013307 | Bacteria | 4508 |
| 75 | Ga0163163_10009825 | 3300014325 | Bacteria | 8575 |
| 76 | Ga0157380_10099053 | 3300014326 | Bacteria | 2423 |
| 77 | Ga0157377_10396459 | 3300014745 | Bacteria | 939 |
| 78 | Ga0182006_1013374 | 3300015261 | Bacteria | 3563 |
| 79 | Ga0206356_10098656 | 3300020070 | Bacteria | 1487 |
| 80 | Ga0206354_11456562 | 3300020081 | Bacteria | 1125 |
| 81 | Ga0206353_11789093 | 3300020082 | Bacteria | 990 |
| 82 | Ga0154015_1175367 | 3300020610 | Bacteria | 2558 |
| 83 | Ga0213875_10050417 | 3300021388 | Bacteria | 1950 |
| 84 | Ga0207425_1000040 | 3300025245 | Bacteria | 218121 |
| 85 | Ga0207425_1004020 | 3300025245 | Bacteria | 4519 |
| 86 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 87 | Ga0209673_1006867 | 3300025273 | Bacteria | 5395 |
| 88 | Ga0209130_1016213 | 3300025284 | Bacteria | 1810 |
| 89 | Ga0209675_1014861 | 3300025291 | Bacteria | 2345 |
| 90 | Ga0209676_1000875 | 3300025292 | Bacteria | 38585 |
| 91 | Ga0209676_1002435 | 3300025292 | Bacteria | 13235 |
| 92 | Ga0209676_1004358 | 3300025292 | Bacteria | 7923 |
| 93 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 94 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 95 | Ga0209564_1037051 | 3300025295 | Bacteria | 1381 |
| 96 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 97 | Ga0209758_1005161 | 3300025297 | Bacteria | 10277 |
| 98 | Ga0209050_1001382 | 3300025298 | Bacteria | 26440 |
| 99 | Ga0209050_1006336 | 3300025298 | Bacteria | 7044 |
| 100 | Ga0209256_1006988 | 3300025299 | Bacteria | 5742 |
| 101 | Ga0209257_1000343 | 3300025304 | Bacteria | 96876 |
| 102 | Ga0209257_1001069 | 3300025304 | Bacteria | 36154 |
| 103 | Ga0209257_1002349 | 3300025304 | Bacteria | 19030 |
| 104 | Ga0209257_1005411 | 3300025304 | Bacteria | 8981 |
| 105 | Ga0207647_10005232 | 3300025904 | Bacteria | 9552 |
| 106 | Ga0207705_10006810 | 3300025909 | Bacteria | 8444 |
| 107 | Ga0207705_10008814 | 3300025909 | Bacteria | 7354 |
| 108 | Ga0207705_10054645 | 3300025909 | Bacteria | 2878 |
| 109 | Ga0207707_10000179 | 3300025912 | Bacteria | 66039 |
| 110 | Ga0207695_10002955 | 3300025913 | Bacteria | 24524 |
| 111 | Ga0207695_10032680 | 3300025913 | Bacteria | 5691 |
| 112 | Ga0207671_10020755 | 3300025914 | Bacteria | 4996 |
| 113 | Ga0207660_10009177 | 3300025917 | Bacteria | 6404 |
| 114 | Ga0207660_10038059 | 3300025917 | Bacteria | 3356 |
| 115 | Ga0207657_10017681 | 3300025919 | Bacteria | 6831 |
| 116 | Ga0207657_10139376 | 3300025919 | Bacteria | 1982 |
| 117 | Ga0207649_10016388 | 3300025920 | Bacteria | 4177 |
| 118 | Ga0207649_10114243 | 3300025920 | Bacteria | 1809 |
| 119 | Ga0207652_10000894 | 3300025921 | Bacteria | 28219 |
| 120 | Ga0207681_10031517 | 3300025923 | Bacteria | 3464 |
| 121 | Ga0207694_10083696 | 3300025924 | Bacteria | 2509 |
