F382262

General Info

Members Datasets Scaffolds Average Seq Length
278 192 556 132

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100046582|Ga0070672_1000465822
Length 151
Sequence MRNKPHPQTEVHLQTDEQQIRDLVATWMAATKSGDAEAVLGLMTEDAVFLVPGKPPMRKSDVAAAARAQASGNAPTFDGTSEIQEVQVAGDWAFMWSKLTVVATPPGGAIPTTRSGHTLTVFHRQGGRWLLARDANLLAPVQPGARQREQH

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
144 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
177 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 1.08
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 19.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100046582 3300005543 Bacteria 3360
2 JGI25407J50210_10053477 3300003373 Unclassified 1021
3 Ga0055540_1004651 3300003792 Bacteria 6089
4 Ga0055531_10001914 3300003794 Bacteria 14562
5 Ga0065715_10010635 3300005293 Unclassified 2800
6 Ga0070658_10359421 3300005327 Bacteria 1247
7 Ga0070658_10384327 3300005327 Bacteria 1205
8 Ga0070676_10485737 3300005328 Unclassified 874
9 Ga0070683_100002931 3300005329 Bacteria 13673
10 Ga0070683_100354268 3300005329 Bacteria 1398
11 Ga0070690_100711336 3300005330 Unclassified 772
12 Ga0070670_101803384 3300005331 Unclassified 563
13 Ga0068869_100010694 3300005334 Bacteria 5993
14 Ga0068869_100484679 3300005334 Bacteria 1030
15 Ga0068869_100916476 3300005334 Bacteria 759
16 Ga0070666_10000266 3300005335 Bacteria 34748
17 Ga0070666_10333192 3300005335 Unclassified 1084
18 Ga0070666_10380774 3300005335 Bacteria 1013
19 Ga0070666_10458159 3300005335 Unclassified 921
20 Ga0070680_100974828 3300005336 Unclassified 732
21 Ga0070682_100817642 3300005337 Bacteria 758
22 Ga0068868_100234461 3300005338 Unclassified 1540
23 Ga0070660_100033458 3300005339 Bacteria 3875
24 Ga0070661_101469021 3300005344 Unclassified 574
25 Ga0070692_10147559 3300005345 Bacteria 1337
26 Ga0070669_100797206 3300005353 Bacteria 803
27 Ga0070675_100292647 3300005354 Unclassified 1433
28 Ga0070671_100058696 3300005355 Bacteria 3202
29 Ga0070671_100630511 3300005355 Bacteria 927
30 Ga0070671_101091760 3300005355 Bacteria 701
31 Ga0070673_100049291 3300005364 Bacteria 3288
32 Ga0070673_101373024 3300005364 Bacteria 664
33 Ga0070667_100255787 3300005367 Bacteria 1567
34 Ga0070700_101189937 3300005441 Unclassified 636
35 Ga0068867_101273704 3300005459 Bacteria 678
36 Ga0070706_100331900 3300005467 Unclassified 1418
37 Ga0070698_100000005 3300005471 Bacteria 131348
38 Ga0070684_100043689 3300005535 Bacteria 3872
39 Ga0068853_100468769 3300005539 Bacteria 1186
40 Ga0068853_100897440 3300005539 Unclassified 851
41 Ga0070672_100005815 3300005543 Bacteria 8227
42 Ga0070672_100714914 3300005543 Bacteria 878
43 Ga0070693_100907888 3300005547 Unclassified 660
44 Ga0070665_100013994 3300005548 Bacteria 8069
45 Ga0068855_101947203 3300005563 Bacteria 594
46 Ga0068857_100100328 3300005577 Unclassified 2597
47 Ga0068857_100205651 3300005577 Bacteria 1795
48 Ga0068857_101950194 3300005577 Bacteria 575
49 Ga0068856_100083408 3300005614 Unclassified 3174
50 Ga0068852_100885096 3300005616 Bacteria 909
51 Ga0068859_100064180 3300005617 Bacteria 3705
52 Ga0068864_100040622 3300005618 Bacteria 3979
53 Ga0068864_100663052 3300005618 Bacteria 1017
54 Ga0068866_10357210 3300005718 Bacteria 930
55 Ga0068861_102158017 3300005719 Unclassified 558
56 Ga0068851_10209026 3300005834 Bacteria 1092
57 Ga0068863_100252854 3300005841 Bacteria 1702
58 Ga0068863_101353284 3300005841 Bacteria 719
