F382292

General Info

Members Datasets Scaffolds Average Seq Length
278 194 556 268

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100362588|Ga0068858_1003625882
Length 257
Sequence MQAYLDLLSLVLDQGRFKPDRTGTGTYSVFGAQARFDLSAGFPLLTTKKLHLKSIIHELLWFLAGDTNVRYLQENGVTIWNEWADAEGNLGRVYGAQDGRRVDQIDDVIAAIKKNPDSRRLIVSAWNPGEVSSMALPPCHALFQFFVLDGRLSCQLYQRSADLFLGVPFNVASYALLTMMVAQVTGLAPGDFVHTFGDLHLYANHLDQAREQLTRAPRALPTMTLNPAIRDIHGFRYEDFTLGGYDPYPAIKAPIAV

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
122 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
127 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
133 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
134 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
165 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
174 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2643221593 Lysobacter sp. Root690 Isolate Unclassified
179 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
180 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
181 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
182 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
183 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
184 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
185 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
186 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
187 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
188 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
189 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
190 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
191 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
192 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
193 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
194 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.45
Metatranscriptomes 1.44
Isolates 6.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.95
Nodule 0
Rhizoplane 1.08
Rhizosphere 80.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100362588 3300005842 Bacteria 1389
2 JGI24741J21665_1004973 3300001915 Bacteria 2852
3 JGI24740J21852_10023256 3300001979 Bacteria 2120
4 JGI25150J39212_1000139 3300002774 Bacteria 41082
5 JGI25151J46595_10000286 3300003187 Bacteria 57223
6 JGI25153J46596_10000185 3300003215 Bacteria 60646
7 Ga0055536_1006798 3300003781 Bacteria 5235
8 Ga0055534_1008697 3300003784 Bacteria 2276
9 Ga0055531_10010756 3300003794 Bacteria 4504
10 Ga0055531_10020448 3300003794 Bacteria 2617
11 Ga0055531_10023853 3300003794 Bacteria 2277
12 Ga0065715_10128137 3300005293 Bacteria 2072
13 Ga0070658_10017120 3300005327 Bacteria 5800
14 Ga0070658_10022634 3300005327 Bacteria 5043
15 Ga0070676_10223395 3300005328 Bacteria 1245
16 Ga0070683_100427031 3300005329 Bacteria 1264
17 Ga0070680_100004423 3300005336 Bacteria 10579
18 Ga0070680_100159799 3300005336 Bacteria 1893
19 Ga0070682_100133947 3300005337 Bacteria 1680
20 Ga0070660_100100423 3300005339 Bacteria 2292
21 Ga0070661_100006488 3300005344 Bacteria 8069
22 Ga0070661_100173157 3300005344 Bacteria 1640
23 Ga0070661_100268150 3300005344 Bacteria 1321
24 Ga0070692_10060056 3300005345 Bacteria 2000
25 Ga0070675_100507935 3300005354 Bacteria 1087
26 Ga0070671_100114667 3300005355 Bacteria 2265