| 122 | Ga0207694_10163986 | 3300025924 | Bacteria | 1796 |
| 123 | Ga0207650_10106129 | 3300025925 | Bacteria | 2169 |
| 124 | Ga0207690_10000869 | 3300025932 | Bacteria | 19295 |
| 125 | Ga0207690_10001880 | 3300025932 | Bacteria | 12885 |
| 126 | Ga0207706_10149349 | 3300025933 | Bacteria | 2055 |
| 127 | Ga0207661_10006454 | 3300025944 | Bacteria | 8292 |
| 128 | Ga0207679_10100921 | 3300025945 | Bacteria | 2256 |
| 129 | Ga0207667_10001475 | 3300025949 | Bacteria | 29510 |
| 130 | Ga0207667_10002217 | 3300025949 | Bacteria | 24401 |
| 131 | Ga0207667_10015281 | 3300025949 | Bacteria | 8729 |
| 132 | Ga0207640_10000593 | 3300025981 | Bacteria | 21569 |
| 133 | Ga0207640_10007800 | 3300025981 | Bacteria | 5913 |
| 134 | Ga0207640_10109547 | 3300025981 | Bacteria | 1954 |
| 135 | Ga0207658_10140404 | 3300025986 | Bacteria | 1954 |
| 136 | Ga0207658_10550886 | 3300025986 | Bacteria | 1032 |
| 137 | Ga0207677_10332870 | 3300026023 | Bacteria | 1266 |
| 138 | Ga0207639_10002079 | 3300026041 | Bacteria | 13485 |
| 139 | Ga0207639_10020689 | 3300026041 | Bacteria | 4713 |
| 140 | Ga0207678_10002825 | 3300026067 | Bacteria | 15738 |
| 141 | Ga0207678_10007453 | 3300026067 | Bacteria | 9687 |
| 142 | Ga0207708_10000011 | 3300026075 | Bacteria | 214227 |
| 143 | Ga0207702_10142242 | 3300026078 | Bacteria | 2172 |
| 144 | Ga0207674_10299818 | 3300026116 | Bacteria | 1556 |
| 145 | Ga0207698_10010632 | 3300026142 | Bacteria | 5930 |
| 146 | Ga0268266_10440976 | 3300028379 | Bacteria | 1237 |
| 147 | Ga0307511_10000064 | 3300030521 | Bacteria | 89445 |
| 148 | Ga0316178_1122830 | 3300030735 | Bacteria | 1955 |
| 149 | Ga0307408_100321533 | 3300031548 | Bacteria | 1303 |
| 150 | Ga0307408_100701744 | 3300031548 | Bacteria | 909 |
| 151 | Ga0307413_10022309 | 3300031824 | Bacteria | 3409 |
| 152 | Ga0307413_10416788 | 3300031824 | Bacteria | 1056 |
| 153 | Ga0307410_10138596 | 3300031852 | Bacteria | 1796 |
| 154 | Ga0307410_10269366 | 3300031852 | Bacteria | 1331 |
| 155 | Ga0307407_10004088 | 3300031903 | Bacteria | 6132 |
| 156 | Ga0307407_10157806 | 3300031903 | Bacteria | 1481 |
| 157 | Ga0307407_10300718 | 3300031903 | Bacteria | 1118 |
| 158 | Ga0307412_10053280 | 3300031911 | Bacteria | 2681 |
| 159 | Ga0307412_10188198 | 3300031911 | Bacteria | 1558 |
| 160 | Ga0307409_100109863 | 3300031995 | Bacteria | 2309 |
| 161 | Ga0307409_100379389 | 3300031995 | Bacteria | 1343 |
| 162 | Ga0307409_100449678 | 3300031995 | Bacteria | 1243 |
| 163 | Ga0307416_100020434 | 3300032002 | Bacteria | 4725 |
| 164 | Ga0307416_100078746 | 3300032002 | Bacteria | 2775 |
| 165 | Ga0307416_100255884 | 3300032002 | Bacteria | 1707 |
| 166 | Ga0307414_10053152 | 3300032004 | Bacteria | 2824 |
| 167 | Ga0307414_10407446 | 3300032004 | Bacteria | 1182 |
| 168 | Ga0307415_100179563 | 3300032126 | Bacteria | 1659 |
