F382221

General Info

Members Datasets Scaffolds Average Seq Length
278 201 556 246

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100525755|Ga0070714_1005257551
Length 276
Sequence MSCRTAIAASAGRCTQAGKCVVPAAGACLSEVMAGFDDPAFYGDRWAAVYDDHFAHVDPGPAVEFLAGLAGDGRVLELAIGTGRVALPLAARGIAVEGIDASAAMAGRLRAKPGGPSIPVAIGDMAQLPPSGPFRLVYLVFNTLFGLLSQERQAECFASVARVLEPGGMFVIECFVPDLTRFDHDQRVQARSVAEDSAIIEVSLHDRVRQRITTQMVTLDGQGMHLRPVAIRYSYPAELDLMAGPAGLRLAERYAGWDRQPFTSASDNHISVYQRT

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
57 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2501939600 Micromonospora sp. L5 Isolate Unclassified
168 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
169 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
170 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
171 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
172 2855683550 Micromonospora sp. RP3T Isolate Unclassified
173 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
174 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
175 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
176 2858882152 Micromonospora noduli MED15 Isolate Nodule
177 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
178 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
179 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
180 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
181 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
182 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
183 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
184 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
185 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
186 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
187 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
188 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
189 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
190 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
191 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
192 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
193 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
194 649633069 Micromonospora sp. L5 Isolate Unclassified
195 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
196 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
197 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
198 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
199 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
200 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
201 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.05
Metatranscriptomes 0.36
Isolates 12.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 1.8
Rhizoplane 4.32
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100525755 3300005435 Bacteria 1130
2 Ga0068868_100468664 3300005338 Bacteria 1098
3 Ga0070669_100272280 3300005353 Bacteria 1354
4 Ga0070709_10048524 3300005434 Bacteria 2650
5 Ga0070713_100229872 3300005436 Bacteria 1685
6 Ga0070710_10162869 3300005437 Bacteria 1384
7 Ga0070710_10163819 3300005437 Bacteria 1381
8 Ga0070711_100026532 3300005439 Bacteria 3796
9 Ga0070711_100541700 3300005439 Bacteria 964
10 Ga0070705_100103502 3300005440 Bacteria 1803
11 Ga0070708_100059058 3300005445 Bacteria 3419
12 Ga0070706_100032948 3300005467 Bacteria 4780
