F382256

General Info

Members Datasets Scaffolds Average Seq Length
278 197 556 161

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_101422192|Ga0070679_1014221921
Length 170
Sequence MRPPVSGEGAPTTQPMDCHDLRVAVVAARWHEQVMAGLVDGARRALTDSKVEAPVVVRVPGSFELPVMAKALADKGYEAVVALGVVIRGGTPHFDYVCSAATDGLSRVALDSGTAVGFGLLTCDTEEQALDRAGLEGSSEDKGYEATSAALVTATCLRKIRRGYEDDPRM

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
69 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
95 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
175 2643221576 Nocardioides sp. Root614 Isolate Unclassified
176 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
177 2643221590 Nocardioides sp. Root682 Isolate Unclassified
178 2643221604 Nocardioides sp. Root190 Isolate Unclassified
179 2643221617 Nocardioides sp. Root79 Isolate Unclassified
180 2643221620 Nocardioides sp. Root240 Isolate Unclassified
181 2643221670 Streptomyces sp. Root431 Isolate Unclassified
182 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
183 2738541305 Nocardioides sp. CF167 Isolate Unclassified
184 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
185 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
186 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
187 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
188 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
189 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
190 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
191 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
192 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
193 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
194 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
195 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
196 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
197 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 2.52
Isolates 8.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 5.76
Nodule 0
Rhizoplane 8.99
Rhizosphere 77.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_101422192 3300005530 Bacteria 640
2 Ga0006562J51391_1057236 3300003578 Bacteria 1840
3 Ga0070683_100065461 3300005329 Bacteria 3384
4 Ga0070670_101584805 3300005331 Bacteria 602
5 Ga0070677_10093087 3300005333 Bacteria 1315
6 Ga0070680_100043510 3300005336 Bacteria 3648
7 Ga0070680_100122865 3300005336 Bacteria 2168
8 Ga0070682_100091327 3300005337 Bacteria 1993
9 Ga0070682_100095763 3300005337 Bacteria 1950
10 Ga0070682_100342914 3300005337 Bacteria 1111
11 Ga0070682_100771967 3300005337 Bacteria 778
12 Ga0070682_101102704 3300005337 Bacteria 665
13 Ga0070660_100038602 3300005339 Bacteria 3626
14 Ga0070660_101329693 3300005339 Bacteria 610
15 Ga0070689_100613105 3300005340 Bacteria 944
16 Ga0070687_100069975 3300005343 Bacteria 1881
17 Ga0070692_10209267 3300005345 Bacteria 1147
18 Ga0070692_10372813 3300005345 Bacteria 893
19 Ga0070659_100186061 3300005366 Bacteria 1706
20 Ga0070659_100548138 3300005366 Bacteria 990
21 Ga0070714_100006270 3300005435 Bacteria 9164
22 Ga0070708_100499121 3300005445 Bacteria 1148
23 Ga0070681_10011213 3300005458 Bacteria 8864
24 Ga0070707_100103506 3300005468 Bacteria 2759
25 Ga0070698_100046125 3300005471 Bacteria 4457