| 169 | Ga0307415_100265496 | 3300032126 | Bacteria | 1403 |
| 170 | Ga0395899_0145822 | 3300037312 | Bacteria | 1681 |
| 171 | Ga0395900_0000060 | 3300037418 | Bacteria | 205509 |
| 172 | Ga0395900_0010148 | 3300037418 | Bacteria | 9634 |
| 173 | Ga0395900_0494374 | 3300037418 | Bacteria | 1174 |
| 174 | Ga0395898_0123190 | 3300037466 | Bacteria | 2484 |
| 175 | Ga0395898_0463415 | 3300037466 | Bacteria | 1206 |
| 176 | Ga0395898_0502459 | 3300037466 | Bacteria | 1153 |
| 177 | Ga0436364_0473284 | 3300037853 | Bacteria | 4142 |
| 178 | Ga0395901_0065218 | 3300038443 | Bacteria | 3791 |
| 179 | Ga0395901_0524204 | 3300038443 | Bacteria | 1203 |
| 180 | Ga0237816_00310 | 3300039145 | Bacteria | 4190 |
| 181 | Ga0439436_0005365 | 3300041404 | Bacteria | 3932 |
| 182 | Ga0439439_0003072 | 3300041406 | Bacteria | 3637 |
| 183 | Ga0439447_003838 | 3300041407 | Bacteria | 5272 |
| 184 | Ga0439461_0004494 | 3300041410 | Bacteria | 2332 |
| 185 | Ga0439466_0015787 | 3300041411 | Bacteria | 2740 |
| 186 | Ga0439431_0059081 | 3300041997 | Bacteria | 1006 |
| 187 | Ga0439433_0003359 | 3300041999 | Bacteria | 3430 |
| 188 | Ga0439442_000355 | 3300042002 | Bacteria | 10924 |
| 189 | Ga0439442_013366 | 3300042002 | Bacteria | 1683 |
| 190 | Ga0439432_009906 | 3300042006 | Bacteria | 3314 |
| 191 | Ga0439432_016339 | 3300042006 | Bacteria | 2499 |
| 192 | Ga0439452_002811 | 3300042010 | Bacteria | 6286 |
| 193 | Ga0439457_003284 | 3300042014 | Bacteria | 4429 |
| 194 | Ga0439462_0000143 | 3300042015 | Bacteria | 11572 |
| 195 | Ga0450919_003934 | 3300042121 | Bacteria | 1832 |
| 196 | Ga0450906_027130 | 3300042145 | Bacteria | 1016 |
| 197 | Ga0450907_011544 | 3300042146 | Bacteria | 1466 |
| 198 | Ga0439446_0032175 | 3300042156 | Bacteria | 1520 |
| 199 | Ga0450909_000023 | 3300042185 | Bacteria | 11784 |
| 200 | Ga0439434_0008435 | 3300042435 | Bacteria | 3020 |
| 201 | Ga0453684_0027727 | 3300044712 | Bacteria | 8108 |
| 202 | Ga0451576_0046320 | 3300045051 | Bacteria | 4580 |
| 203 | Ga0451576_0068937 | 3300045051 | Bacteria | 3681 |
| 204 | Ga0495663_0061035 | 3300046525 | Bacteria | 1185 |
| 205 | Ga0495586_0250249 | 3300046535 | Bacteria | 1011 |
| 206 | Ga0495598_0015933 | 3300046537 | Bacteria | 1908 |
| 207 | Ga0495621_0043475 | 3300046539 | Bacteria | 1585 |
| 208 | Ga0495656_0006943 | 3300046615 | Bacteria | 3984 |
| 209 | Ga0495636_0000775 | 3300047318 | Bacteria | 11753 |
| 210 | Ga0495636_0032489 | 3300047318 | Bacteria | 2141 |
| 211 | Ga0495636_0046128 | 3300047318 | Bacteria | 1817 |
| 212 | Ga0495636_0087517 | 3300047318 | Bacteria | 1349 |
| 213 | Ga0496113_0037241 | 3300048916 | Bacteria | 3568 |
| 214 | Ga0496114_0320581 | 3300048917 | Bacteria | 1369 |
| 215 | Ga0496117_0003786 | 3300048920 | Bacteria | 17270 |
| 216 | Ga0501290_000825 | 3300049513 | Bacteria | 4575 |