13 Ga0070706_100238575 3300005467 Bacteria 1698
14 Ga0070706_100360143 3300005467 Bacteria 1355
15 Ga0070707_100009464 3300005468 Bacteria 9048
16 Ga0070707_100128650 3300005468 Bacteria 2461
17 Ga0070698_100323366 3300005471 Bacteria 1473
18 Ga0070698_100505476 3300005471 Bacteria 1147
19 Ga0070699_100001037 3300005518 Bacteria 25820
20 Ga0070697_100064883 3300005536 Bacteria 2983
21 Ga0070697_100241435 3300005536 Bacteria 1543
22 Ga0068853_100157620 3300005539 Bacteria 2046
23 Ga0070696_100219827 3300005546 Bacteria 1425
24 Ga0070704_100242205 3300005549 Unclassified 1476
25 Ga0070664_100569349 3300005564 Bacteria 1049
26 Ga0070717_10101651 3300006028 Bacteria 2442
27 Ga0070717_10764058 3300006028 Bacteria 879
28 Ga0075365_10090242 3300006038 Bacteria 2087
29 Ga0075365_10263949 3300006038 Bacteria 1211
30 Ga0075364_10359399 3300006051 Bacteria 993
31 Ga0075432_10009454 3300006058 Bacteria 3320
32 Ga0070716_100049274 3300006173 Bacteria 2385
33 Ga0070716_100072401 3300006173 Bacteria 2029
34 Ga0070712_100052752 3300006175 Bacteria 2837
35 Ga0075428_100002808 3300006844 Bacteria 18955
36 Ga0075428_100036166 3300006844 Bacteria 5441
37 Ga0075428_100366215 3300006844 Bacteria 1546
38 Ga0075430_100003403 3300006846 Bacteria 13292
39 Ga0075431_100004258 3300006847 Bacteria 14009
40 Ga0075431_100030868 3300006847 Bacteria 5520
41 Ga0075433_10036694 3300006852 Bacteria 4224
42 Ga0075433_10379339 3300006852 Unclassified 1248
43 Ga0075434_100021543 3300006871 Bacteria 6265
44 Ga0075429_100020129 3300006880 Bacteria 5786
45 Ga0075436_100012599 3300006914 Bacteria 5793
46 Ga0075435_100089765 3300007076 Bacteria 2534
47 Ga0114129_10005355 3300009147 Bacteria 18110
48 Ga0114129_10009722 3300009147 Bacteria 13721
49 Ga0114129_10105472 3300009147 Bacteria 3895
50 Ga0105242_10043996 3300009176 Bacteria 3614
51 Ga0163163_11251427 3300014325 Bacteria 804
52 Ga0207692_10084850 3300025898 Bacteria 1703
53 Ga0207692_10132109 3300025898 Bacteria 1411
54 Ga0207685_10021158 3300025905 Bacteria 2175
55 Ga0207685_10066824 3300025905 Unclassified 1444
56 Ga0207699_10110660 3300025906 Unclassified 1760
57 Ga0207684_10125916 3300025910 Bacteria 2198
58 Ga0207684_10246876 3300025910 Bacteria 1540
59 Ga0207684_10303667 3300025910 Bacteria 1376
60 Ga0207684_10401015 3300025910 Bacteria 1179
61 Ga0207684_10406625 3300025910 Bacteria 1170
62 Ga0207693_10068323 3300025915 Bacteria 2781
63 Ga0207693_10087449 3300025915 Bacteria 2442
64 Ga0207693_10166612 3300025915 Bacteria 1734
65 Ga0207663_10099389 3300025916 Bacteria 1950
66 Ga0207646_10011005 3300025922 Bacteria 8787
67 Ga0207646_10062489 3300025922 Bacteria 3324
68 Ga0207646_10149147 3300025922 Bacteria 2109
69 Ga0207681_10283467 3300025923 Bacteria 1305
70 Ga0207700_10362934 3300025928 Bacteria 1263
71 Ga0207700_10410295 3300025928 Archaea 1188
72 Ga0207664_10009809 3300025929 Bacteria 6739
73 Ga0207664_10080641 3300025929 Bacteria 2645
74 Ga0207664_10145475 3300025929 Bacteria 2009
75 Ga0207664_10261183 3300025929 Bacteria 1514
76 Ga0207686_10043111 3300025934 Bacteria 2763
77 Ga0207686_10351382 3300025934 Bacteria 1110
78 Ga0207665_10035578 3300025939 Bacteria 3307
79 Ga0207677_10558805 3300026023 Bacteria 999
80 Ga0207677_10705096 3300026023 Bacteria 896
81 Ga0207639_10585175 3300026041 Bacteria 1028
82 Ga0207428_10005685 3300027907 Bacteria 11588