26 Ga0070679_100023376 3300005530 Bacteria 6049
27 Ga0070679_100127553 3300005530 Bacteria 2526
28 Ga0070684_100689582 3300005535 Bacteria 952
29 Ga0070684_100712727 3300005535 Bacteria 936
30 Ga0070684_101058362 3300005535 Bacteria 762
31 Ga0070686_100106019 3300005544 Bacteria 1907
32 Ga0070686_100929528 3300005544 Bacteria 709
33 Ga0070693_100496086 3300005547 Bacteria 865
34 Ga0068855_100876675 3300005563 Bacteria 949
35 Ga0070664_101641499 3300005564 Bacteria 609
36 Ga0068854_100685650 3300005578 Bacteria 883
37 Ga0068852_100841081 3300005616 Bacteria 933
38 Ga0068852_101532999 3300005616 Bacteria 689
39 Ga0068861_100491428 3300005719 Bacteria 1108
40 Ga0075365_10006719 3300006038 Bacteria 6362
41 Ga0075365_10066530 3300006038 Bacteria 2418
42 Ga0075365_10317865 3300006038 Bacteria 1096
43 Ga0075365_10334681 3300006038 Bacteria 1067
44 Ga0075368_10000895 3300006042 Bacteria 9244
45 Ga0075363_100013914 3300006048 Bacteria 3917
46 Ga0075367_10396360 3300006178 Bacteria 873
47 Ga0075434_101042239 3300006871 Bacteria 832
48 Ga0105245_10040884 3300009098 Bacteria 4132
49 Ga0105245_10274279 3300009098 Bacteria 1646
50 Ga0105243_10258014 3300009148 Bacteria 1559
51 Ga0105238_10292381 3300009551 Bacteria 1612
52 Ga0163162_11577314 3300013306 Bacteria 749
53 Ga0157372_10122476 3300013307 Bacteria 2989
54 Ga0157372_10162884 3300013307 Bacteria 2578
55 Ga0157372_11611215 3300013307 Bacteria 747
56 Ga0157375_12580834 3300013308 Bacteria 607
57 Ga0163163_10800209 3300014325 Bacteria 1006
58 Ga0182008_10022006 3300014497 Bacteria 3267
59 Ga0163161_10009694 3300017792 Bacteria 6666
60 Ga0206356_11723883 3300020070 Bacteria 1304
61 Ga0206354_10443338 3300020081 Bacteria 800
62 Ga0206354_10459217 3300020081 Bacteria 1147
63 Ga0206354_11370894 3300020081 Bacteria 1165
64 Ga0206353_10896924 3300020082 Bacteria 1046
65 Ga0206353_11782370 3300020082 Bacteria 11269
66 Ga0207426_1006832 3300025302 Bacteria 4878
67 Ga0207426_1007323 3300025302 Bacteria 4636
68 Ga0207682_10051493 3300025893 Bacteria 1705
69 Ga0207705_10000595 3300025909 Bacteria 30272
70 Ga0207707_10081365 3300025912 Bacteria 2827
71 Ga0207660_10030771 3300025917 Bacteria 3690
72 Ga0207660_10190733 3300025917 Bacteria 1596
73 Ga0207660_10926790 3300025917 Bacteria 711
74 Ga0207662_10114761 3300025918 Bacteria 1683
75 Ga0207657_10044082 3300025919 Bacteria 3924
76 Ga0207657_10631578 3300025919 Bacteria 834
77 Ga0207652_10112145 3300025921 Bacteria 2419
78 Ga0207646_10089216 3300025922 Bacteria 2759
79 Ga0207650_10176917 3300025925 Bacteria 1699
80 Ga0207659_10536298 3300025926 Bacteria 993
81 Ga0207687_10889296 3300025927 Bacteria 762
82 Ga0207664_10021533 3300025929 Bacteria 4797
83 Ga0207690_10224564 3300025932 Bacteria 1439
84 Ga0207690_10618237 3300025932 Bacteria 885
85 Ga0207709_10218890 3300025935 Bacteria 1372
86 Ga0207669_10301613 3300025937 Bacteria 1218
87 Ga0207669_10873422 3300025937 Bacteria 750
88 Ga0207661_10131219 3300025944 Bacteria 2146
89 Ga0207712_10300839 3300025961 Bacteria 1316
90 Ga0207668_10028750 3300025972 Bacteria 3639
91 Ga0207658_10057536 3300025986 Bacteria 2890
92 Ga0207708_10112296 3300026075 Bacteria 2117
93 Ga0207675_100221325 3300026118 Bacteria 1824
94 Ga0207683_10046338 3300026121 Bacteria 3804