| 217 | Ga0501034_0002873 | 3300049571 | Bacteria | 20025 |
| 218 | Ga0501034_0084656 | 3300049571 | Bacteria | 3172 |
| 219 | Ga0501037_0087397 | 3300049573 | Bacteria | 2256 |
| 220 | Ga0501038_0030834 | 3300049574 | Bacteria | 4740 |
| 221 | Ga0501047_0008521 | 3300049581 | Bacteria | 9672 |
| 222 | Ga0501047_0015168 | 3300049581 | Bacteria | 7337 |
| 223 | Ga0501047_0132108 | 3300049581 | Bacteria | 2376 |
| 224 | Ga0501069_0044660 | 3300049585 | Bacteria | 2453 |
| 225 | Ga0501069_0089125 | 3300049585 | Bacteria | 1744 |
| 226 | Ga0501069_0211555 | 3300049585 | Bacteria | 1125 |
| 227 | Ga0501070_0076364 | 3300049586 | Bacteria | 2773 |
| 228 | Ga0501070_0082636 | 3300049586 | Bacteria | 2658 |
| 229 | Ga0501070_0199135 | 3300049586 | Bacteria | 1645 |
| 230 | Ga0501070_0368626 | 3300049586 | Bacteria | 1164 |
| 231 | Ga0501071_0008981 | 3300049587 | Bacteria | 6632 |
| 232 | Ga0501073_0002230 | 3300049589 | Bacteria | 14502 |
| 233 | Ga0501073_0054602 | 3300049589 | Bacteria | 2796 |
| 234 | Ga0501074_0011346 | 3300049590 | Bacteria | 6475 |
| 235 | Ga0501074_0034063 | 3300049590 | Bacteria | 3692 |
| 236 | Ga0501076_0149022 | 3300049592 | Bacteria | 1903 |
| 237 | Ga0501202_003072 | 3300049652 | Bacteria | 2841 |
| 238 | Ga0501079_0005608 | 3300049741 | Bacteria | 9368 |
| 239 | Ga0501080_0021250 | 3300049742 | Bacteria | 6007 |
| 240 | Ga0501080_0037402 | 3300049742 | Bacteria | 4533 |
| 241 | Ga0501080_0487577 | 3300049742 | Bacteria | 1102 |
| 242 | Ga0501083_0055885 | 3300049744 | Bacteria | 2645 |
| 243 | Ga0501266_002614 | 3300049763 | Bacteria | 2259 |
| 244 | Ga0501268_004319 | 3300049765 | Bacteria | 1995 |
| 245 | Ga0501035_0065808 | 3300049822 | Bacteria | 3217 |
| 246 | Ga0501035_0198520 | 3300049822 | Bacteria | 1721 |
| 247 | Ga0501035_0652717 | 3300049822 | Bacteria | 853 |
| 248 | Ga0501044_0012205 | 3300049823 | Bacteria | 9300 |
| 249 | Ga0501044_0034494 | 3300049823 | Bacteria | 5306 |
| 250 | Ga0501044_0054426 | 3300049823 | Bacteria | 4113 |
| 251 | Ga0501044_0078298 | 3300049823 | Bacteria | 3350 |
| 252 | nmdc:mga0k408_9483_c1 | 3300050493 | Bacteria | 5248 |
| 253 | nmdc:mga06r32_426862_c1 | 3300050510 | Bacteria | 1306 |
| 254 | nmdc:mga08y16_17087_c1 | 3300050511 | Bacteria | 7639 |
| 255 | nmdc:mga0rr50_92988_c1 | 3300050513 | Bacteria | 2352 |
| 256 | nmdc:mga08x19_66_c1 | 3300050514 | Bacteria | 105609 |
| 257 | Ga0500555_000003 | 3300053103 | Bacteria | 392994 |
| 258 | Ga0500593_000036 | 3300053117 | Bacteria | 47889 |
| 259 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 260 | Ga0501084_0235044 | 3300054114 | Bacteria | 1547 |
| 261 | Ga0501082_0185020 | 3300060353 | Bacteria | 1812 |
| 262 | 2643976282 | 2643221593 | Bacteria | 6296053 |
| 263 | 2687580066 | 2687453129 | Bacteria | 4387428 |
| 264 | 2748018819 | 2747842501 | Bacteria | 5293829 |