27 Ga0070667_100071570 3300005367 Bacteria 2953
28 Ga0070705_100298557 3300005440 Bacteria 1153
29 Ga0070700_100000060 3300005441 Bacteria 82198
30 Ga0070694_100072794 3300005444 Bacteria 2371
31 Ga0070662_100174075 3300005457 Bacteria 1692
32 Ga0070681_10002611 3300005458 Bacteria 16539
33 Ga0070681_10309026 3300005458 Bacteria 1490
34 Ga0070679_100007492 3300005530 Bacteria 10207
35 Ga0070697_100001447 3300005536 Bacteria 18057
36 Ga0070697_100111780 3300005536 Bacteria 2277
37 Ga0068853_100291498 3300005539 Bacteria 1506
38 Ga0068853_100463036 3300005539 Bacteria 1193
39 Ga0070695_100027525 3300005545 Bacteria 3522
40 Ga0070696_100008693 3300005546 Bacteria 6795
41 Ga0070696_100054133 3300005546 Bacteria 2795
42 Ga0070693_100006800 3300005547 Bacteria 5554
43 Ga0068855_100012259 3300005563 Bacteria 10360
44 Ga0068855_100013476 3300005563 Bacteria 9855
45 Ga0070664_100368317 3300005564 Bacteria 1309
46 Ga0068854_100009218 3300005578 Bacteria 6369
47 Ga0068854_100056654 3300005578 Bacteria 2825
48 Ga0068854_100194106 3300005578 Bacteria 1592
49 Ga0068856_100272881 3300005614 Bacteria 1707
50 Ga0068852_100200937 3300005616 Bacteria 1886
51 Ga0068852_100506748 3300005616 Bacteria 1202
52 Ga0068864_100313561 3300005618 Bacteria 1471
53 Ga0068851_10034049 3300005834 Bacteria 2541
54 Ga0068863_100012080 3300005841 Bacteria 8342
55 Ga0075367_10308225 3300006178 Bacteria 997
56 Ga0075366_10001410 3300006195 Bacteria 11989
57 Ga0075366_10016351 3300006195 Bacteria 4264
58 Ga0075436_100065464 3300006914 Bacteria 2512
59 Ga0075435_100059757 3300007076 Bacteria 3090
60 Ga0105240_10854559 3300009093 Bacteria 982
61 Ga0111539_10021888 3300009094 Bacteria 7860
62 Ga0105248_10086974 3300009177 Bacteria 3517
63 Ga0105237_10028708 3300009545 Bacteria 5663
64 Ga0105237_10288507 3300009545 Bacteria 1644
65 Ga0105238_10074559 3300009551 Bacteria 3386
66 Ga0105246_10123402 3300011119 Bacteria 1923
67 Ga0157373_10107373 3300013100 Bacteria 1962
68 Ga0157373_10123165 3300013100 Bacteria 1823
69 Ga0157370_10015907 3300013104 Bacteria 7633
70 Ga0157370_10040803 3300013104 Bacteria 4480
71 Ga0157370_10076225 3300013104 Bacteria 3159
72 Ga0157369_10074352 3300013105 Bacteria 3644
73 Ga0157369_10397809 3300013105 Bacteria 1429
74 Ga0157372_10053301 3300013307 Bacteria 4508
75 Ga0163163_10009825 3300014325 Bacteria 8575
76 Ga0157380_10099053 3300014326 Bacteria 2423
77 Ga0157377_10396459 3300014745 Bacteria 939
78 Ga0182006_1013374 3300015261 Bacteria 3563
79 Ga0206356_10098656 3300020070 Bacteria 1487
80 Ga0206354_11456562 3300020081 Bacteria 1125
81 Ga0206353_11789093 3300020082 Bacteria 990
82 Ga0154015_1175367 3300020610 Bacteria 2558
83 Ga0213875_10050417 3300021388 Bacteria 1950
84 Ga0207425_1000040 3300025245 Bacteria 218121
85 Ga0207425_1004020 3300025245 Bacteria 4519
86 Ga0209129_1000011 3300025258 Bacteria 568657
87 Ga0209673_1006867 3300025273 Bacteria 5395
88 Ga0209130_1016213 3300025284 Bacteria 1810
89 Ga0209675_1014861 3300025291 Bacteria 2345
90 Ga0209676_1000875 3300025292 Bacteria 38585
91 Ga0209676_1002435 3300025292 Bacteria 13235
92 Ga0209676_1004358 3300025292 Bacteria 7923
93 Ga0209025_1000002 3300025294 Bacteria 1393142
94 Ga0209025_1000006 3300025294 Bacteria 1153444