59 Ga0068858_100072449 3300005842 Bacteria 3196
60 Ga0068858_100210972 3300005842 Bacteria 1838
61 Ga0068858_100392772 3300005842 Bacteria 1332
62 Ga0068860_100006140 3300005843 Bacteria 12086
63 Ga0068860_100716514 3300005843 Bacteria 1011
64 Ga0068860_101158156 3300005843 Unclassified 793
65 Ga0068860_102597489 3300005843 Unclassified 526
66 Ga0081538_10002644 3300005981 Bacteria 17290
67 Ga0081540_1000158 3300005983 Bacteria 69951
68 Ga0075365_10025646 3300006038 Bacteria 3733
69 Ga0075366_10100898 3300006195 Bacteria 1732
70 Ga0097621_100101511 3300006237 Bacteria 2421
71 Ga0097621_100630411 3300006237 Bacteria 982
72 Ga0068871_100199170 3300006358 Bacteria 1728
73 Ga0068871_100679473 3300006358 Bacteria 942
74 Ga0075428_100323547 3300006844 Bacteria 1657
75 Ga0075430_100245596 3300006846 Bacteria 1483
76 Ga0068865_100752656 3300006881 Bacteria 837
77 Ga0068865_100917090 3300006881 Bacteria 763
78 Ga0068865_101291918 3300006881 Unclassified 648
79 Ga0097620_100064181 3300006931 Bacteria 3705
80 Ga0099795_10227090 3300007788 Bacteria 797
81 Ga0105240_10015710 3300009093 Bacteria 10273
82 Ga0105240_10139800 3300009093 Bacteria 2896
83 Ga0105245_10215414 3300009098 Bacteria 1850
84 Ga0114129_10071149 3300009147 Bacteria 4850
85 Ga0114129_10368969 3300009147 Bacteria 1898
86 Ga0114129_11162827 3300009147 Bacteria 963
87 Ga0114129_11612295 3300009147 Bacteria 794
88 Ga0105243_10678124 3300009148 Bacteria 1002
89 Ga0105241_10498373 3300009174 Bacteria 1085
90 Ga0105241_10571951 3300009174 Unclassified 1017
91 Ga0105241_11582056 3300009174 Unclassified 633
92 Ga0105248_10033103 3300009177 Bacteria 5773
93 Ga0105248_10035120 3300009177 Bacteria 5609
94 Ga0105248_10087042 3300009177 Unclassified 3515
95 Ga0105239_10970510 3300010375 Bacteria 977
96 Ga0105246_10037271 3300011119 Bacteria 3263
97 Ga0157373_10132220 3300013100 Bacteria 1755
98 Ga0157371_10372442 3300013102 Bacteria 1042
99 Ga0157371_10377729 3300013102 Unclassified 1034
100 Ga0157370_10084510 3300013104 Bacteria 2983
101 Ga0157369_10006171 3300013105 Bacteria 13910
102 Ga0157378_10224388 3300013297 Bacteria 1787
103 Ga0157378_10574957 3300013297 Bacteria 1135
104 Ga0157378_12606724 3300013297 Unclassified 558
105 Ga0163162_10056095 3300013306 Bacteria 3968
106 Ga0163162_10153610 3300013306 Bacteria 2420
107 Ga0163162_10241422 3300013306 Unclassified 1938
108 Ga0163162_10247226 3300013306 Bacteria 1915
109 Ga0157375_10010036 3300013308 Bacteria 8325
110 Ga0157375_10110006 3300013308 Bacteria 2852
111 Ga0157375_10226103 3300013308 Bacteria 2030
112 Ga0157375_10549016 3300013308 Bacteria 1317
113 Ga0157375_10563769 3300013308 Bacteria 1300
114 Ga0163163_10000117 3300014325 Bacteria 84938
115 Ga0163163_10137895 3300014325 Bacteria 2481
116 Ga0157380_10174231 3300014326 Unclassified 1883
117 Ga0182008_10266632 3300014497 Archaea 887
118 Ga0157377_10205807 3300014745 Unclassified 1252
119 Ga0157379_10065109 3300014968 Bacteria 3258
120 Ga0157379_10638012 3300014968 Bacteria 996
121 Ga0157379_11618578 3300014968 Bacteria 633
122 Ga0157376_10705381 3300014969 Unclassified 1014
123 Ga0209673_1054529 3300025273 Bacteria 1035
124 Ga0209051_1000055 3300025303 Bacteria 277194
125 Ga0209257_1000101 3300025304 Bacteria 251553
126 Ga0207656_10006015 3300025321 Bacteria 4339
127 Ga0207680_10000249 3300025903 Bacteria 25802
128 Ga0207680_10856869 3300025903 Bacteria 651
129 Ga0207645_10621576 3300025907 Unclassified 734