95 Ga0207698_11084791 3300026142 Bacteria 813
96 Ga0209813_10002982 3300027866 Bacteria 3923
97 Ga0314311_1211499 3300030733 Bacteria 887
98 Ga0316181_1021108 3300030744 Bacteria 981
99 Ga0316181_1247547 3300030744 Bacteria 1466
100 Ga0307408_100052528 3300031548 Bacteria 2940
101 Ga0316576_10007072 3300031727 Bacteria 7030
102 Ga0307405_10781781 3300031731 Bacteria 798
103 Ga0307413_10101525 3300031824 Bacteria 1902
104 Ga0307410_10029525 3300031852 Bacteria 3493
105 Ga0307410_10506858 3300031852 Bacteria 994
106 Ga0307406_10059513 3300031901 Bacteria 2460
107 Ga0307412_10209326 3300031911 Bacteria 1487
108 Ga0307409_100804547 3300031995 Bacteria 948
109 Ga0307409_101156955 3300031995 Bacteria 796
110 Ga0307416_100344745 3300032002 Bacteria 1504
111 Ga0307416_101059762 3300032002 Bacteria 915
112 Ga0307416_102452122 3300032002 Bacteria 621
113 Ga0307414_11251447 3300032004 Bacteria 688
114 Ga0307411_10187529 3300032005 Bacteria 1576
115 Ga0307415_100432117 3300032126 Bacteria 1133
116 Ga0307415_101595764 3300032126 Bacteria 627
117 Ga0316583_10007156 3300032133 Bacteria 4011
118 Ga0316585_10003075 3300032137 Bacteria 4552
119 Ga0316580_10006437 3300032139 Bacteria 3468
120 Ga0316574_0056780 3300035398 Bacteria 2449
121 Ga0316582_0524119 3300036647 Bacteria 816
122 Ga0316584_0113755 3300036712 Bacteria 2024
123 Ga0395900_0116783 3300037418 Bacteria 2738
124 Ga0395900_0635262 3300037418 Bacteria 1005
125 Ga0395900_0828012 3300037418 Bacteria 852
126 Ga0395898_0096104 3300037466 Bacteria 2846
127 Ga0395898_0686668 3300037466 Bacteria 966
128 Ga0395898_1139836 3300037466 Bacteria 712
129 Ga0316581_0005096 3300037588 Bacteria 3398
130 Ga0436364_0655569 3300037853 Bacteria 1920
131 Ga0395901_0071755 3300038443 Bacteria 3609
132 Ga0395901_1160651 3300038443 Bacteria 740
133 Ga0439461_0015914 3300041410 Bacteria 1446
134 Ga0451793_1561084 3300041452 Bacteria 616
135 Ga0451800_0572345 3300041459 Bacteria 521
136 Ga0451853_1140012 3300041512 Bacteria 614
137 Ga0439431_0031048 3300041997 Bacteria 1326
138 Ga0439448_0107377 3300042005 Bacteria 952
139 Ga0439446_0030592 3300042156 Bacteria 1556
140 Ga0439434_0129064 3300042435 Bacteria 828
141 Ga0451577_0048335 3300042876 Bacteria 3801
142 Ga0466972_0156818 3300044658 Bacteria 1069
143 Ga0466965_0006256 3300044683 Bacteria 5391
144 Ga0466965_0225018 3300044683 Bacteria 1001
145 Ga0466966_0188809 3300044684 Bacteria 1249
146 Ga0466961_0145483 3300044693 Bacteria 1482
147 Ga0466961_0321582 3300044693 Bacteria 943
148 Ga0466963_0085627 3300044694 Bacteria 2140
149 Ga0466970_0006742 3300044765 Bacteria 5746
150 Ga0466970_0038191 3300044765 Bacteria 2546
151 Ga0466970_0252182 3300044765 Bacteria 989
152 Ga0466970_0390881 3300044765 Bacteria 793
153 Ga0466957_0076091 3300044842 Bacteria 2084
154 Ga0466957_0266342 3300044842 Bacteria 1143
155 Ga0466960_0008085 3300044901 Bacteria 4297
156 Ga0466960_0105064 3300044901 Bacteria 1459
157 Ga0466960_0128819 3300044901 Bacteria 1333
158 Ga0466959_0124039 3300045049 Bacteria 1834
159 Ga0466959_0162189 3300045049 Bacteria 1571
160 Ga0466967_0001031 3300045976 Bacteria 15281
161 Ga0466967_0106813 3300045976 Bacteria 2567
162 Ga0466967_0248627 3300045976 Bacteria 1698
163 Ga0466967_0360784 3300045976 Bacteria 1408