95 Ga0209564_1037051 3300025295 Bacteria 1381
96 Ga0209758_1000003 3300025297 Bacteria 1398533
97 Ga0209758_1005161 3300025297 Bacteria 10277
98 Ga0209050_1001382 3300025298 Bacteria 26440
99 Ga0209050_1006336 3300025298 Bacteria 7044
100 Ga0209256_1006988 3300025299 Bacteria 5742
101 Ga0209257_1000343 3300025304 Bacteria 96876
102 Ga0209257_1001069 3300025304 Bacteria 36154
103 Ga0209257_1002349 3300025304 Bacteria 19030
104 Ga0209257_1005411 3300025304 Bacteria 8981
105 Ga0207647_10005232 3300025904 Bacteria 9552
106 Ga0207705_10006810 3300025909 Bacteria 8444
107 Ga0207705_10008814 3300025909 Bacteria 7354
108 Ga0207705_10054645 3300025909 Bacteria 2878
109 Ga0207707_10000179 3300025912 Bacteria 66039
110 Ga0207695_10002955 3300025913 Bacteria 24524
111 Ga0207695_10032680 3300025913 Bacteria 5691
112 Ga0207671_10020755 3300025914 Bacteria 4996
113 Ga0207660_10009177 3300025917 Bacteria 6404
114 Ga0207660_10038059 3300025917 Bacteria 3356
115 Ga0207657_10017681 3300025919 Bacteria 6831
116 Ga0207657_10139376 3300025919 Bacteria 1982
117 Ga0207649_10016388 3300025920 Bacteria 4177
118 Ga0207649_10114243 3300025920 Bacteria 1809
119 Ga0207652_10000894 3300025921 Bacteria 28219
120 Ga0207681_10031517 3300025923 Bacteria 3464
121 Ga0207694_10083696 3300025924 Bacteria 2509
122 Ga0207694_10163986 3300025924 Bacteria 1796
123 Ga0207650_10106129 3300025925 Bacteria 2169
124 Ga0207690_10000869 3300025932 Bacteria 19295
125 Ga0207690_10001880 3300025932 Bacteria 12885
126 Ga0207706_10149349 3300025933 Bacteria 2055
127 Ga0207661_10006454 3300025944 Bacteria 8292
128 Ga0207679_10100921 3300025945 Bacteria 2256
129 Ga0207667_10001475 3300025949 Bacteria 29510
130 Ga0207667_10002217 3300025949 Bacteria 24401
131 Ga0207667_10015281 3300025949 Bacteria 8729
132 Ga0207640_10000593 3300025981 Bacteria 21569
133 Ga0207640_10007800 3300025981 Bacteria 5913
134 Ga0207640_10109547 3300025981 Bacteria 1954
135 Ga0207658_10140404 3300025986 Bacteria 1954
136 Ga0207658_10550886 3300025986 Bacteria 1032
137 Ga0207677_10332870 3300026023 Bacteria 1266
138 Ga0207639_10002079 3300026041 Bacteria 13485
139 Ga0207639_10020689 3300026041 Bacteria 4713
140 Ga0207678_10002825 3300026067 Bacteria 15738
141 Ga0207678_10007453 3300026067 Bacteria 9687
142 Ga0207708_10000011 3300026075 Bacteria 214227
143 Ga0207702_10142242 3300026078 Bacteria 2172
144 Ga0207674_10299818 3300026116 Bacteria 1556
145 Ga0207698_10010632 3300026142 Bacteria 5930
146 Ga0268266_10440976 3300028379 Bacteria 1237
147 Ga0307511_10000064 3300030521 Bacteria 89445
148 Ga0316178_1122830 3300030735 Bacteria 1955
149 Ga0307408_100321533 3300031548 Bacteria 1303
150 Ga0307408_100701744 3300031548 Bacteria 909
151 Ga0307413_10022309 3300031824 Bacteria 3409
152 Ga0307413_10416788 3300031824 Bacteria 1056
153 Ga0307410_10138596 3300031852 Bacteria 1796
154 Ga0307410_10269366 3300031852 Bacteria 1331
155 Ga0307407_10004088 3300031903 Bacteria 6132
156 Ga0307407_10157806 3300031903 Bacteria 1481
157 Ga0307407_10300718 3300031903 Bacteria 1118
158 Ga0307412_10053280 3300031911 Bacteria 2681
159 Ga0307412_10188198 3300031911 Bacteria 1558
160 Ga0307409_100109863 3300031995 Bacteria 2309
161 Ga0307409_100379389 3300031995 Bacteria 1343
162 Ga0307409_100449678 3300031995 Bacteria 1243