130 Ga0207705_10103747 3300025909 Bacteria 2094
131 Ga0207684_10558632 3300025910 Unclassified 979
132 Ga0207707_10127146 3300025912 Bacteria 2229
133 Ga0207671_10744382 3300025914 Bacteria 779
134 Ga0207662_10184910 3300025918 Unclassified 1342
135 Ga0207657_10006186 3300025919 Bacteria 12444
136 Ga0207649_10215580 3300025920 Bacteria 1364
137 Ga0207649_11172784 3300025920 Unclassified 607
138 Ga0207652_10798242 3300025921 Bacteria 838
139 Ga0207694_10573082 3300025924 Bacteria 948
140 Ga0207690_10229752 3300025932 Bacteria 1424
141 Ga0207706_10002005 3300025933 Bacteria 19923
142 Ga0207706_10139727 3300025933 Bacteria 2131
143 Ga0207706_10272929 3300025933 Bacteria 1475
144 Ga0207706_10294333 3300025933 Bacteria 1415
145 Ga0207709_10510586 3300025935 Bacteria 939
146 Ga0207665_11052105 3300025939 Bacteria 648
147 Ga0207691_10048415 3300025940 Bacteria 3898
148 Ga0207691_10109378 3300025940 Unclassified 2459
149 Ga0207691_10323005 3300025940 Unclassified 1323
150 Ga0207711_10070439 3300025941 Bacteria 3033
151 Ga0207711_10163183 3300025941 Bacteria 2018
152 Ga0207711_10360770 3300025941 Bacteria 1346
153 Ga0207689_10018181 3300025942 Bacteria 5935
154 Ga0207661_10265194 3300025944 Bacteria 1531
155 Ga0207679_10633204 3300025945 Bacteria 966
156 Ga0207679_11751704 3300025945 Unclassified 568
157 Ga0207667_10097240 3300025949 Bacteria 3039
158 Ga0207651_10014794 3300025960 Bacteria 4517
159 Ga0207651_10297448 3300025960 Bacteria 1341
160 Ga0207668_10405479 3300025972 Bacteria 1154
161 Ga0207640_11875538 3300025981 Bacteria 542
162 Ga0207658_10290813 3300025986 Bacteria 1404
163 Ga0207658_10708855 3300025986 Bacteria 910
164 Ga0207703_10093369 3300026035 Bacteria 2534
165 Ga0207703_11422489 3300026035 Bacteria 667
166 Ga0207639_10185923 3300026041 Bacteria 1771
167 Ga0207639_10257865 3300026041 Bacteria 1524
168 Ga0207678_10623203 3300026067 Bacteria 947
169 Ga0207702_10320330 3300026078 Bacteria 1476
170 Ga0207702_10332013 3300026078 Unclassified 1451
171 Ga0207674_10005372 3300026116 Bacteria 15240
172 Ga0207698_10366884 3300026142 Bacteria 1365
173 Ga0207698_11152140 3300026142 Unclassified 789
174 Ga0207428_10066861 3300027907 Bacteria 2831
175 Ga0268266_10015199 3300028379 Bacteria 6610
176 Ga0268266_10226960 3300028379 Bacteria 1719
177 Ga0268265_10039244 3300028380 Bacteria 3489
178 Ga0268264_10180657 3300028381 Bacteria 1916
179 Ga0307515_10017712 3300028794 Bacteria 12951
180 Ga0307512_10156281 3300030522 Bacteria 1349
181 Ga0265316_10267894 3300031344 Bacteria 1251
182 Ga0307513_10093727 3300031456 Bacteria 3051
183 Ga0307509_10837432 3300031507 Unclassified 584
184 Ga0307508_10000466 3300031616 Bacteria 48802
185 Ga0307514_10008972 3300031649 Bacteria 8449
186 Ga0373923_0178299 3300035111 Bacteria 975
187 Ga0373954_0269484 3300035118 Bacteria 839
188 Ga0373957_0069103 3300035120 Bacteria 1379
189 Ga0373957_0247248 3300035120 Bacteria 750
190 Ga0373946_0032918 3300035171 Bacteria 2084
191 Ga0373946_0167136 3300035171 Bacteria 1036
192 Ga0373955_0916624 3300035172 Bacteria 539
193 Ga0373924_0075246 3300035410 Bacteria 1429
194 Ga0373931_0492235 3300035691 Bacteria 790
195 Ga0373935_0339569 3300035692 Bacteria 1069
196 Ga0373933_0179847 3300035724 Bacteria 1349
197 Ga0373937_0034320 3300036401 Bacteria 4615
198 Ga0373937_0527892 3300036401 Bacteria 1121
199 Ga0373925_0033454 3300037068 Bacteria 3788
200 Ga0395905_0054660 3300037471 Bacteria 3736