164 Ga0466967_0554560 3300045976 Bacteria 1131
165 Ga0495651_0011738 3300046462 Bacteria 6731
166 Ga0495664_0129068 3300046477 Bacteria 1530
167 Ga0495628_0010676 3300046516 Bacteria 7779
168 Ga0495652_0004317 3300046529 Bacteria 13624
169 Ga0495645_0018853 3300046543 Bacteria 4963
170 Ga0495635_0698185 3300046663 Bacteria 658
171 Ga0495646_0492724 3300046680 Bacteria 630
172 Ga0495600_0021668 3300046809 Bacteria 4119
173 Ga0495604_0015559 3300047317 Bacteria 6073
174 Ga0495636_0051899 3300047318 Bacteria 1719
175 Ga0495674_0844222 3300047319 Bacteria 710
176 Ga0496100_0027332 3300048903 Bacteria 3509
177 Ga0496101_0241422 3300048904 Bacteria 1406
178 Ga0496102_0190284 3300048905 Bacteria 1933
179 Ga0496102_0219658 3300048905 Bacteria 1791
180 Ga0496103_0163860 3300048906 Bacteria 1426
181 Ga0496104_0781863 3300048907 Bacteria 861
182 Ga0496105_0229698 3300048908 Bacteria 1508
183 Ga0496106_0063514 3300048909 Bacteria 2806
184 Ga0496106_0296535 3300048909 Bacteria 1296
185 Ga0496107_0034509 3300048910 Bacteria 3624
186 Ga0496107_0734534 3300048910 Bacteria 725
187 Ga0496108_0393424 3300048911 Bacteria 1210
188 Ga0496108_0553927 3300048911 Bacteria 1003
189 Ga0496109_0300811 3300048912 Bacteria 1513
190 Ga0496109_0589366 3300048912 Bacteria 1048
191 Ga0496110_0043195 3300048913 Bacteria 3935
192 Ga0496110_0047343 3300048913 Bacteria 3765
193 Ga0496110_0336876 3300048913 Bacteria 1374
194 Ga0496110_0829955 3300048913 Bacteria 829
195 Ga0496111_0103757 3300048914 Bacteria 2091
196 Ga0496112_0598094 3300048915 Bacteria 1035
197 Ga0496113_0638778 3300048916 Bacteria 851
198 Ga0496114_0179586 3300048917 Bacteria 1848
199 Ga0501033_0030399 3300049570 Bacteria 4059
200 Ga0501033_0431006 3300049570 Bacteria 917
201 Ga0501034_0009485 3300049571 Bacteria 10187
202 Ga0501036_0011657 3300049572 Bacteria 7286
203 Ga0501036_0083846 3300049572 Bacteria 2695
204 Ga0501038_0008097 3300049574 Bacteria 9672
205 Ga0501038_0591834 3300049574 Bacteria 840
206 Ga0501039_0028959 3300049575 Bacteria 4265
207 Ga0501039_0262645 3300049575 Bacteria 1357
208 Ga0501039_0945149 3300049575 Bacteria 670
209 Ga0501040_0501578 3300049576 Bacteria 875
210 Ga0501041_0513350 3300049577 Bacteria 763
211 Ga0501041_0651532 3300049577 Bacteria 673
212 Ga0501042_0112292 3300049578 Bacteria 1962
213 Ga0501042_0138130 3300049578 Bacteria 1757
214 Ga0501042_0451863 3300049578 Bacteria 932
215 Ga0501046_1043377 3300049580 Bacteria 566
216 Ga0501047_0023313 3300049581 Bacteria 5943
217 Ga0501048_0593468 3300049582 Bacteria 795
218 Ga0501067_0042204 3300049583 Bacteria 2532
219 Ga0501067_0148759 3300049583 Bacteria 1305
220 Ga0501068_0479358 3300049584 Bacteria 806
221 Ga0501069_0031914 3300049585 Bacteria 2900
222 Ga0501070_0063935 3300049586 Bacteria 3048
223 Ga0501070_0766806 3300049586 Bacteria 759
224 Ga0501070_0996482 3300049586 Bacteria 650
225 Ga0501071_1240658 3300049587 Bacteria 576
226 Ga0501072_0708643 3300049588 Bacteria 791
227 Ga0501073_0048341 3300049589 Bacteria 2986
228 Ga0501074_0388666 3300049590 Bacteria 990
229 Ga0501074_0420584 3300049590 Bacteria 948
230 Ga0501075_0308405 3300049591 Bacteria 1206
231 Ga0501075_0418342 3300049591 Bacteria 1022
232 Ga0501076_0293868 3300049592 Bacteria 1331
