F382203

General Info

Members Datasets Scaffolds Average Seq Length
278 190 556 155

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100776154|Ga0068868_1007761542
Length 169
Sequence MRVHDLSPAPGATTSRKRVGRGIGGKGGKTAGRGTKGQHARNTVNRGFEGGQMPLKQRVPKLKGFNNPFRVEYKAINLDTIAELAAIVGGRVDLQALVEHGLARKSDYIKVLARGELTTKVDVHAHAVSKAAEAAITAAGGTVTLVQLPFKAEGKAGRPAVKGNQFANR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 0
Rhizoplane 9.35
Rhizosphere 81.29
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100776154 3300005338 Bacteria 863
2 Ga0070683_100665386 3300005329 Bacteria 997
3 Ga0070683_101574571 3300005329 Bacteria 632
4 Ga0070690_100177050 3300005330 Bacteria 1472
5 Ga0070690_100301249 3300005330 Bacteria 1150
6 Ga0070666_11148725 3300005335 Bacteria 578
7 Ga0070682_100160083 3300005337 Bacteria 1554
8 Ga0068868_100074954 3300005338 Bacteria 2703
9 Ga0068868_100801362 3300005338 Bacteria 850
10 Ga0070660_100563329 3300005339 Bacteria 951
11 Ga0070687_100154993 3300005343 Bacteria 1349
12 Ga0070671_100025705 3300005355 Bacteria 4833
13 Ga0070674_100367472 3300005356 Bacteria 1166
14 Ga0070688_100225428 3300005365 Bacteria 1323
15 Ga0070688_100690109 3300005365 Bacteria 790
16 Ga0070667_101477282 3300005367 Bacteria 638
17 Ga0070700_100182106 3300005441 Bacteria 1463
18 Ga0070708_100054472 3300005445 Bacteria 3552
19 Ga0070678_101436261 3300005456 Bacteria 645
20 Ga0068867_100396047 3300005459 Bacteria 1164
21 Ga0070706_100024686 3300005467 Bacteria 5534
22 Ga0070706_100075943 3300005467 Bacteria 3110
23 Ga0070707_100242339 3300005468 Bacteria 1755
24 Ga0070698_100292654 3300005471 Bacteria 1559
25 Ga0070699_100059059 3300005518 Bacteria 3323
26 Ga0068853_101374233 3300005539 Bacteria 683
27 Ga0070696_100317101 3300005546 Bacteria 1199
28 Ga0068855_100299319 3300005563 Bacteria 1782
29 Ga0068852_100608089 3300005616 Bacteria 1098
30 Ga0068859_100763226 3300005617 Bacteria 1056
31 Ga0068866_10653147 3300005718 Bacteria 716
32 Ga0068861_100915226 3300005719 Bacteria 832
33 Ga0068863_100923188 3300005841 Bacteria 874
34 Ga0068858_101513897 3300005842 Bacteria 662
35 Ga0068860_100349104 3300005843 Bacteria 1456
36 Ga0068860_101105370 3300005843 Bacteria 812
37 Ga0081455_10865729 3300005937 Bacteria 564
38 Ga0081538_10070400 3300005981 Bacteria 1931
39 Ga0075365_10746324 3300006038 Bacteria 691
40 Ga0075363_100028311 3300006048 Bacteria 2880
41 Ga0075363_100040363 3300006048 Bacteria 2460
42 Ga0075363_100189500 3300006048 Bacteria 1173
43 Ga0075363_100236301 3300006048 Bacteria 1050
44 Ga0075364_10523340 3300006051 Bacteria 811
45 Ga0075362_10127067 3300006177 Bacteria 1210
46 Ga0075367_10384249 3300006178 Bacteria 887
47 Ga0075370_10253124 3300006353 Bacteria 1044
48 Ga0068871_101615574 3300006358 Bacteria 614
49 Ga0075428_100176389 3300006844 Bacteria 2314
50 Ga0075430_100541111 3300006846 Bacteria 960
51 Ga0075431_100115945 3300006847 Bacteria 2765