| 265 | 2776913870 | 2775507049 | Bacteria | 6284736 |
| 266 | 2787435294 | 2786546517 | Bacteria | 6614109 |
| 267 | 2808827979 | 2808606357 | Bacteria | 4466944 |
| 268 | 2808853334 | 2808606360 | Bacteria | 4404006 |
| 269 | 2808878169 | 2808606366 | Bacteria | 4415912 |
| 270 | 2808892227 | 2808606370 | Bacteria | 4942454 |
| 271 | 2808897326 | 2808606371 | Bacteria | 4251511 |
| 272 | 2939598948 | 2939598168 | Bacteria | 4687164 |
| 273 | 2945921707 | 2945920336 | Bacteria | 4501603 |
| 274 | 2945942077 | 2945941187 | Bacteria | 4682474 |
| 275 | 2946038058 | 2946037020 | Bacteria | 4900426 |
| 276 | 2946061842 | 2946059875 | Bacteria | 4386623 |
| 277 | 2953999335 | 2953998280 | Bacteria | 4812144 |
| 278 | 8003015092 | 8003014200 | Bacteria | 4059994 |
| 279 | Ga0068858_100362588 | |||
| 280 | JGI24741J21665_1004973 | |||
| 281 | JGI24740J21852_10023256 | |||
| 282 | JGI25150J39212_1000139 | |||
| 283 | JGI25151J46595_10000286 | |||
| 284 | JGI25153J46596_10000185 | |||
| 285 | Ga0055536_1006798 | |||
| 286 | Ga0055534_1008697 | |||
| 287 | Ga0055531_10010756 | |||
| 288 | Ga0055531_10020448 | |||
| 289 | Ga0055531_10023853 | |||
| 290 | Ga0065715_10128137 | |||
| 291 | Ga0070658_10017120 | |||
| 292 | Ga0070658_10022634 | |||
| 293 | Ga0070676_10223395 | |||
| 294 | Ga0070683_100427031 | |||
| 295 | Ga0070680_100004423 | |||
| 296 | Ga0070680_100159799 | |||
| 297 | Ga0070682_100133947 | |||
| 298 | Ga0070660_100100423 | |||
| 299 | Ga0070661_100006488 | |||
| 300 | Ga0070661_100173157 | |||
| 301 | Ga0070661_100268150 | |||
| 302 | Ga0070692_10060056 | |||
| 303 | Ga0070675_100507935 | |||
| 304 | Ga0070671_100114667 | |||
| 305 | Ga0070667_100071570 | |||
| 306 | Ga0070705_100298557 | |||
| 307 | Ga0070700_100000060 | |||
| 308 | Ga0070694_100072794 | |||
| 309 | Ga0070662_100174075 | |||
| 310 | Ga0070681_10002611 | |||
| 311 | Ga0070681_10309026 | |||
| 312 | Ga0070679_100007492 | |||
| 313 | Ga0070697_100001447 | |||
| 314 | Ga0070697_100111780 | |||
| 315 | Ga0068853_100291498 | |||
| 316 | Ga0068853_100463036 | |||
| 317 | Ga0070695_100027525 | |||
| 318 | Ga0070696_100008693 | |||
| 319 | Ga0070696_100054133 | |||
| 320 | Ga0070693_100006800 | |||
| 321 | Ga0068855_100012259 | |||
| 322 | Ga0068855_100013476 | |||
| 323 | Ga0070664_100368317 | |||
| 324 | Ga0068854_100009218 | |||
| 325 | Ga0068854_100056654 | |||
| 326 | Ga0068854_100194106 | |||
| 327 | Ga0068856_100272881 | |||
| 328 | Ga0068852_100200937 | |||
| 329 | Ga0068852_100506748 | |||
| 330 | Ga0068864_100313561 | |||
| 331 | Ga0068851_10034049 | |||
| 332 | Ga0068863_100012080 | |||
| 333 | Ga0075367_10308225 | |||
| 334 | Ga0075366_10001410 | |||
| 335 | Ga0075366_10016351 | |||
| 336 | Ga0075436_100065464 | |||
| 337 | Ga0075435_100059757 | |||
| 338 | Ga0105240_10854559 | |||