201 Ga0436362_0084681 3300039453 Unclassified 755
202 Ga0439436_0028006 3300041404 Bacteria 1646
203 Ga0439436_0097751 3300041404 Bacteria 818
204 Ga0451795_0631554 3300041456 Bacteria 915
205 Ga0451802_0703461 3300041460 Unclassified 1951
206 Ga0451841_0364210 3300041498 Unclassified 1052
207 Ga0451847_0763252 3300041503 Unclassified 931
208 Ga0451849_1417320 3300041505 Bacteria 1021
209 Ga0451843_0270990 3300041509 Unclassified 1195
210 Ga0451853_0225061 3300041512 Unclassified 1466
211 Ga0450919_043876 3300042121 Bacteria 521
212 Ga0450909_044576 3300042185 Bacteria 686
213 Ga0439464_0071530 3300042439 Bacteria 1027
214 Ga0451577_0147700 3300042876 Unclassified 2114
215 Ga0453683_0133736 3300044673 Bacteria 1564
216 Ga0453684_0217177 3300044712 Bacteria 2218
217 Ga0451576_0417652 3300045051 Unclassified 1407
218 Ga0451576_0422154 3300045051 Bacteria 1399
219 Ga0466967_0371285 3300045976 Bacteria 1388
220 Ga0495629_0254829 3300046459 Bacteria 1207
221 Ga0495629_0280331 3300046459 Bacteria 1144
222 Ga0495629_0431165 3300046459 Bacteria 894
223 Ga0495580_0090223 3300046472 Bacteria 2134
224 Ga0495580_0192925 3300046472 Bacteria 1405
225 Ga0495582_0792181 3300046473 Bacteria 548
226 Ga0495664_0243891 3300046477 Unclassified 1087
227 Ga0495664_0340679 3300046477 Bacteria 903
228 Ga0495594_0039749 3300046499 Bacteria 2572
229 Ga0495606_0083991 3300046507 Bacteria 1973
230 Ga0495608_0642716 3300046511 Bacteria 634
231 Ga0495630_0627187 3300046517 Bacteria 824
232 Ga0495632_0035943 3300046519 Bacteria 2523
233 Ga0495632_0195948 3300046519 Unclassified 921
234 Ga0495643_0015803 3300046522 Bacteria 4449
235 Ga0495640_0394778 3300046533 Bacteria 850
236 Ga0495635_0171187 3300046663 Bacteria 1477
237 Ga0495599_0154735 3300046678 Bacteria 1419
238 Ga0495623_0155232 3300046679 Bacteria 1350
239 Ga0495623_0601151 3300046679 Bacteria 571
240 Ga0495647_0025235 3300046681 Bacteria 2170
241 Ga0495658_0019408 3300046683 Bacteria 3548
242 Ga0495658_0215967 3300046683 Bacteria 1199
243 Ga0495613_0238736 3300046689 Bacteria 1271
244 Ga0495613_0455893 3300046689 Unclassified 866
245 Ga0495600_0087605 3300046809 Bacteria 2031
246 Ga0495660_0475735 3300046810 Bacteria 537
247 Ga0495674_0498128 3300047319 Bacteria 975
248 Ga0495676_0802945 3300047321 Bacteria 606
249 Ga0495680_0279314 3300047322 Bacteria 1177
250 Ga0495680_0287090 3300047322 Bacteria 1158
251 Ga0495684_0101663 3300047471 Bacteria 2173
252 Ga0495686_0631457 3300047472 Unclassified 552
253 Ga0496110_0853562 3300048913 Unclassified 816
254 Ga0501227_005115 3300049665 Bacteria 2813
255 Ga0501259_059034 3300049688 Bacteria 797
256 Ga0501080_0146856 3300049742 Bacteria 2180
257 Ga0501083_0080680 3300049744 Bacteria 2157
258 nmdc:mga0k408_54683_c1 3300050493 Bacteria 2313
259 nmdc:mga07m45_811817_c1 3300050496 Bacteria 536
260 nmdc:mga05p37_1115615_c1 3300050507 Bacteria 824
261 nmdc:mga05p37_167097_c1 3300050507 Bacteria 2684
262 nmdc:mga09592_35113_c1 3300050508 Bacteria 4195
263 nmdc:mga09592_96070_c1 3300050508 Bacteria 2535
264 nmdc:mga0qj67_60432_c1 3300050509 Bacteria 3008
265 nmdc:mga0qj67_63623_c1 3300050509 Bacteria 2934
266 nmdc:mga06r32_128068_c1 3300050510 Bacteria 2509
267 nmdc:mga06r32_81942_c1 3300050510 Bacteria 3143
268 nmdc:mga08y16_40902_c1 3300050511 Bacteria 4857
269 nmdc:mga0a205_1255945_c1 3300050515 Unclassified 588
270 Ga0495601_0036558 3300053077 Bacteria 3068