52 Ga0075431_100116745 3300006847 Bacteria 2754
53 Ga0075433_10002059 3300006852 Bacteria 15203
54 Ga0075434_100004000 3300006871 Bacteria 13201
55 Ga0075434_100378849 3300006871 Bacteria 1436
56 Ga0075429_100035358 3300006880 Bacteria 4345
57 Ga0075429_100842853 3300006880 Unclassified 802
58 Ga0075436_100023445 3300006914 Bacteria 4238
59 Ga0075436_100214344 3300006914 Bacteria 1365
60 Ga0097620_100763290 3300006931 Bacteria 1056
61 Ga0075435_100050728 3300007076 Bacteria 3340
62 Ga0075435_100270986 3300007076 Bacteria 1448
63 Ga0075435_100539699 3300007076 Bacteria 1009
64 Ga0111539_10924467 3300009094 Bacteria 1014
65 Ga0105245_10003133 3300009098 Bacteria 14797
66 Ga0105245_10015735 3300009098 Bacteria 6597
67 Ga0105245_10225190 3300009098 Bacteria 1811
68 Ga0105245_11733717 3300009098 Bacteria 677
69 Ga0105245_12342300 3300009098 Bacteria 588
70 Ga0114129_10045478 3300009147 Bacteria 6171
71 Ga0114129_10160984 3300009147 Bacteria 3066
72 Ga0114129_10525361 3300009147 Bacteria 1542
73 Ga0114129_11267949 3300009147 Unclassified 915
74 Ga0105243_10263004 3300009148 Bacteria 1545
75 Ga0105242_10037504 3300009176 Bacteria 3894
76 Ga0105242_10274703 3300009176 Bacteria 1528
77 Ga0105249_10342305 3300009553 Bacteria 1512
78 Ga0157374_10884192 3300013296 Bacteria 911
79 Ga0157374_11472539 3300013296 Bacteria 704
80 Ga0157378_10606459 3300013297 Bacteria 1106
81 Ga0157375_10188221 3300013308 Bacteria 2218
82 Ga0157375_10549373 3300013308 Bacteria 1317
83 Ga0163163_10720369 3300014325 Bacteria 1061
84 Ga0163163_10726374 3300014325 Bacteria 1057
85 Ga0163163_10785808 3300014325 Bacteria 1015
86 Ga0163163_12599090 3300014325 Bacteria 564
87 Ga0157379_11055131 3300014968 Bacteria 777
88 Ga0157376_11261235 3300014969 Bacteria 768
89 Ga0163161_11296608 3300017792 Bacteria 633
90 Ga0207645_10275666 3300025907 Bacteria 1116
91 Ga0207684_10161879 3300025910 Bacteria 1927
92 Ga0207684_10386540 3300025910 Bacteria 1203
93 Ga0207695_10896590 3300025913 Bacteria 766
94 Ga0207662_10439127 3300025918 Bacteria 891
95 Ga0207646_10133546 3300025922 Bacteria 2234
96 Ga0207646_10362002 3300025922 Bacteria 1310
97 Ga0207646_11211179 3300025922 Bacteria 662
98 Ga0207687_10014503 3300025927 Bacteria 5158
99 Ga0207664_11353390 3300025929 Bacteria 632
100 Ga0207686_10760077 3300025934 Bacteria 774
101 Ga0207709_10250064 3300025935 Bacteria 1294
102 Ga0207670_10342566 3300025936 Bacteria 1182
103 Ga0207669_10262773 3300025937 Bacteria 1292
104 Ga0207712_10030754 3300025961 Bacteria 3611
105 Ga0207677_10484441 3300026023 Bacteria 1066
106 Ga0207703_10578440 3300026035 Bacteria 1061
107 Ga0207703_10728568 3300026035 Bacteria 944
108 Ga0207639_11281552 3300026041 Bacteria 688
109 Ga0207708_10240754 3300026075 Bacteria 1455
110 Ga0207708_10466066 3300026075 Bacteria 1054
111 Ga0207648_10279658 3300026089 Bacteria 1492
112 Ga0207648_11535975 3300026089 Bacteria 626
113 Ga0207675_100691046 3300026118 Bacteria 1029