163 Ga0307416_100020434 3300032002 Bacteria 4725
164 Ga0307416_100078746 3300032002 Bacteria 2775
165 Ga0307416_100255884 3300032002 Bacteria 1707
166 Ga0307414_10053152 3300032004 Bacteria 2824
167 Ga0307414_10407446 3300032004 Bacteria 1182
168 Ga0307415_100179563 3300032126 Bacteria 1659
169 Ga0307415_100265496 3300032126 Bacteria 1403
170 Ga0395899_0145822 3300037312 Bacteria 1681
171 Ga0395900_0000060 3300037418 Bacteria 205509
172 Ga0395900_0010148 3300037418 Bacteria 9634
173 Ga0395900_0494374 3300037418 Bacteria 1174
174 Ga0395898_0123190 3300037466 Bacteria 2484
175 Ga0395898_0463415 3300037466 Bacteria 1206
176 Ga0395898_0502459 3300037466 Bacteria 1153
177 Ga0436364_0473284 3300037853 Bacteria 4142
178 Ga0395901_0065218 3300038443 Bacteria 3791
179 Ga0395901_0524204 3300038443 Bacteria 1203
180 Ga0237816_00310 3300039145 Bacteria 4190
181 Ga0439436_0005365 3300041404 Bacteria 3932
182 Ga0439439_0003072 3300041406 Bacteria 3637
183 Ga0439447_003838 3300041407 Bacteria 5272
184 Ga0439461_0004494 3300041410 Bacteria 2332
185 Ga0439466_0015787 3300041411 Bacteria 2740
186 Ga0439431_0059081 3300041997 Bacteria 1006
187 Ga0439433_0003359 3300041999 Bacteria 3430
188 Ga0439442_000355 3300042002 Bacteria 10924
189 Ga0439442_013366 3300042002 Bacteria 1683
190 Ga0439432_009906 3300042006 Bacteria 3314
191 Ga0439432_016339 3300042006 Bacteria 2499
192 Ga0439452_002811 3300042010 Bacteria 6286
193 Ga0439457_003284 3300042014 Bacteria 4429
194 Ga0439462_0000143 3300042015 Bacteria 11572
195 Ga0450919_003934 3300042121 Bacteria 1832
196 Ga0450906_027130 3300042145 Bacteria 1016
197 Ga0450907_011544 3300042146 Bacteria 1466
198 Ga0439446_0032175 3300042156 Bacteria 1520
199 Ga0450909_000023 3300042185 Bacteria 11784
200 Ga0439434_0008435 3300042435 Bacteria 3020
201 Ga0453684_0027727 3300044712 Bacteria 8108
202 Ga0451576_0046320 3300045051 Bacteria 4580
203 Ga0451576_0068937 3300045051 Bacteria 3681
204 Ga0495663_0061035 3300046525 Bacteria 1185
205 Ga0495586_0250249 3300046535 Bacteria 1011
206 Ga0495598_0015933 3300046537 Bacteria 1908
207 Ga0495621_0043475 3300046539 Bacteria 1585
208 Ga0495656_0006943 3300046615 Bacteria 3984
209 Ga0495636_0000775 3300047318 Bacteria 11753
210 Ga0495636_0032489 3300047318 Bacteria 2141
211 Ga0495636_0046128 3300047318 Bacteria 1817
212 Ga0495636_0087517 3300047318 Bacteria 1349
213 Ga0496113_0037241 3300048916 Bacteria 3568
214 Ga0496114_0320581 3300048917 Bacteria 1369
215 Ga0496117_0003786 3300048920 Bacteria 17270
216 Ga0501290_000825 3300049513 Bacteria 4575
217 Ga0501034_0002873 3300049571 Bacteria 20025
218 Ga0501034_0084656 3300049571 Bacteria 3172
219 Ga0501037_0087397 3300049573 Bacteria 2256
220 Ga0501038_0030834 3300049574 Bacteria 4740
221 Ga0501047_0008521 3300049581 Bacteria 9672
222 Ga0501047_0015168 3300049581 Bacteria 7337
223 Ga0501047_0132108 3300049581 Bacteria 2376
224 Ga0501069_0044660 3300049585 Bacteria 2453
225 Ga0501069_0089125 3300049585 Bacteria 1744
226 Ga0501069_0211555 3300049585 Bacteria 1125
227 Ga0501070_0076364 3300049586 Bacteria 2773
228 Ga0501070_0082636 3300049586 Bacteria 2658
229 Ga0501070_0199135 3300049586 Bacteria 1645
230 Ga0501070_0368626 3300049586 Bacteria 1164
231 Ga0501071_0008981 3300049587 Bacteria 6632