83 Ga0316575_10093692 3300031665 Bacteria 1218
84 Ga0307413_10220923 3300031824 Bacteria 1384
85 Ga0307416_100154398 3300032002 Bacteria 2111
86 Ga0307415_100073211 3300032126 Bacteria 2416
87 Ga0373934_0038581 3300035086 Bacteria 1882
88 Ga0373944_0006804 3300035089 Bacteria 3046
89 Ga0373923_0017225 3300035111 Bacteria 2760
90 Ga0373936_0001670 3300035113 Bacteria 8139
91 Ga0373945_0002104 3300035116 Bacteria 6205
92 Ga0373953_0025402 3300035117 Bacteria 2263
93 Ga0373943_0005935 3300035170 Bacteria 5479
94 Ga0373946_0002108 3300035171 Bacteria 6979
95 Ga0373955_0004385 3300035172 Bacteria 6243
96 Ga0373955_0016726 3300035172 Bacteria 3615
97 Ga0373924_0072323 3300035410 Bacteria 1456
98 Ga0373935_0016890 3300035692 Bacteria 4419
99 Ga0373935_0325485 3300035692 Bacteria 1091
100 Ga0373927_0068358 3300035695 Bacteria 2298
101 Ga0373933_0104564 3300035724 Bacteria 1760
102 Ga0373933_0342604 3300035724 Bacteria 970
103 Ga0373947_0001139 3300035725 Bacteria 16327
104 Ga0373937_0035845 3300036401 Bacteria 4517
105 Ga0373937_0186128 3300036401 Bacteria 1950
106 Ga0372808_001405 3300036459 Bacteria 2488
107 Ga0373925_0004406 3300037068 Bacteria 10635
108 Ga0373925_0009502 3300037068 Bacteria 7080
109 Ga0373925_0202805 3300037068 Bacteria 1578
110 Ga0395899_0061994 3300037312 Bacteria 2754
111 Ga0395905_0057060 3300037471 Bacteria 3652
112 Ga0395901_0029107 3300038443 Bacteria 5684
113 Ga0242420_020933 3300038996 Bacteria 1167
114 Ga0436363_0804786 3300039450 Bacteria 3749
115 Ga0451807_1896151 3300041486 Bacteria 2336
116 Ga0466972_0147916 3300044658 Bacteria 1105
117 Ga0466960_0144931 3300044901 Bacteria 1264
118 Ga0495641_0049198 3300046461 Bacteria 1931
119 Ga0495651_0002131 3300046462 Bacteria 15309
120 Ga0495653_0014098 3300046463 Bacteria 6516
121 Ga0495582_0135905 3300046473 Bacteria 1391
122 Ga0495664_0005070 3300046477 Bacteria 7220
123 Ga0495594_0017013 3300046499 Bacteria 3838
124 Ga0495608_0048114 3300046511 Bacteria 2834
125 Ga0495608_0225181 3300046511 Bacteria 1175
126 Ga0495618_0030458 3300046514 Bacteria 3370
127 Ga0495628_0227340 3300046516 Bacteria 1399
128 Ga0495630_0050639 3300046517 Bacteria 3108
129 Ga0495652_0322046 3300046529 Bacteria 1116
130 Ga0495665_0024673 3300046531 Bacteria 3230
131 Ga0495640_0020873 3300046533 Bacteria 4814
132 Ga0495587_0307239 3300046536 Bacteria 886
133 Ga0495645_0013658 3300046543 Bacteria 5753
134 Ga0495645_0099070 3300046543 Bacteria 2074
135 Ga0495667_0005354 3300046559 Bacteria 8673
136 Ga0495667_0345434 3300046559 Bacteria 940
137 Ga0495635_0003433 3300046663 Bacteria 10961
138 Ga0495588_0301997 3300046674 Bacteria 843
139 Ga0495657_0379093 3300046675 Bacteria 834
140 Ga0495646_0097707 3300046680 Bacteria 1687
141 Ga0495646_0254756 3300046680 Bacteria 939
142 Ga0495647_0023071 3300046681 Bacteria 2254
143 Ga0495613_0269090 3300046689 Bacteria 1186
144 Ga0495624_0058467 3300046690 Bacteria 2421
145 Ga0495600_0119625 3300046809 Bacteria 1713
146 Ga0495600_0225180 3300046809 Bacteria 1199
147 Ga0495674_0016290 3300047319 Bacteria 6933
148 Ga0495676_0009353 3300047321 Bacteria 8933
149 Ga0495680_0004675 3300047322 Bacteria 13045
150 Ga0495680_0008342 3300047322 Bacteria 9422
151 Ga0495680_0041291 3300047322 Bacteria 3670
152 Ga0495675_0027848 3300047444 Bacteria 3602
153 Ga0495684_0004787 3300047471 Bacteria 10566