114 Ga0209813_10070707 3300027866 Bacteria 1134
115 Ga0209974_10225897 3300027876 Bacteria 698
116 Ga0207428_10148448 3300027907 Bacteria 1786
117 Ga0268264_10627692 3300028381 Bacteria 1061
118 Ga0265318_10252267 3300028577 Bacteria 644
119 Ga0265338_10000149 3300028800 Bacteria 127027
120 Ga0265330_10118994 3300031235 Bacteria 1126
121 Ga0265325_10002115 3300031241 Bacteria 13565
122 Ga0265340_10124503 3300031247 Bacteria 1185
123 Ga0265340_10382797 3300031247 Bacteria 621
124 Ga0265339_10006894 3300031249 Bacteria 7405
125 Ga0265331_10133751 3300031250 Bacteria 1130
126 Ga0265316_10181613 3300031344 Bacteria 1566
127 Ga0265316_10883875 3300031344 Bacteria 625
128 Ga0265313_10003941 3300031595 Bacteria 11679
129 Ga0265314_10156240 3300031711 Bacteria 1393
130 Ga0265314_10224662 3300031711 Bacteria 1093
131 Ga0316576_10659590 3300031727 Bacteria 760
132 Ga0307413_10595931 3300031824 Bacteria 904
133 Ga0307416_100362178 3300032002 Bacteria 1473
134 Ga0307411_10155569 3300032005 Bacteria 1705
135 Ga0307411_11534051 3300032005 Bacteria 613
136 Ga0307415_100165718 3300032126 Bacteria 1718
137 Ga0373923_0127841 3300035111 Bacteria 1140
138 Ga0373943_0055876 3300035170 Bacteria 1957
139 Ga0373946_0037793 3300035171 Bacteria 1964
140 Ga0373935_0154382 3300035692 Bacteria 1560
141 Ga0373935_0342046 3300035692 Bacteria 1065
142 Ga0373927_0344453 3300035695 Bacteria 982
143 Ga0373947_0013050 3300035725 Bacteria 4764
144 Ga0373937_0098430 3300036401 Bacteria 2713
145 Ga0373925_0037600 3300037068 Bacteria 3574
146 Ga0373925_0270169 3300037068 Bacteria 1368
147 Ga0436361_0348946 3300039447 Bacteria 1781
148 Ga0436362_0154078 3300039453 Bacteria 1362
149 Ga0451791_0900071 3300041451 Bacteria 1017
150 Ga0451807_0791173 3300041486 Bacteria 994
151 Ga0451849_0880005 3300041505 Bacteria 718
152 Ga0439431_0031261 3300041997 Bacteria 1323
153 Ga0439460_0055187 3300042461 Bacteria 1200
154 Ga0466966_0027215 3300044684 Bacteria 3729
155 Ga0466961_0076947 3300044693 Bacteria 2114
156 Ga0466959_0123574 3300045049 Bacteria 1838
157 Ga0495603_0181632 3300046455 Bacteria 1217
158 Ga0495629_0154283 3300046459 Bacteria 1596
159 Ga0495641_0126180 3300046461 Bacteria 1142
160 Ga0495605_0317625 3300046474 Bacteria 657
161 Ga0495664_0135145 3300046477 Bacteria 1494
162 Ga0495607_0257186 3300046501 Bacteria 838
163 Ga0495583_0165767 3300046506 Bacteria 910
164 Ga0495608_0298759 3300046511 Bacteria 997
165 Ga0495618_0232537 3300046514 Bacteria 1160
166 Ga0495630_0136007 3300046517 Bacteria 1867
167 Ga0495642_0027321 3300046528 Bacteria 2271
168 Ga0495645_0262108 3300046543 Bacteria 1144
169 Ga0495656_0073435 3300046615 Bacteria 1525
170 Ga0495635_0088436 3300046663 Bacteria 2120
171 Ga0495659_0099047 3300046664 Bacteria 1127
172 Ga0495588_0270809 3300046674 Bacteria 895
173 Ga0495647_0078130 3300046681 Bacteria 1337
174 Ga0495658_0226026 3300046683 Bacteria 1173
175 Ga0495658_0268916 3300046683 Bacteria 1074