232 Ga0501073_0002230 3300049589 Bacteria 14502
233 Ga0501073_0054602 3300049589 Bacteria 2796
234 Ga0501074_0011346 3300049590 Bacteria 6475
235 Ga0501074_0034063 3300049590 Bacteria 3692
236 Ga0501076_0149022 3300049592 Bacteria 1903
237 Ga0501202_003072 3300049652 Bacteria 2841
238 Ga0501079_0005608 3300049741 Bacteria 9368
239 Ga0501080_0021250 3300049742 Bacteria 6007
240 Ga0501080_0037402 3300049742 Bacteria 4533
241 Ga0501080_0487577 3300049742 Bacteria 1102
242 Ga0501083_0055885 3300049744 Bacteria 2645
243 Ga0501266_002614 3300049763 Bacteria 2259
244 Ga0501268_004319 3300049765 Bacteria 1995
245 Ga0501035_0065808 3300049822 Bacteria 3217
246 Ga0501035_0198520 3300049822 Bacteria 1721
247 Ga0501035_0652717 3300049822 Bacteria 853
248 Ga0501044_0012205 3300049823 Bacteria 9300
249 Ga0501044_0034494 3300049823 Bacteria 5306
250 Ga0501044_0054426 3300049823 Bacteria 4113
251 Ga0501044_0078298 3300049823 Bacteria 3350
252 nmdc:mga0k408_9483_c1 3300050493 Bacteria 5248
253 nmdc:mga06r32_426862_c1 3300050510 Bacteria 1306
254 nmdc:mga08y16_17087_c1 3300050511 Bacteria 7639
255 nmdc:mga0rr50_92988_c1 3300050513 Bacteria 2352
256 nmdc:mga08x19_66_c1 3300050514 Bacteria 105609
257 Ga0500555_000003 3300053103 Bacteria 392994
258 Ga0500593_000036 3300053117 Bacteria 47889
259 Ga0500568_0000002 3300053139 Bacteria 880601
260 Ga0501084_0235044 3300054114 Bacteria 1547
261 Ga0501082_0185020 3300060353 Bacteria 1812
262 2643976282 2643221593 Bacteria 6296053
263 2687580066 2687453129 Bacteria 4387428
264 2748018819 2747842501 Bacteria 5293829
265 2776913870 2775507049 Bacteria 6284736
266 2787435294 2786546517 Bacteria 6614109
267 2808827979 2808606357 Bacteria 4466944
268 2808853334 2808606360 Bacteria 4404006
269 2808878169 2808606366 Bacteria 4415912
270 2808892227 2808606370 Bacteria 4942454
271 2808897326 2808606371 Bacteria 4251511
272 2939598948 2939598168 Bacteria 4687164
273 2945921707 2945920336 Bacteria 4501603
274 2945942077 2945941187 Bacteria 4682474
275 2946038058 2946037020 Bacteria 4900426
276 2946061842 2946059875 Bacteria 4386623
277 2953999335 2953998280 Bacteria 4812144
278 8003015092 8003014200 Bacteria 4059994
279 Ga0068858_100362588
280 JGI24741J21665_1004973
281 JGI24740J21852_10023256
282 JGI25150J39212_1000139
283 JGI25151J46595_10000286
284 JGI25153J46596_10000185
285 Ga0055536_1006798
286 Ga0055534_1008697
287 Ga0055531_10010756
288 Ga0055531_10020448
289 Ga0055531_10023853
290 Ga0065715_10128137
291 Ga0070658_10017120
292 Ga0070658_10022634
293 Ga0070676_10223395
294 Ga0070683_100427031
295 Ga0070680_100004423
296 Ga0070680_100159799
297 Ga0070682_100133947
298 Ga0070660_100100423
299 Ga0070661_100006488
300 Ga0070661_100173157
301 Ga0070661_100268150
302 Ga0070692_10060056
303 Ga0070675_100507935
304 Ga0070671_100114667
305 Ga0070667_100071570
306 Ga0070705_100298557
307 Ga0070700_100000060
308 Ga0070694_100072794
309 Ga0070662_100174075
310 Ga0070681_10002611
311 Ga0070681_10309026
312 Ga0070679_100007492
313 Ga0070697_100001447
314 Ga0070697_100111780
315 Ga0068853_100291498
316 Ga0068853_100463036
317 Ga0070695_100027525
318 Ga0070696_100008693
319 Ga0070696_100054133
320 Ga0070693_100006800
321 Ga0068855_100012259
322 Ga0068855_100013476
323 Ga0070664_100368317