154 Ga0495684_0111284 3300047471 Bacteria 2066
155 Ga0495684_0172439 3300047471 Bacteria 1608
156 Ga0495593_0014207 3300047673 Bacteria 4529
157 Ga0495602_0093306 3300048088 Bacteria 2491
158 Ga0495602_0112486 3300048088 Bacteria 2209
159 Ga0496102_0473784 3300048905 Bacteria 1173
160 Ga0496104_0047333 3300048907 Bacteria 4053
161 Ga0496108_0036768 3300048911 Bacteria 4075
162 Ga0496108_0183391 3300048911 Bacteria 1813
163 Ga0496109_0029757 3300048912 Bacteria 4893
164 Ga0496109_0166166 3300048912 Bacteria 2069
165 Ga0496110_0296560 3300048913 Unclassified 1473
166 Ga0496110_0434789 3300048913 Bacteria 1196
167 Ga0496112_0096921 3300048915 Bacteria 2920
168 Ga0496114_0049492 3300048917 Bacteria 3497
169 Ga0496114_0077230 3300048917 Bacteria 2807
170 Ga0496126_0080080 3300048929 Bacteria 2891
171 Ga0501031_0000336 3300049568 Bacteria 27217
172 Ga0501031_0004188 3300049568 Bacteria 9317
173 Ga0501031_0053067 3300049568 Bacteria 2641
174 Ga0501032_0002775 3300049569 Bacteria 13640
175 Ga0501033_0000239 3300049570 Bacteria 52812
176 Ga0501034_0022352 3300049571 Bacteria 6445
177 Ga0501036_0000107 3300049572 Bacteria 51071
178 Ga0501036_0102026 3300049572 Bacteria 2427
179 Ga0501037_0027461 3300049573 Bacteria 4204
180 Ga0501038_0034623 3300049574 Bacteria 4439
181 Ga0501039_0001687 3300049575 Bacteria 16278
182 Ga0501039_0011887 3300049575 Bacteria 6634
183 Ga0501040_0001117 3300049576 Bacteria 16995
184 Ga0501040_0002117 3300049576 Bacteria 12798
185 Ga0501041_0000011 3300049577 Bacteria 58729
186 Ga0501041_0029220 3300049577 Bacteria 3325
187 Ga0501042_0000956 3300049578 Bacteria 16278
188 Ga0501042_0038198 3300049578 Bacteria 3409
189 Ga0501043_0000477 3300049579 Bacteria 35754
190 Ga0501046_0001077 3300049580 Bacteria 26750
191 Ga0501046_0133291 3300049580 Bacteria 1883
192 Ga0501047_0000743 3300049581 Bacteria 33980
193 Ga0501048_0000339 3300049582 Bacteria 32273
194 Ga0501048_0029063 3300049582 Bacteria 4012
195 Ga0501068_0000241 3300049584 Bacteria 26764
196 Ga0501068_0035718 3300049584 Bacteria 2968
197 Ga0501069_0001803 3300049585 Bacteria 10711
198 Ga0501069_0402534 3300049585 Bacteria 810
199 Ga0501070_0002434 3300049586 Bacteria 16324
200 Ga0501070_0134079 3300049586 Bacteria 2045
201 Ga0501071_0000208 3300049587 Bacteria 26807
202 Ga0501071_0044887 3300049587 Bacteria 3171
203 Ga0501072_0000561 3300049588 Bacteria 26764
204 Ga0501072_0031010 3300049588 Bacteria 4182
205 Ga0501072_0599184 3300049588 Bacteria 869
206 Ga0501073_0015822 3300049589 Bacteria 5465
207 Ga0501074_0000158 3300049590 Bacteria 35682
208 Ga0501075_0026213 3300049591 Bacteria 4288
209 Ga0501076_0002150 3300049592 Bacteria 13521
210 Ga0501076_0027170 3300049592 Bacteria 4439
211 Ga0501077_0000371 3300049593 Bacteria 26807
212 Ga0501079_0000053 3300049741 Bacteria 51071
213 Ga0501079_0003860 3300049741 Bacteria 11059
214 Ga0501080_0000136 3300049742 Bacteria 52047
215 Ga0501081_0027257 3300049743 Bacteria 3853
216 Ga0501081_0076898 3300049743 Bacteria 2331
217 Ga0501083_0000234 3300049744 Bacteria 35676
218 Ga0501083_0104319 3300049744 Bacteria 1868
219 Ga0501035_0002443 3300049822 Bacteria 18151
220 Ga0501044_0024132 3300049823 Bacteria 6459
221 Ga0501045_0000035 3300049824 Bacteria 58729
222 Ga0501045_0099560 3300049824 Bacteria 2151
223 nmdc:mga00v17_318153_c1 3300050491 Bacteria 1011