176 Ga0495624_0028647 3300046690 Bacteria 3638
177 Ga0495674_0129779 3300047319 Bacteria 2124
178 Ga0495672_0003324 3300047320 Bacteria 13880
179 Ga0495680_0185749 3300047322 Bacteria 1498
180 Ga0495614_0114814 3300048089 Bacteria 1184
181 Ga0496102_0258834 3300048905 Bacteria 1641
182 Ga0496102_0867149 3300048905 Bacteria 825
183 Ga0496105_0013984 3300048908 Bacteria 6384
184 Ga0496105_0364235 3300048908 Bacteria 1153
185 Ga0496105_0469123 3300048908 Bacteria 992
186 Ga0496108_0264172 3300048911 Bacteria 1498
187 Ga0496108_0271068 3300048911 Bacteria 1477
188 Ga0496108_0302227 3300048911 Bacteria 1394
189 Ga0496108_0815965 3300048911 Bacteria 804
190 Ga0496109_0021829 3300048912 Bacteria 5666
191 Ga0496109_0599215 3300048912 Bacteria 1038
192 Ga0496109_1091981 3300048912 Bacteria 735
193 Ga0496110_0132870 3300048913 Bacteria 2248
194 Ga0496110_0387975 3300048913 Bacteria 1273
195 Ga0496110_0878461 3300048913 Bacteria 802
196 Ga0496111_0906213 3300048914 Bacteria 635
197 Ga0496111_1147375 3300048914 Bacteria 552
198 Ga0496112_0048788 3300048915 Bacteria 4149
199 Ga0496112_1311303 3300048915 Bacteria 639
200 Ga0496113_0095816 3300048916 Bacteria 2294
201 Ga0496114_0087081 3300048917 Bacteria 2648
202 Ga0496114_0141868 3300048917 Bacteria 2081
203 Ga0496115_0271785 3300048918 Bacteria 1392
204 Ga0496115_0481880 3300048918 Bacteria 999
205 Ga0501031_0311686 3300049568 Bacteria 1020
206 Ga0501031_0437613 3300049568 Bacteria 845
207 Ga0501032_0002622 3300049569 Bacteria 14061
208 Ga0501036_0699996 3300049572 Bacteria 837
209 Ga0501037_0003123 3300049573 Bacteria 12009
210 Ga0501038_0792391 3300049574 Bacteria 705
211 Ga0501040_0248348 3300049576 Bacteria 1269
212 Ga0501040_0750328 3300049576 Bacteria 706
213 Ga0501042_0406058 3300049578 Bacteria 987
214 Ga0501042_0708774 3300049578 Bacteria 732
215 Ga0501048_0143951 3300049582 Bacteria 1686
216 Ga0501068_0005342 3300049584 Bacteria 7020
217 Ga0501068_0159000 3300049584 Bacteria 1424
218 Ga0501068_0301526 3300049584 Bacteria 1026
219 Ga0501068_0378382 3300049584 Bacteria 911
220 Ga0501068_0569086 3300049584 Bacteria 737
221 Ga0501069_0171187 3300049585 Bacteria 1253
222 Ga0501070_0078524 3300049586 Bacteria 2731
223 Ga0501071_0118159 3300049587 Bacteria 1964
224 Ga0501071_0306653 3300049587 Bacteria 1204
225 Ga0501071_1092311 3300049587 Bacteria 616
226 Ga0501073_0163642 3300049589 Bacteria 1541
227 Ga0501073_0194011 3300049589 Bacteria 1405
228 Ga0501075_0268626 3300049591 Bacteria 1300
229 Ga0501076_0359609 3300049592 Bacteria 1196
230 Ga0501076_1110951 3300049592 Bacteria 651
231 Ga0501076_1240755 3300049592 Bacteria 613
232 Ga0501077_0312104 3300049593 Bacteria 1002
233 Ga0501077_0458910 3300049593 Bacteria 816
234 Ga0501080_0007063 3300049742 Bacteria 10140
235 Ga0501080_0362235 3300049742 Bacteria 1308
236 Ga0501080_0611205 3300049742 Bacteria 967
237 Ga0501080_0646293 3300049742 Bacteria 936