233 Ga0501079_0339239 3300049741 Bacteria 1177
234 Ga0501081_0368914 3300049743 Bacteria 1060
235 Ga0501035_0017073 3300049822 Bacteria 6687
236 Ga0501035_0220974 3300049822 Bacteria 1617
237 Ga0501044_0015803 3300049823 Bacteria 8126
238 Ga0501045_0428075 3300049824 Bacteria 984
239 Ga0501045_0712150 3300049824 Bacteria 740
240 nmdc:mga03n38_20570_c1 3300050490 Bacteria 2643
241 nmdc:mga0yw44_15483_c1 3300050492 Bacteria 4088
242 nmdc:mga0yw44_26362_c1 3300050492 Bacteria 3319
243 nmdc:mga0yw44_356519_c1 3300050492 Bacteria 985
244 nmdc:mga0yw44_669147_c1 3300050492 Bacteria 705
245 nmdc:mga04h51_4707_c1 3300050495 Bacteria 3418
246 nmdc:mga0n895_1863088_c1 3300050512 Bacteria 561
247 Ga0495601_0062717 3300053077 Bacteria 2361
248 Ga0495601_0168097 3300053077 Bacteria 1433
249 Ga0495612_0211119 3300053078 Bacteria 858
250 Ga0501084_0246894 3300054114 Bacteria 1507
251 Ga0501082_0287282 3300060353 Bacteria 1432
252 Ga0466962_0491184 3300061719 Bacteria 621
253 Ga0530510_0225893 3300061734 Bacteria 1392
254 Ga0530510_0813035 3300061734 Bacteria 713
255 2547406470 2547132111 Bacteria 8013147
256 2643888790 2643221576 Bacteria 5214352
257 2643946609 2643221587 Bacteria 7586415
258 2643957845 2643221590 Bacteria 5214697
259 2644034341 2643221604 Bacteria 5014917
260 2644098600 2643221617 Bacteria 5139111
261 2644114541 2643221620 Bacteria 5134593
262 2644389037 2643221670 Bacteria 6497041
263 2644434413 2643221677 Bacteria 7584031
264 2738869871 2738541305 Bacteria 4910150
265 2774392877 2773857762 Bacteria 5971770
266 2799183945 2799112218 Bacteria 4315149
267 2812351159 2811994878 Bacteria 5992952
268 2855391123 2855386786 Bacteria 4752232
269 2857484068 2857481737 Bacteria 4761446
270 2891971216 2891968417 Bacteria 5821697
271 2893684652 2893684298 Bacteria 2897960
272 2918502460 2918501144 Bacteria 8668083
273 2984579985 2984576629 Bacteria 4248407
274 2990045812 2990044586 Bacteria 6603797
275 2990260766 2990256926 Bacteria 4252839
276 8008486615 8008485437 Bacteria 7198341
277 8025525684 8025524527 Bacteria 7197316
278 8056449254 8056447290 Bacteria 7680491
279 Ga0070679_101422192
280 Ga0006562J51391_1057236
281 Ga0070683_100065461
282 Ga0070670_101584805
283 Ga0070677_10093087
284 Ga0070680_100043510
285 Ga0070680_100122865
286 Ga0070682_100091327
287 Ga0070682_100095763
288 Ga0070682_100342914
289 Ga0070682_100771967
290 Ga0070682_101102704
291 Ga0070660_100038602
292 Ga0070660_101329693
293 Ga0070689_100613105
294 Ga0070687_100069975
295 Ga0070692_10209267
296 Ga0070692_10372813
297 Ga0070659_100186061
298 Ga0070659_100548138
299 Ga0070714_100006270
300 Ga0070708_100499121
301 Ga0070681_10011213
302 Ga0070707_100103506
303 Ga0070698_100046125
304 Ga0070679_100023376
305 Ga0070679_100127553
306 Ga0070684_100689582
307 Ga0070684_100712727
308 Ga0070684_101058362
309 Ga0070686_100106019
310 Ga0070686_100929528
311 Ga0070693_100496086
312 Ga0068855_100876675
313 Ga0070664_101641499
314 Ga0068854_100685650
315 Ga0068852_100841081
316 Ga0068852_101532999
317 Ga0068861_100491428
318 Ga0075365_10006719
319 Ga0075365_10066530
320 Ga0075365_10317865
321 Ga0075365_10334681
322 Ga0075368_10000895
323 Ga0075363_100013914
324 Ga0075367_10396360
325 Ga0075434_101042239