324 Ga0068854_100009218
325 Ga0068854_100056654
326 Ga0068854_100194106
327 Ga0068856_100272881
328 Ga0068852_100200937
329 Ga0068852_100506748
330 Ga0068864_100313561
331 Ga0068851_10034049
332 Ga0068863_100012080
333 Ga0075367_10308225
334 Ga0075366_10001410
335 Ga0075366_10016351
336 Ga0075436_100065464
337 Ga0075435_100059757
338 Ga0105240_10854559
339 Ga0111539_10021888
340 Ga0105248_10086974
341 Ga0105237_10028708
342 Ga0105237_10288507
343 Ga0105238_10074559
344 Ga0105246_10123402
345 Ga0157373_10107373
346 Ga0157373_10123165
347 Ga0157370_10015907
348 Ga0157370_10040803
349 Ga0157370_10076225
350 Ga0157369_10074352
351 Ga0157369_10397809
352 Ga0157372_10053301
353 Ga0163163_10009825
354 Ga0157380_10099053
355 Ga0157377_10396459
356 Ga0182006_1013374
357 Ga0206356_10098656
358 Ga0206354_11456562
359 Ga0206353_11789093
360 Ga0154015_1175367
361 Ga0213875_10050417
362 Ga0207425_1000040
363 Ga0207425_1004020
364 Ga0209129_1000011
365 Ga0209673_1006867
366 Ga0209130_1016213
367 Ga0209675_1014861
368 Ga0209676_1000875
369 Ga0209676_1002435
370 Ga0209676_1004358
371 Ga0209025_1000002
372 Ga0209025_1000006
373 Ga0209564_1037051
374 Ga0209758_1000003
375 Ga0209758_1005161
376 Ga0209050_1001382
377 Ga0209050_1006336
378 Ga0209256_1006988
379 Ga0209257_1000343
380 Ga0209257_1001069
381 Ga0209257_1002349
382 Ga0209257_1005411
383 Ga0207647_10005232
384 Ga0207705_10006810
385 Ga0207705_10008814
386 Ga0207705_10054645
387 Ga0207707_10000179
388 Ga0207695_10002955
389 Ga0207695_10032680
390 Ga0207671_10020755
391 Ga0207660_10009177
392 Ga0207660_10038059
393 Ga0207657_10017681
394 Ga0207657_10139376
395 Ga0207649_10016388
396 Ga0207649_10114243
397 Ga0207652_10000894
398 Ga0207681_10031517
399 Ga0207694_10083696
400 Ga0207694_10163986
401 Ga0207650_10106129
402 Ga0207690_10000869
403 Ga0207690_10001880
404 Ga0207706_10149349
405 Ga0207661_10006454
406 Ga0207679_10100921
407 Ga0207667_10001475
408 Ga0207667_10002217
409 Ga0207667_10015281
410 Ga0207640_10000593
411 Ga0207640_10007800
412 Ga0207640_10109547
413 Ga0207658_10140404
414 Ga0207658_10550886
415 Ga0207677_10332870
416 Ga0207639_10002079
417 Ga0207639_10020689
418 Ga0207678_10002825
419 Ga0207678_10007453
420 Ga0207708_10000011
421 Ga0207702_10142242
422 Ga0207674_10299818
423 Ga0207698_10010632
424 Ga0268266_10440976
425 Ga0307511_10000064
426 Ga0316178_1122830
427 Ga0307408_100321533
428 Ga0307408_100701744
429 Ga0307413_10022309
430 Ga0307413_10416788
431 Ga0307410_10138596
432 Ga0307410_10269366
433 Ga0307407_10004088
434 Ga0307407_10157806
435 Ga0307407_10300718
436 Ga0307412_10053280
437 Ga0307412_10188198
438 Ga0307409_100109863
439 Ga0307409_100379389
440 Ga0307409_100449678
441 Ga0307416_100020434
442 Ga0307416_100078746
443 Ga0307416_100255884
444 Ga0307414_10053152
445 Ga0307414_10407446
446 Ga0307415_100179563
447 Ga0307415_100265496
448 Ga0395899_0145822
449 Ga0395900_0000060
450 Ga0395900_0010148
451 Ga0395900_0494374
452 Ga0395898_0123190
453 Ga0395898_0463415
454 Ga0395898_0502459
455 Ga0436364_0473284
456 Ga0395901_0065218
457 Ga0395901_0524204
458 Ga0237816_00310
459 Ga0439436_0005365
460 Ga0439439_0003072
461 Ga0439447_003838
462 Ga0439461_0004494
463 Ga0439466_0015787
464 Ga0439431_0059081
465 Ga0439433_0003359
466 Ga0439442_000355