224 nmdc:mga0yw44_148964_c1 3300050492 Bacteria 1525
225 nmdc:mga05p37_28657_c1 3300050507 Bacteria 6793
226 nmdc:mga05p37_2871_c1 3300050507 Bacteria 19998
227 nmdc:mga09592_29067_c1 3300050508 Bacteria 4597
228 nmdc:mga0qj67_7486_c1 3300050509 Bacteria 8063
229 nmdc:mga06r32_111844_c1 3300050510 Bacteria 2688
230 nmdc:mga06r32_46642_c1 3300050510 Bacteria 4135
231 nmdc:mga08y16_407035_c1 3300050511 Bacteria 1392
232 nmdc:mga0n895_3167_c1 3300050512 Bacteria 13149
233 nmdc:mga0rr50_4008_c1 3300050513 Bacteria 8588
234 nmdc:mga08x19_44969_c1 3300050514 Bacteria 2821
235 nmdc:mga0a205_10416_c1 3300050515 Bacteria 8543
236 Ga0495601_0365419 3300053077 Bacteria 937
237 Ga0500583_0026560 3300053092 Bacteria 2489
238 Ga0501084_0000336 3300054114 Bacteria 35754
239 Ga0501084_0046437 3300054114 Bacteria 3638
240 Ga0501082_0035279 3300060353 Bacteria 4311
241 Ga0501082_0136115 3300060353 Bacteria 2131
242 Ga0530510_0000445 3300061734 Bacteria 26717
243 Ga0530510_0087784 3300061734 Bacteria 2266
244 2501945736 2501939600 Bacteria 6907073
245 2768643898 2767802112 Bacteria 6465194
246 2831940300 2831935698 Bacteria 5963223
247 2855674699 2855670206 Bacteria 7120389
248 2855680155 2855676851 Bacteria 7063653
249 2855685994 2855683550 Bacteria 7134265
250 2856858704 2856858025 Bacteria 7255264
251 2857289264 2857288857 Bacteria 7189066
252 2858854791 2858848962 Bacteria 6963058
253 2858887339 2858882152 Bacteria 7230291
254 2858890239 2858888857 Bacteria 7060307
255 2858902202 2858895516 Bacteria 7378898
256 2862707169 2862705112 Bacteria 6563286
257 2867352325 2867346516 Bacteria 7608576
258 2867512144 2867507094 Bacteria 6506033
259 2869050019 2869048445 Bacteria 6875584
260 2869066410 2869061728 Bacteria 7112407
261 2869070453 2869068681 Bacteria 7205615
262 2873318755 2873314349 Bacteria 8512634
263 2880495424 2880489317 Bacteria 7096270
264 2880496945 2880495981 Bacteria 7340502
265 2904437723 2904434214 Bacteria 6230908
266 2929225544 2929219909 Bacteria 6984360
267 2929231473 2929226422 Bacteria 7248583
268 2990047858 2990044586 Bacteria 6603797
269 2995468924 2995463766 Bacteria 8577691
270 3006427768 3006425503 Bacteria 6491253
271 649813114 649633069 Bacteria 6962533
272 8003831852 8003830390 Bacteria 6541657
273 8003872316 8003870546 Bacteria 7396674
274 8008490998 8008485437 Bacteria 7198341
275 8025530328 8025524527 Bacteria 7197316
276 8054708423 8054704163 Bacteria 7247792
277 8054734520 8054727385 Bacteria 7558670
278 8054740583 8054734606 Bacteria 6947278
279 Ga0070714_100525755
280 Ga0068868_100468664
281 Ga0070669_100272280
282 Ga0070709_10048524
283 Ga0070713_100229872
284 Ga0070710_10162869
285 Ga0070710_10163819
286 Ga0070711_100026532
287 Ga0070711_100541700
288 Ga0070705_100103502
289 Ga0070708_100059058
290 Ga0070706_100032948
291 Ga0070706_100238575
292 Ga0070706_100360143
293 Ga0070707_100009464
294 Ga0070707_100128650
295 Ga0070698_100323366
296 Ga0070698_100505476
297 Ga0070699_100001037
298 Ga0070697_100064883
299 Ga0070697_100241435
300 Ga0068853_100157620
301 Ga0070696_100219827
302 Ga0070704_100242205
303 Ga0070664_100569349
304 Ga0070717_10101651
305 Ga0070717_10764058
306 Ga0075365_10090242
307 Ga0075365_10263949
308 Ga0075364_10359399
309 Ga0075432_10009454
310 Ga0070716_100049274
311 Ga0070716_100072401
312 Ga0070712_100052752