238 Ga0501083_0515710 3300049744 Bacteria 778
239 Ga0501044_0005788 3300049823 Bacteria 13687
240 nmdc:mga03683_119199_c1 3300050489 Bacteria 1172
241 nmdc:mga03n38_233991_c1 3300050490 Bacteria 964
242 nmdc:mga03n38_292655_c1 3300050490 Bacteria 872
243 nmdc:mga03n38_8365_c1 3300050490 Bacteria 3711
244 nmdc:mga00v17_424539_c1 3300050491 Bacteria 863
245 nmdc:mga0k408_79776_c1 3300050493 Bacteria 1915
246 nmdc:mga06z11_287261_c1 3300050494 Bacteria 975
247 nmdc:mga06z11_61481_c1 3300050494 Bacteria 1959
248 nmdc:mga06z11_78637_c1 3300050494 Unclassified 1763
249 nmdc:mga06z11_97502_c1 3300050494 Bacteria 1607
250 nmdc:mga07m45_248767_c1 3300050496 Bacteria 1034
251 nmdc:mga05p37_1318725_c1 3300050507 Bacteria 734
252 nmdc:mga05p37_810566_c1 3300050507 Bacteria 1023
253 nmdc:mga05p37_88211_c1 3300050507 Bacteria 3824
254 nmdc:mga09592_621913_c1 3300050508 Unclassified 924
255 nmdc:mga0qj67_239572_c1 3300050509 Bacteria 1472
256 nmdc:mga06r32_22307_c1 3300050510 Bacteria 5852
257 nmdc:mga06r32_532731_c1 3300050510 Unclassified 1150
258 nmdc:mga08y16_1245526_c1 3300050511 Bacteria 713
259 nmdc:mga08y16_325943_c1 3300050511 Bacteria 1580
260 nmdc:mga0n895_1454445_c1 3300050512 Bacteria 653
261 nmdc:mga0n895_526182_c1 3300050512 Bacteria 1190
262 nmdc:mga0rr50_127773_c1 3300050513 Bacteria 2031
263 nmdc:mga0rr50_1745_c1 3300050513 Bacteria 11991
264 nmdc:mga0rr50_814145_c1 3300050513 Bacteria 797
265 nmdc:mga0rr50_848898_c1 3300050513 Bacteria 779
266 nmdc:mga08x19_4128_c1 3300050514 Bacteria 8615
267 nmdc:mga0a205_25778_c1 3300050515 Bacteria 5602
268 Ga0495619_0060809 3300053085 Bacteria 2512
269 Ga0495619_0567176 3300053085 Bacteria 778
270 Ga0500566_0062955 3300053094 Bacteria 2096
271 Ga0500641_0005026 3300053096 Bacteria 4690
272 Ga0500568_0013989 3300053139 Bacteria 3638
273 Ga0500616_0000816 3300053153 Bacteria 35390
274 Ga0501084_0232201 3300054114 Bacteria 1557
275 Ga0501084_0775722 3300054114 Bacteria 808
276 Ga0501082_0282662 3300060353 Bacteria 1444
277 Ga0501082_1098424 3300060353 Bacteria 695
278 Ga0530510_0420373 3300061734 Bacteria 1009
279 Ga0068868_100776154
280 Ga0070683_100665386
281 Ga0070683_101574571
282 Ga0070690_100177050
283 Ga0070690_100301249
284 Ga0070666_11148725
285 Ga0070682_100160083
286 Ga0068868_100074954
287 Ga0068868_100801362
288 Ga0070660_100563329
289 Ga0070687_100154993
290 Ga0070671_100025705
291 Ga0070674_100367472
292 Ga0070688_100225428
293 Ga0070688_100690109
294 Ga0070667_101477282
295 Ga0070700_100182106
296 Ga0070708_100054472
297 Ga0070678_101436261
298 Ga0068867_100396047
299 Ga0070706_100024686
300 Ga0070706_100075943
301 Ga0070707_100242339
302 Ga0070698_100292654
303 Ga0070699_100059059
304 Ga0068853_101374233
305 Ga0070696_100317101
306 Ga0068855_100299319
307 Ga0068852_100608089
308 Ga0068859_100763226
309 Ga0068866_10653147
310 Ga0068861_100915226
311 Ga0068863_100923188
312 Ga0068858_101513897
313 Ga0068860_100349104