467 Ga0439442_013366
468 Ga0439432_009906
469 Ga0439432_016339
470 Ga0439452_002811
471 Ga0439457_003284
472 Ga0439462_0000143
473 Ga0450919_003934
474 Ga0450906_027130
475 Ga0450907_011544
476 Ga0439446_0032175
477 Ga0450909_000023
478 Ga0439434_0008435
479 Ga0453684_0027727
480 Ga0451576_0046320
481 Ga0451576_0068937
482 Ga0495663_0061035
483 Ga0495586_0250249
484 Ga0495598_0015933
485 Ga0495621_0043475
486 Ga0495656_0006943
487 Ga0495636_0000775
488 Ga0495636_0032489
489 Ga0495636_0046128
490 Ga0495636_0087517
491 Ga0496113_0037241
492 Ga0496114_0320581
493 Ga0496117_0003786
494 Ga0501290_000825
495 Ga0501034_0002873
496 Ga0501034_0084656
497 Ga0501037_0087397
498 Ga0501038_0030834
499 Ga0501047_0008521
500 Ga0501047_0015168
501 Ga0501047_0132108
502 Ga0501069_0044660
503 Ga0501069_0089125
504 Ga0501069_0211555
505 Ga0501070_0076364
506 Ga0501070_0082636
507 Ga0501070_0199135
508 Ga0501070_0368626
509 Ga0501071_0008981
510 Ga0501073_0002230
511 Ga0501073_0054602
512 Ga0501074_0011346
513 Ga0501074_0034063
514 Ga0501076_0149022
515 Ga0501202_003072
516 Ga0501079_0005608
517 Ga0501080_0021250
518 Ga0501080_0037402
519 Ga0501080_0487577
520 Ga0501083_0055885
521 Ga0501266_002614
522 Ga0501268_004319
523 Ga0501035_0065808
524 Ga0501035_0198520
525 Ga0501035_0652717
526 Ga0501044_0012205
527 Ga0501044_0034494
528 Ga0501044_0054426
529 Ga0501044_0078298
530 nmdc:mga0k408_9483_c1
531 nmdc:mga06r32_426862_c1
532 nmdc:mga08y16_17087_c1
533 nmdc:mga0rr50_92988_c1
534 nmdc:mga08x19_66_c1
535 Ga0500555_000003
536 Ga0500593_000036
537 Ga0500568_0000002
538 Ga0501084_0235044
539 Ga0501082_0185020
540 2643976282
541 2687580066
542 2748018819
543 2776913870
544 2787435294
545 2808827979
546 2808853334
547 2808878169
548 2808892227
549 2808897326
550 2939598948
551 2945921707
552 2945942077
553 2946038058
554 2946061842
555 2953999335
556 8003015092

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

257

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9884 3 264
1nce-assembly1.cif.gz_B crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 0.9881 4 264
3b5b-assembly1.cif.gz_B crystal structure of the thymidylate synthase k48q 0.9879 1 264
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9878 1 261
4h0u-assembly1.cif.gz_B crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump 0.9876 3 259
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9758 2 249 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9745 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9673 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9604 4 262 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9582 4 259 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A059X1I7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9962 29 209 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A528BC42-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9957 48 236 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A1G0F8E3-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9942 66 204 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A519H9X7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9939 1 211 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A6N8MV19-F1-model_v4 deleted 0.9939 37 190

Map