313 Ga0075428_100002808
314 Ga0075428_100036166
315 Ga0075428_100366215
316 Ga0075430_100003403
317 Ga0075431_100004258
318 Ga0075431_100030868
319 Ga0075433_10036694
320 Ga0075433_10379339
321 Ga0075434_100021543
322 Ga0075429_100020129
323 Ga0075436_100012599
324 Ga0075435_100089765
325 Ga0114129_10005355
326 Ga0114129_10009722
327 Ga0114129_10105472
328 Ga0105242_10043996
329 Ga0163163_11251427
330 Ga0207692_10084850
331 Ga0207692_10132109
332 Ga0207685_10021158
333 Ga0207685_10066824
334 Ga0207699_10110660
335 Ga0207684_10125916
336 Ga0207684_10246876
337 Ga0207684_10303667
338 Ga0207684_10401015
339 Ga0207684_10406625
340 Ga0207693_10068323
341 Ga0207693_10087449
342 Ga0207693_10166612
343 Ga0207663_10099389
344 Ga0207646_10011005
345 Ga0207646_10062489
346 Ga0207646_10149147
347 Ga0207681_10283467
348 Ga0207700_10362934
349 Ga0207700_10410295
350 Ga0207664_10009809
351 Ga0207664_10080641
352 Ga0207664_10145475
353 Ga0207664_10261183
354 Ga0207686_10043111
355 Ga0207686_10351382
356 Ga0207665_10035578
357 Ga0207677_10558805
358 Ga0207677_10705096
359 Ga0207639_10585175
360 Ga0207428_10005685
361 Ga0316575_10093692
362 Ga0307413_10220923
363 Ga0307416_100154398
364 Ga0307415_100073211
365 Ga0373934_0038581
366 Ga0373944_0006804
367 Ga0373923_0017225
368 Ga0373936_0001670
369 Ga0373945_0002104
370 Ga0373953_0025402
371 Ga0373943_0005935
372 Ga0373946_0002108
373 Ga0373955_0004385
374 Ga0373955_0016726
375 Ga0373924_0072323
376 Ga0373935_0016890
377 Ga0373935_0325485
378 Ga0373927_0068358
379 Ga0373933_0104564
380 Ga0373933_0342604
381 Ga0373947_0001139
382 Ga0373937_0035845
383 Ga0373937_0186128
384 Ga0372808_001405
385 Ga0373925_0004406
386 Ga0373925_0009502
387 Ga0373925_0202805
388 Ga0395899_0061994
389 Ga0395905_0057060
390 Ga0395901_0029107
391 Ga0242420_020933
392 Ga0436363_0804786
393 Ga0451807_1896151
394 Ga0466972_0147916
395 Ga0466960_0144931
396 Ga0495641_0049198
397 Ga0495651_0002131
398 Ga0495653_0014098
399 Ga0495582_0135905
400 Ga0495664_0005070
401 Ga0495594_0017013
402 Ga0495608_0048114
403 Ga0495608_0225181
404 Ga0495618_0030458
405 Ga0495628_0227340
406 Ga0495630_0050639
407 Ga0495652_0322046
408 Ga0495665_0024673
409 Ga0495640_0020873
410 Ga0495587_0307239
411 Ga0495645_0013658
412 Ga0495645_0099070
413 Ga0495667_0005354
414 Ga0495667_0345434
415 Ga0495635_0003433
416 Ga0495588_0301997
417 Ga0495657_0379093
418 Ga0495646_0097707
419 Ga0495646_0254756
420 Ga0495647_0023071
421 Ga0495613_0269090
422 Ga0495624_0058467
423 Ga0495600_0119625
424 Ga0495600_0225180
425 Ga0495674_0016290
426 Ga0495676_0009353
427 Ga0495680_0004675
428 Ga0495680_0008342
429 Ga0495680_0041291
430 Ga0495675_0027848
431 Ga0495684_0004787
432 Ga0495684_0111284
433 Ga0495684_0172439
434 Ga0495593_0014207
435 Ga0495602_0093306
436 Ga0495602_0112486
437 Ga0496102_0473784
438 Ga0496104_0047333
439 Ga0496108_0036768
440 Ga0496108_0183391
441 Ga0496109_0029757
442 Ga0496109_0166166
443 Ga0496110_0296560
444 Ga0496110_0434789
445 Ga0496112_0096921
446 Ga0496114_0049492
447 Ga0496114_0077230
448 Ga0496126_0080080
449 Ga0501031_0000336
450 Ga0501031_0004188
451 Ga0501031_0053067
452 Ga0501032_0002775
453 Ga0501033_0000239
454 Ga0501034_0022352
455 Ga0501036_0000107
456 Ga0501036_0102026
457 Ga0501037_0027461
458 Ga0501038_0034623
459 Ga0501039_0001687
460 Ga0501039_0011887