| 339 | Ga0111539_10021888 | |||
| 340 | Ga0105248_10086974 | |||
| 341 | Ga0105237_10028708 | |||
| 342 | Ga0105237_10288507 | |||
| 343 | Ga0105238_10074559 | |||
| 344 | Ga0105246_10123402 | |||
| 345 | Ga0157373_10107373 | |||
| 346 | Ga0157373_10123165 | |||
| 347 | Ga0157370_10015907 | |||
| 348 | Ga0157370_10040803 | |||
| 349 | Ga0157370_10076225 | |||
| 350 | Ga0157369_10074352 | |||
| 351 | Ga0157369_10397809 | |||
| 352 | Ga0157372_10053301 | |||
| 353 | Ga0163163_10009825 | |||
| 354 | Ga0157380_10099053 | |||
| 355 | Ga0157377_10396459 | |||
| 356 | Ga0182006_1013374 | |||
| 357 | Ga0206356_10098656 | |||
| 358 | Ga0206354_11456562 | |||
| 359 | Ga0206353_11789093 | |||
| 360 | Ga0154015_1175367 | |||
| 361 | Ga0213875_10050417 | |||
| 362 | Ga0207425_1000040 | |||
| 363 | Ga0207425_1004020 | |||
| 364 | Ga0209129_1000011 | |||
| 365 | Ga0209673_1006867 | |||
| 366 | Ga0209130_1016213 | |||
| 367 | Ga0209675_1014861 | |||
| 368 | Ga0209676_1000875 | |||
| 369 | Ga0209676_1002435 | |||
| 370 | Ga0209676_1004358 | |||
| 371 | Ga0209025_1000002 | |||
| 372 | Ga0209025_1000006 | |||
| 373 | Ga0209564_1037051 | |||
| 374 | Ga0209758_1000003 | |||
| 375 | Ga0209758_1005161 | |||
| 376 | Ga0209050_1001382 | |||
| 377 | Ga0209050_1006336 | |||
| 378 | Ga0209256_1006988 | |||
| 379 | Ga0209257_1000343 | |||
| 380 | Ga0209257_1001069 | |||
| 381 | Ga0209257_1002349 | |||
| 382 | Ga0209257_1005411 | |||
| 383 | Ga0207647_10005232 | |||
| 384 | Ga0207705_10006810 | |||
| 385 | Ga0207705_10008814 | |||
| 386 | Ga0207705_10054645 | |||
| 387 | Ga0207707_10000179 | |||
| 388 | Ga0207695_10002955 | |||
| 389 | Ga0207695_10032680 | |||
| 390 | Ga0207671_10020755 | |||
| 391 | Ga0207660_10009177 | |||
| 392 | Ga0207660_10038059 | |||
| 393 | Ga0207657_10017681 | |||
| 394 | Ga0207657_10139376 | |||
| 395 | Ga0207649_10016388 | |||
| 396 | Ga0207649_10114243 | |||
| 397 | Ga0207652_10000894 | |||
| 398 | Ga0207681_10031517 | |||
| 399 | Ga0207694_10083696 | |||
| 400 | Ga0207694_10163986 | |||
| 401 | Ga0207650_10106129 | |||
| 402 | Ga0207690_10000869 | |||
| 403 | Ga0207690_10001880 | |||
| 404 | Ga0207706_10149349 | |||
| 405 | Ga0207661_10006454 | |||
| 406 | Ga0207679_10100921 | |||
| 407 | Ga0207667_10001475 | |||
| 408 | Ga0207667_10002217 | |||
| 409 | Ga0207667_10015281 | |||
| 410 | Ga0207640_10000593 | |||
| 411 | Ga0207640_10007800 | |||
| 412 | Ga0207640_10109547 | |||
| 413 | Ga0207658_10140404 | |||
| 414 | Ga0207658_10550886 | |||
| 415 | Ga0207677_10332870 | |||
| 416 | Ga0207639_10002079 | |||
| 417 | Ga0207639_10020689 | |||
| 418 | Ga0207678_10002825 | |||
| 419 | Ga0207678_10007453 | |||
| 420 | Ga0207708_10000011 | |||
| 421 | Ga0207702_10142242 | |||
| 422 | Ga0207674_10299818 | |||
| 423 | Ga0207698_10010632 | |||
| 424 | Ga0268266_10440976 | |||