326 Ga0105245_10040884
327 Ga0105245_10274279
328 Ga0105243_10258014
329 Ga0105238_10292381
330 Ga0163162_11577314
331 Ga0157372_10122476
332 Ga0157372_10162884
333 Ga0157372_11611215
334 Ga0157375_12580834
335 Ga0163163_10800209
336 Ga0182008_10022006
337 Ga0163161_10009694
338 Ga0206356_11723883
339 Ga0206354_10443338
340 Ga0206354_10459217
341 Ga0206354_11370894
342 Ga0206353_10896924
343 Ga0206353_11782370
344 Ga0207426_1006832
345 Ga0207426_1007323
346 Ga0207682_10051493
347 Ga0207705_10000595
348 Ga0207707_10081365
349 Ga0207660_10030771
350 Ga0207660_10190733
351 Ga0207660_10926790
352 Ga0207662_10114761
353 Ga0207657_10044082
354 Ga0207657_10631578
355 Ga0207652_10112145
356 Ga0207646_10089216
357 Ga0207650_10176917
358 Ga0207659_10536298
359 Ga0207687_10889296
360 Ga0207664_10021533
361 Ga0207690_10224564
362 Ga0207690_10618237
363 Ga0207709_10218890
364 Ga0207669_10301613
365 Ga0207669_10873422
366 Ga0207661_10131219
367 Ga0207712_10300839
368 Ga0207668_10028750
369 Ga0207658_10057536
370 Ga0207708_10112296
371 Ga0207675_100221325
372 Ga0207683_10046338
373 Ga0207698_11084791
374 Ga0209813_10002982
375 Ga0314311_1211499
376 Ga0316181_1021108
377 Ga0316181_1247547
378 Ga0307408_100052528
379 Ga0316576_10007072
380 Ga0307405_10781781
381 Ga0307413_10101525
382 Ga0307410_10029525
383 Ga0307410_10506858
384 Ga0307406_10059513
385 Ga0307412_10209326
386 Ga0307409_100804547
387 Ga0307409_101156955
388 Ga0307416_100344745
389 Ga0307416_101059762
390 Ga0307416_102452122
391 Ga0307414_11251447
392 Ga0307411_10187529
393 Ga0307415_100432117
394 Ga0307415_101595764
395 Ga0316583_10007156
396 Ga0316585_10003075
397 Ga0316580_10006437
398 Ga0316574_0056780
399 Ga0316582_0524119
400 Ga0316584_0113755
401 Ga0395900_0116783
402 Ga0395900_0635262
403 Ga0395900_0828012
404 Ga0395898_0096104
405 Ga0395898_0686668
406 Ga0395898_1139836
407 Ga0316581_0005096
408 Ga0436364_0655569
409 Ga0395901_0071755
410 Ga0395901_1160651
411 Ga0439461_0015914
412 Ga0451793_1561084
413 Ga0451800_0572345
414 Ga0451853_1140012
415 Ga0439431_0031048
416 Ga0439448_0107377
417 Ga0439446_0030592
418 Ga0439434_0129064
419 Ga0451577_0048335
420 Ga0466972_0156818
421 Ga0466965_0006256
422 Ga0466965_0225018
423 Ga0466966_0188809
424 Ga0466961_0145483
425 Ga0466961_0321582
426 Ga0466963_0085627
427 Ga0466970_0006742
428 Ga0466970_0038191
429 Ga0466970_0252182
430 Ga0466970_0390881
431 Ga0466957_0076091
432 Ga0466957_0266342
433 Ga0466960_0008085
434 Ga0466960_0105064
435 Ga0466960_0128819
436 Ga0466959_0124039
437 Ga0466959_0162189
438 Ga0466967_0001031
439 Ga0466967_0106813
440 Ga0466967_0248627
441 Ga0466967_0360784
442 Ga0466967_0554560
443 Ga0495651_0011738
444 Ga0495664_0129068
445 Ga0495628_0010676
446 Ga0495652_0004317
447 Ga0495645_0018853
448 Ga0495635_0698185
449 Ga0495646_0492724
450 Ga0495600_0021668
451 Ga0495604_0015559
452 Ga0495636_0051899
453 Ga0495674_0844222
454 Ga0496100_0027332
455 Ga0496101_0241422
456 Ga0496102_0190284
457 Ga0496102_0219658
458 Ga0496103_0163860
459 Ga0496104_0781863
460 Ga0496105_0229698
461 Ga0496106_0063514
462 Ga0496106_0296535
463 Ga0496107_0034509
464 Ga0496107_0734534
465 Ga0496108_0393424
466 Ga0496108_0553927
467 Ga0496109_0300811
468 Ga0496109_0589366