461 Ga0501040_0001117
462 Ga0501040_0002117
463 Ga0501041_0000011
464 Ga0501041_0029220
465 Ga0501042_0000956
466 Ga0501042_0038198
467 Ga0501043_0000477
468 Ga0501046_0001077
469 Ga0501046_0133291
470 Ga0501047_0000743
471 Ga0501048_0000339
472 Ga0501048_0029063
473 Ga0501068_0000241
474 Ga0501068_0035718
475 Ga0501069_0001803
476 Ga0501069_0402534
477 Ga0501070_0002434
478 Ga0501070_0134079
479 Ga0501071_0000208
480 Ga0501071_0044887
481 Ga0501072_0000561
482 Ga0501072_0031010
483 Ga0501072_0599184
484 Ga0501073_0015822
485 Ga0501074_0000158
486 Ga0501075_0026213
487 Ga0501076_0002150
488 Ga0501076_0027170
489 Ga0501077_0000371
490 Ga0501079_0000053
491 Ga0501079_0003860
492 Ga0501080_0000136
493 Ga0501081_0027257
494 Ga0501081_0076898
495 Ga0501083_0000234
496 Ga0501083_0104319
497 Ga0501035_0002443
498 Ga0501044_0024132
499 Ga0501045_0000035
500 Ga0501045_0099560
501 nmdc:mga00v17_318153_c1
502 nmdc:mga0yw44_148964_c1
503 nmdc:mga05p37_28657_c1
504 nmdc:mga05p37_2871_c1
505 nmdc:mga09592_29067_c1
506 nmdc:mga0qj67_7486_c1
507 nmdc:mga06r32_111844_c1
508 nmdc:mga06r32_46642_c1
509 nmdc:mga08y16_407035_c1
510 nmdc:mga0n895_3167_c1
511 nmdc:mga0rr50_4008_c1
512 nmdc:mga08x19_44969_c1
513 nmdc:mga0a205_10416_c1
514 Ga0495601_0365419
515 Ga0500583_0026560
516 Ga0501084_0000336
517 Ga0501084_0046437
518 Ga0501082_0035279
519 Ga0501082_0136115
520 Ga0530510_0000445
521 Ga0530510_0087784
522 2501945736
523 2768643898
524 2831940300
525 2855674699
526 2855680155
527 2855685994
528 2856858704
529 2857289264
530 2858854791
531 2858887339
532 2858890239
533 2858902202
534 2862707169
535 2867352325
536 2867512144
537 2869050019
538 2869066410
539 2869070453
540 2873318755
541 2880495424
542 2880496945
543 2904437723
544 2929225544
545 2929231473
546 2990047858
547 2995468924
548 3006427768
549 649813114
550 8003831852
551 8003872316
552 8008490998
553 8025530328
554 8054708423
555 8054734520
556 8054740583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

75

168

0.94

PF08241

Methyltransf_11

Methyltransferase domain

76

172

0.9

PF13489

Methyltransf_23

Methyltransferase domain

52

213

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.9443 28 243
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.9402 1 244
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.9328 1 244
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.8962 9 240
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.8633 28 243
ID Description Score Start End Superfamily
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9248 28 245 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9052 13 242 3.40.50.150
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8983 28 245 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8903 13 242 3.40.50.150
4hh4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8842 4 244 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A838I2B6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9801 3 243 GO:0008168
GO:0032259
AF-A0A3D1ZEB2-F1-model_v4 SAM-dependent methyltransferase 0.9763 114 241 GO:0008168
GO:0032259
AF-A0A3S1Q966-F1-model_v4 Class I SAM-dependent methyltransferase 0.9711 72 245
AF-A0A2W6DQG0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9705 57 245 GO:0008757
GO:0032259
AF-A0A4Q8AVH9-F1-model_v4 deleted 0.9663 1 243

Map