| 425 | Ga0307511_10000064 | |||
| 426 | Ga0316178_1122830 | |||
| 427 | Ga0307408_100321533 | |||
| 428 | Ga0307408_100701744 | |||
| 429 | Ga0307413_10022309 | |||
| 430 | Ga0307413_10416788 | |||
| 431 | Ga0307410_10138596 | |||
| 432 | Ga0307410_10269366 | |||
| 433 | Ga0307407_10004088 | |||
| 434 | Ga0307407_10157806 | |||
| 435 | Ga0307407_10300718 | |||
| 436 | Ga0307412_10053280 | |||
| 437 | Ga0307412_10188198 | |||
| 438 | Ga0307409_100109863 | |||
| 439 | Ga0307409_100379389 | |||
| 440 | Ga0307409_100449678 | |||
| 441 | Ga0307416_100020434 | |||
| 442 | Ga0307416_100078746 | |||
| 443 | Ga0307416_100255884 | |||
| 444 | Ga0307414_10053152 | |||
| 445 | Ga0307414_10407446 | |||
| 446 | Ga0307415_100179563 | |||
| 447 | Ga0307415_100265496 | |||
| 448 | Ga0395899_0145822 | |||
| 449 | Ga0395900_0000060 | |||
| 450 | Ga0395900_0010148 | |||
| 451 | Ga0395900_0494374 | |||
| 452 | Ga0395898_0123190 | |||
| 453 | Ga0395898_0463415 | |||
| 454 | Ga0395898_0502459 | |||
| 455 | Ga0436364_0473284 | |||
| 456 | Ga0395901_0065218 | |||
| 457 | Ga0395901_0524204 | |||
| 458 | Ga0237816_00310 | |||
| 459 | Ga0439436_0005365 | |||
| 460 | Ga0439439_0003072 | |||
| 461 | Ga0439447_003838 | |||
| 462 | Ga0439461_0004494 | |||
| 463 | Ga0439466_0015787 | |||
| 464 | Ga0439431_0059081 | |||
| 465 | Ga0439433_0003359 | |||
| 466 | Ga0439442_000355 | |||
| 467 | Ga0439442_013366 | |||
| 468 | Ga0439432_009906 | |||
| 469 | Ga0439432_016339 | |||
| 470 | Ga0439452_002811 | |||
| 471 | Ga0439457_003284 | |||
| 472 | Ga0439462_0000143 | |||
| 473 | Ga0450919_003934 | |||
| 474 | Ga0450906_027130 | |||
| 475 | Ga0450907_011544 | |||
| 476 | Ga0439446_0032175 | |||
| 477 | Ga0450909_000023 | |||
| 478 | Ga0439434_0008435 | |||
| 479 | Ga0453684_0027727 | |||
| 480 | Ga0451576_0046320 | |||
| 481 | Ga0451576_0068937 | |||
| 482 | Ga0495663_0061035 | |||
| 483 | Ga0495586_0250249 | |||
| 484 | Ga0495598_0015933 | |||
| 485 | Ga0495621_0043475 | |||
| 486 | Ga0495656_0006943 | |||
| 487 | Ga0495636_0000775 | |||
| 488 | Ga0495636_0032489 | |||
| 489 | Ga0495636_0046128 | |||
| 490 | Ga0495636_0087517 | |||
| 491 | Ga0496113_0037241 | |||
| 492 | Ga0496114_0320581 | |||
| 493 | Ga0496117_0003786 | |||
| 494 | Ga0501290_000825 | |||
| 495 | Ga0501034_0002873 | |||
| 496 | Ga0501034_0084656 | |||
| 497 | Ga0501037_0087397 | |||
| 498 | Ga0501038_0030834 | |||
| 499 | Ga0501047_0008521 | |||
| 500 | Ga0501047_0015168 | |||
| 501 | Ga0501047_0132108 | |||
| 502 | Ga0501069_0044660 | |||
| 503 | Ga0501069_0089125 | |||
| 504 | Ga0501069_0211555 | |||
| 505 | Ga0501070_0076364 | |||
| 506 | Ga0501070_0082636 | |||
| 507 | Ga0501070_0199135 | |||
| 508 | Ga0501070_0368626 | |||
| 509 | Ga0501071_0008981 | |||
| 510 | Ga0501073_0002230 | |||
| 511 | Ga0501073_0054602 | |||
| 512 | Ga0501074_0011346 | |||