271 Ga0495601_0066608 3300053077 Bacteria 2293
272 Ga0495601_0166618 3300053077 Bacteria 1440
273 Ga0495595_0404960 3300053084 Bacteria 691
274 Ga0495619_0065224 3300053085 Bacteria 2429
275 Ga0495619_0070588 3300053085 Bacteria 2336
276 Ga0495619_0179000 3300053085 Bacteria 1467
277 Ga0500651_0005795 3300053093 Bacteria 7074
278 Ga0500658_0099260 3300053134 Unclassified 1269
279 Ga0070672_100046582
280 JGI25407J50210_10053477
281 Ga0055540_1004651
282 Ga0055531_10001914
283 Ga0065715_10010635
284 Ga0070658_10359421
285 Ga0070658_10384327
286 Ga0070676_10485737
287 Ga0070683_100002931
288 Ga0070683_100354268
289 Ga0070690_100711336
290 Ga0070670_101803384
291 Ga0068869_100010694
292 Ga0068869_100484679
293 Ga0068869_100916476
294 Ga0070666_10000266
295 Ga0070666_10333192
296 Ga0070666_10380774
297 Ga0070666_10458159
298 Ga0070680_100974828
299 Ga0070682_100817642
300 Ga0068868_100234461
301 Ga0070660_100033458
302 Ga0070661_101469021
303 Ga0070692_10147559
304 Ga0070669_100797206
305 Ga0070675_100292647
306 Ga0070671_100058696
307 Ga0070671_100630511
308 Ga0070671_101091760
309 Ga0070673_100049291
310 Ga0070673_101373024
311 Ga0070667_100255787
312 Ga0070700_101189937
313 Ga0068867_101273704
314 Ga0070706_100331900
315 Ga0070698_100000005
316 Ga0070684_100043689
317 Ga0068853_100468769
318 Ga0068853_100897440
319 Ga0070672_100005815
320 Ga0070672_100714914
321 Ga0070693_100907888
322 Ga0070665_100013994
323 Ga0068855_101947203
324 Ga0068857_100100328
325 Ga0068857_100205651
326 Ga0068857_101950194
327 Ga0068856_100083408
328 Ga0068852_100885096
329 Ga0068859_100064180
330 Ga0068864_100040622
331 Ga0068864_100663052
332 Ga0068866_10357210
333 Ga0068861_102158017
334 Ga0068851_10209026
335 Ga0068863_100252854
336 Ga0068863_101353284
337 Ga0068858_100072449
338 Ga0068858_100210972
339 Ga0068858_100392772
340 Ga0068860_100006140
341 Ga0068860_100716514
342 Ga0068860_101158156
343 Ga0068860_102597489
344 Ga0081538_10002644
345 Ga0081540_1000158
346 Ga0075365_10025646
347 Ga0075366_10100898
348 Ga0097621_100101511
349 Ga0097621_100630411
350 Ga0068871_100199170
351 Ga0068871_100679473
352 Ga0075428_100323547
353 Ga0075430_100245596
354 Ga0068865_100752656
355 Ga0068865_100917090
356 Ga0068865_101291918
357 Ga0097620_100064181
358 Ga0099795_10227090
359 Ga0105240_10015710
360 Ga0105240_10139800
361 Ga0105245_10215414
362 Ga0114129_10071149
363 Ga0114129_10368969
364 Ga0114129_11162827
365 Ga0114129_11612295
366 Ga0105243_10678124
367 Ga0105241_10498373
368 Ga0105241_10571951
369 Ga0105241_11582056
370 Ga0105248_10033103
371 Ga0105248_10035120
372 Ga0105248_10087042
373 Ga0105239_10970510
374 Ga0105246_10037271
375 Ga0157373_10132220
376 Ga0157371_10372442
377 Ga0157371_10377729
378 Ga0157370_10084510
379 Ga0157369_10006171
380 Ga0157378_10224388
381 Ga0157378_10574957
382 Ga0157378_12606724
383 Ga0163162_10056095
384 Ga0163162_10153610
385 Ga0163162_10241422
386 Ga0163162_10247226
387 Ga0157375_10010036
388 Ga0157375_10110006
389 Ga0157375_10226103
390 Ga0157375_10549016
391 Ga0157375_10563769
392 Ga0163163_10000117
393 Ga0163163_10137895
394 Ga0157380_10174231
395 Ga0182008_10266632
396 Ga0157377_10205807
397 Ga0157379_10065109
398 Ga0157379_10638012
399 Ga0157379_11618578
400 Ga0157376_10705381
401 Ga0209673_1054529
402 Ga0209051_1000055
403 Ga0209257_1000101
404 Ga0207656_10006015
405 Ga0207680_10000249
406 Ga0207680_10856869
407 Ga0207645_10621576
408 Ga0207705_10103747