314 Ga0068860_101105370
315 Ga0081455_10865729
316 Ga0081538_10070400
317 Ga0075365_10746324
318 Ga0075363_100028311
319 Ga0075363_100040363
320 Ga0075363_100189500
321 Ga0075363_100236301
322 Ga0075364_10523340
323 Ga0075362_10127067
324 Ga0075367_10384249
325 Ga0075370_10253124
326 Ga0068871_101615574
327 Ga0075428_100176389
328 Ga0075430_100541111
329 Ga0075431_100115945
330 Ga0075431_100116745
331 Ga0075433_10002059
332 Ga0075434_100004000
333 Ga0075434_100378849
334 Ga0075429_100035358
335 Ga0075429_100842853
336 Ga0075436_100023445
337 Ga0075436_100214344
338 Ga0097620_100763290
339 Ga0075435_100050728
340 Ga0075435_100270986
341 Ga0075435_100539699
342 Ga0111539_10924467
343 Ga0105245_10003133
344 Ga0105245_10015735
345 Ga0105245_10225190
346 Ga0105245_11733717
347 Ga0105245_12342300
348 Ga0114129_10045478
349 Ga0114129_10160984
350 Ga0114129_10525361
351 Ga0114129_11267949
352 Ga0105243_10263004
353 Ga0105242_10037504
354 Ga0105242_10274703
355 Ga0105249_10342305
356 Ga0157374_10884192
357 Ga0157374_11472539
358 Ga0157378_10606459
359 Ga0157375_10188221
360 Ga0157375_10549373
361 Ga0163163_10720369
362 Ga0163163_10726374
363 Ga0163163_10785808
364 Ga0163163_12599090
365 Ga0157379_11055131
366 Ga0157376_11261235
367 Ga0163161_11296608
368 Ga0207645_10275666
369 Ga0207684_10161879
370 Ga0207684_10386540
371 Ga0207695_10896590
372 Ga0207662_10439127
373 Ga0207646_10133546
374 Ga0207646_10362002
375 Ga0207646_11211179
376 Ga0207687_10014503
377 Ga0207664_11353390
378 Ga0207686_10760077
379 Ga0207709_10250064
380 Ga0207670_10342566
381 Ga0207669_10262773
382 Ga0207712_10030754
383 Ga0207677_10484441
384 Ga0207703_10578440
385 Ga0207703_10728568
386 Ga0207639_11281552
387 Ga0207708_10240754
388 Ga0207708_10466066
389 Ga0207648_10279658
390 Ga0207648_11535975
391 Ga0207675_100691046
392 Ga0209813_10070707
393 Ga0209974_10225897
394 Ga0207428_10148448
395 Ga0268264_10627692
396 Ga0265318_10252267
397 Ga0265338_10000149
398 Ga0265330_10118994
399 Ga0265325_10002115
400 Ga0265340_10124503
401 Ga0265340_10382797
402 Ga0265339_10006894
403 Ga0265331_10133751
404 Ga0265316_10181613
405 Ga0265316_10883875
406 Ga0265313_10003941
407 Ga0265314_10156240
408 Ga0265314_10224662
409 Ga0316576_10659590
410 Ga0307413_10595931
411 Ga0307416_100362178
412 Ga0307411_10155569
413 Ga0307411_11534051
414 Ga0307415_100165718
415 Ga0373923_0127841
416 Ga0373943_0055876
417 Ga0373946_0037793
418 Ga0373935_0154382
419 Ga0373935_0342046
420 Ga0373927_0344453
421 Ga0373947_0013050
422 Ga0373937_0098430
423 Ga0373925_0037600
424 Ga0373925_0270169
425 Ga0436361_0348946
426 Ga0436362_0154078
427 Ga0451791_0900071
428 Ga0451807_0791173
429 Ga0451849_0880005
430 Ga0439431_0031261
431 Ga0439460_0055187
432 Ga0466966_0027215
433 Ga0466961_0076947
434 Ga0466959_0123574
435 Ga0495603_0181632
436 Ga0495629_0154283
437 Ga0495641_0126180
438 Ga0495605_0317625
439 Ga0495664_0135145
440 Ga0495607_0257186