469 Ga0496110_0043195
470 Ga0496110_0047343
471 Ga0496110_0336876
472 Ga0496110_0829955
473 Ga0496111_0103757
474 Ga0496112_0598094
475 Ga0496113_0638778
476 Ga0496114_0179586
477 Ga0501033_0030399
478 Ga0501033_0431006
479 Ga0501034_0009485
480 Ga0501036_0011657
481 Ga0501036_0083846
482 Ga0501038_0008097
483 Ga0501038_0591834
484 Ga0501039_0028959
485 Ga0501039_0262645
486 Ga0501039_0945149
487 Ga0501040_0501578
488 Ga0501041_0513350
489 Ga0501041_0651532
490 Ga0501042_0112292
491 Ga0501042_0138130
492 Ga0501042_0451863
493 Ga0501046_1043377
494 Ga0501047_0023313
495 Ga0501048_0593468
496 Ga0501067_0042204
497 Ga0501067_0148759
498 Ga0501068_0479358
499 Ga0501069_0031914
500 Ga0501070_0063935
501 Ga0501070_0766806
502 Ga0501070_0996482
503 Ga0501071_1240658
504 Ga0501072_0708643
505 Ga0501073_0048341
506 Ga0501074_0388666
507 Ga0501074_0420584
508 Ga0501075_0308405
509 Ga0501075_0418342
510 Ga0501076_0293868
511 Ga0501079_0339239
512 Ga0501081_0368914
513 Ga0501035_0017073
514 Ga0501035_0220974
515 Ga0501044_0015803
516 Ga0501045_0428075
517 Ga0501045_0712150
518 nmdc:mga03n38_20570_c1
519 nmdc:mga0yw44_15483_c1
520 nmdc:mga0yw44_26362_c1
521 nmdc:mga0yw44_356519_c1
522 nmdc:mga0yw44_669147_c1
523 nmdc:mga04h51_4707_c1
524 nmdc:mga0n895_1863088_c1
525 Ga0495601_0062717
526 Ga0495601_0168097
527 Ga0495612_0211119
528 Ga0501084_0246894
529 Ga0501082_0287282
530 Ga0466962_0491184
531 Ga0530510_0225893
532 Ga0530510_0813035
533 2547406470
534 2643888790
535 2643946609
536 2643957845
537 2644034341
538 2644098600
539 2644114541
540 2644389037
541 2644434413
542 2738869871
543 2774392877
544 2799183945
545 2812351159
546 2855391123
547 2857484068
548 2891971216
549 2893684652
550 2918502460
551 2984579985
552 2990045812
553 2990260766
554 8008486615
555 8025525684
556 8056449254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

20

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9725 12 157
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.9658 13 155
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9532 12 157
2a57-assembly1.cif.gz_A structure of 6,7-dimthyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 6-carboxyethyl-7-oxo-8-ribityllumazine 0.9373 12 151
8f25-assembly1.cif.gz_A cryo-em structure of lumazine synthase nanoparticle linked to vp8* antigen 0.9344 10 155
ID Description Score Start End Superfamily
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9548 7 155 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.934 12 152 3.40.50.960
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9308 16 153 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9237 7 155 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9224 10 155 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A5C2FRX6-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9774 17 152 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A399J9J1-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9762 20 150 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A2S8MPP9-F1-model_v4 deleted 0.9756 12 142
AF-A0A7W5T3Z0-F1-model_v4 deleted 0.9745 12 157
AF-A0A0K2RD09-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9745 31 154 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Map