409 Ga0207684_10558632
410 Ga0207707_10127146
411 Ga0207671_10744382
412 Ga0207662_10184910
413 Ga0207657_10006186
414 Ga0207649_10215580
415 Ga0207649_11172784
416 Ga0207652_10798242
417 Ga0207694_10573082
418 Ga0207690_10229752
419 Ga0207706_10002005
420 Ga0207706_10139727
421 Ga0207706_10272929
422 Ga0207706_10294333
423 Ga0207709_10510586
424 Ga0207665_11052105
425 Ga0207691_10048415
426 Ga0207691_10109378
427 Ga0207691_10323005
428 Ga0207711_10070439
429 Ga0207711_10163183
430 Ga0207711_10360770
431 Ga0207689_10018181
432 Ga0207661_10265194
433 Ga0207679_10633204
434 Ga0207679_11751704
435 Ga0207667_10097240
436 Ga0207651_10014794
437 Ga0207651_10297448
438 Ga0207668_10405479
439 Ga0207640_11875538
440 Ga0207658_10290813
441 Ga0207658_10708855
442 Ga0207703_10093369
443 Ga0207703_11422489
444 Ga0207639_10185923
445 Ga0207639_10257865
446 Ga0207678_10623203
447 Ga0207702_10320330
448 Ga0207702_10332013
449 Ga0207674_10005372
450 Ga0207698_10366884
451 Ga0207698_11152140
452 Ga0207428_10066861
453 Ga0268266_10015199
454 Ga0268266_10226960
455 Ga0268265_10039244
456 Ga0268264_10180657
457 Ga0307515_10017712
458 Ga0307512_10156281
459 Ga0265316_10267894
460 Ga0307513_10093727
461 Ga0307509_10837432
462 Ga0307508_10000466
463 Ga0307514_10008972
464 Ga0373923_0178299
465 Ga0373954_0269484
466 Ga0373957_0069103
467 Ga0373957_0247248
468 Ga0373946_0032918
469 Ga0373946_0167136
470 Ga0373955_0916624
471 Ga0373924_0075246
472 Ga0373931_0492235
473 Ga0373935_0339569
474 Ga0373933_0179847
475 Ga0373937_0034320
476 Ga0373937_0527892
477 Ga0373925_0033454
478 Ga0395905_0054660
479 Ga0436362_0084681
480 Ga0439436_0028006
481 Ga0439436_0097751
482 Ga0451795_0631554
483 Ga0451802_0703461
484 Ga0451841_0364210
485 Ga0451847_0763252
486 Ga0451849_1417320
487 Ga0451843_0270990
488 Ga0451853_0225061
489 Ga0450919_043876
490 Ga0450909_044576
491 Ga0439464_0071530
492 Ga0451577_0147700
493 Ga0453683_0133736
494 Ga0453684_0217177
495 Ga0451576_0417652
496 Ga0451576_0422154
497 Ga0466967_0371285
498 Ga0495629_0254829
499 Ga0495629_0280331
500 Ga0495629_0431165
501 Ga0495580_0090223
502 Ga0495580_0192925
503 Ga0495582_0792181
504 Ga0495664_0243891
505 Ga0495664_0340679
506 Ga0495594_0039749
507 Ga0495606_0083991
508 Ga0495608_0642716
509 Ga0495630_0627187
510 Ga0495632_0035943
511 Ga0495632_0195948
512 Ga0495643_0015803
513 Ga0495640_0394778
514 Ga0495635_0171187
515 Ga0495599_0154735
516 Ga0495623_0155232
517 Ga0495623_0601151
518 Ga0495647_0025235
519 Ga0495658_0019408
520 Ga0495658_0215967
521 Ga0495613_0238736
522 Ga0495613_0455893
523 Ga0495600_0087605
524 Ga0495660_0475735
525 Ga0495674_0498128
526 Ga0495676_0802945
527 Ga0495680_0279314
528 Ga0495680_0287090
529 Ga0495684_0101663
530 Ga0495686_0631457
531 Ga0496110_0853562
532 Ga0501227_005115
533 Ga0501259_059034
534 Ga0501080_0146856
535 Ga0501083_0080680
536 nmdc:mga0k408_54683_c1
537 nmdc:mga07m45_811817_c1
538 nmdc:mga05p37_1115615_c1
539 nmdc:mga05p37_167097_c1
540 nmdc:mga09592_35113_c1
541 nmdc:mga09592_96070_c1
542 nmdc:mga0qj67_60432_c1
543 nmdc:mga0qj67_63623_c1
544 nmdc:mga06r32_128068_c1
545 nmdc:mga06r32_81942_c1
546 nmdc:mga08y16_40902_c1
547 nmdc:mga0a205_1255945_c1
548 Ga0495601_0036558
549 Ga0495601_0066608
550 Ga0495601_0166618
551 Ga0495595_0404960
552 Ga0495619_0065224
553 Ga0495619_0070588
554 Ga0495619_0179000
555 Ga0500651_0005795
556 Ga0500658_0099260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