| 513 | Ga0501074_0034063 | |||
| 514 | Ga0501076_0149022 | |||
| 515 | Ga0501202_003072 | |||
| 516 | Ga0501079_0005608 | |||
| 517 | Ga0501080_0021250 | |||
| 518 | Ga0501080_0037402 | |||
| 519 | Ga0501080_0487577 | |||
| 520 | Ga0501083_0055885 | |||
| 521 | Ga0501266_002614 | |||
| 522 | Ga0501268_004319 | |||
| 523 | Ga0501035_0065808 | |||
| 524 | Ga0501035_0198520 | |||
| 525 | Ga0501035_0652717 | |||
| 526 | Ga0501044_0012205 | |||
| 527 | Ga0501044_0034494 | |||
| 528 | Ga0501044_0054426 | |||
| 529 | Ga0501044_0078298 | |||
| 530 | nmdc:mga0k408_9483_c1 | |||
| 531 | nmdc:mga06r32_426862_c1 | |||
| 532 | nmdc:mga08y16_17087_c1 | |||
| 533 | nmdc:mga0rr50_92988_c1 | |||
| 534 | nmdc:mga08x19_66_c1 | |||
| 535 | Ga0500555_000003 | |||
| 536 | Ga0500593_000036 | |||
| 537 | Ga0500568_0000002 | |||
| 538 | Ga0501084_0235044 | |||
| 539 | Ga0501082_0185020 | |||
| 540 | 2643976282 | |||
| 541 | 2687580066 | |||
| 542 | 2748018819 | |||
| 543 | 2776913870 | |||
| 544 | 2787435294 | |||
| 545 | 2808827979 | |||
| 546 | 2808853334 | |||
| 547 | 2808878169 | |||
| 548 | 2808892227 | |||
| 549 | 2808897326 | |||
| 550 | 2939598948 | |||
| 551 | 2945921707 | |||
| 552 | 2945942077 | |||
| 553 | 2946038058 | |||
| 554 | 2946061842 | |||
| 555 | 2953999335 | |||
| 556 | 8003015092 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bfi-assembly1.cif.gz_A-2 | e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump | 0.9884 | 3 | 264 |
| 1nce-assembly1.cif.gz_B | crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 | 0.9881 | 4 | 264 |
| 3b5b-assembly1.cif.gz_B | crystal structure of the thymidylate synthase k48q | 0.9879 | 1 | 264 |
| 4fog-assembly2.cif.gz_B | crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid | 0.9878 | 1 | 261 |
| 4h0u-assembly1.cif.gz_B | crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump | 0.9876 | 3 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9758 | 2 | 249 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9745 | 2 | 264 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9673 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9604 | 4 | 262 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9582 | 4 | 259 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059X1I7-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9962 | 29 | 209 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A528BC42-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9957 | 48 | 236 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A1G0F8E3-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9942 | 66 | 204 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A519H9X7-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9939 | 1 | 211 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A6N8MV19-F1-model_v4 | deleted | 0.9939 | 37 | 190 |
|