20

131

0.9

PF13474

SnoaL_3

SnoaL-like domain

20

133

0.89

PF13577

SnoaL_4

SnoaL-like domain

14

133

0.84

PF12680

SnoaL_2

SnoaL-like domain

24

132

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9657 4 128
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9366 4 128
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.8723 6 127
4gb5-assembly1.cif.gz_A crystal structure of kfla4162 protein from kribbella flavida 0.8708 2 128
4leh-assembly1.cif.gz_C crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution 0.8673 5 128
ID Description Score Start End Superfamily
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9637 4 128 3.10.450.50
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9338 4 128 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8849 5 128 3.10.450.50
4gb5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8668 2 128 3.10.450.50
5iepA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8637 8 127 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3N1JJZ9-F1-model_v4 deleted 0.986 6 127
AF-A0A7W8MQ07-F1-model_v4 Uncharacterized protein (TIGR02246 family) 0.9847 6 127
AF-A0A7G8BLG0-F1-model_v4 SgcJ/EcaC family oxidoreductase 0.9791 6 127
AF-M5SYU5-F1-model_v4 Steroid delta5-4-isomerase (EC 5.3.3.1) 0.9744 5 127 GO:0004769
AF-A0A538TIS0-F1-model_v4 SgcJ/EcaC family oxidoreductase 0.9741 6 131

Map