441 Ga0495583_0165767
442 Ga0495608_0298759
443 Ga0495618_0232537
444 Ga0495630_0136007
445 Ga0495642_0027321
446 Ga0495645_0262108
447 Ga0495656_0073435
448 Ga0495635_0088436
449 Ga0495659_0099047
450 Ga0495588_0270809
451 Ga0495647_0078130
452 Ga0495658_0226026
453 Ga0495658_0268916
454 Ga0495624_0028647
455 Ga0495674_0129779
456 Ga0495672_0003324
457 Ga0495680_0185749
458 Ga0495614_0114814
459 Ga0496102_0258834
460 Ga0496102_0867149
461 Ga0496105_0013984
462 Ga0496105_0364235
463 Ga0496105_0469123
464 Ga0496108_0264172
465 Ga0496108_0271068
466 Ga0496108_0302227
467 Ga0496108_0815965
468 Ga0496109_0021829
469 Ga0496109_0599215
470 Ga0496109_1091981
471 Ga0496110_0132870
472 Ga0496110_0387975
473 Ga0496110_0878461
474 Ga0496111_0906213
475 Ga0496111_1147375
476 Ga0496112_0048788
477 Ga0496112_1311303
478 Ga0496113_0095816
479 Ga0496114_0087081
480 Ga0496114_0141868
481 Ga0496115_0271785
482 Ga0496115_0481880
483 Ga0501031_0311686
484 Ga0501031_0437613
485 Ga0501032_0002622
486 Ga0501036_0699996
487 Ga0501037_0003123
488 Ga0501038_0792391
489 Ga0501040_0248348
490 Ga0501040_0750328
491 Ga0501042_0406058
492 Ga0501042_0708774
493 Ga0501048_0143951
494 Ga0501068_0005342
495 Ga0501068_0159000
496 Ga0501068_0301526
497 Ga0501068_0378382
498 Ga0501068_0569086
499 Ga0501069_0171187
500 Ga0501070_0078524
501 Ga0501071_0118159
502 Ga0501071_0306653
503 Ga0501071_1092311
504 Ga0501073_0163642
505 Ga0501073_0194011
506 Ga0501075_0268626
507 Ga0501076_0359609
508 Ga0501076_1110951
509 Ga0501076_1240755
510 Ga0501077_0312104
511 Ga0501077_0458910
512 Ga0501080_0007063
513 Ga0501080_0362235
514 Ga0501080_0611205
515 Ga0501080_0646293
516 Ga0501083_0515710
517 Ga0501044_0005788
518 nmdc:mga03683_119199_c1
519 nmdc:mga03n38_233991_c1
520 nmdc:mga03n38_292655_c1
521 nmdc:mga03n38_8365_c1
522 nmdc:mga00v17_424539_c1
523 nmdc:mga0k408_79776_c1
524 nmdc:mga06z11_287261_c1
525 nmdc:mga06z11_61481_c1
526 nmdc:mga06z11_78637_c1
527 nmdc:mga06z11_97502_c1
528 nmdc:mga07m45_248767_c1
529 nmdc:mga05p37_1318725_c1
530 nmdc:mga05p37_810566_c1
531 nmdc:mga05p37_88211_c1
532 nmdc:mga09592_621913_c1
533 nmdc:mga0qj67_239572_c1
534 nmdc:mga06r32_22307_c1
535 nmdc:mga06r32_532731_c1
536 nmdc:mga08y16_1245526_c1
537 nmdc:mga08y16_325943_c1
538 nmdc:mga0n895_1454445_c1
539 nmdc:mga0n895_526182_c1
540 nmdc:mga0rr50_127773_c1
541 nmdc:mga0rr50_1745_c1
542 nmdc:mga0rr50_814145_c1
543 nmdc:mga0rr50_848898_c1
544 nmdc:mga08x19_4128_c1
545 nmdc:mga0a205_25778_c1
546 Ga0495619_0060809
547 Ga0495619_0567176
548 Ga0500566_0062955
549 Ga0500641_0005026
550 Ga0500568_0013989
551 Ga0500616_0000816
552 Ga0501084_0232201
553 Ga0501084_0775722
554 Ga0501082_0282662
555 Ga0501082_1098424
556 Ga0530510_0420373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

27

144

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o13-assembly1.cif.gz_A crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 a resolution 0.893 104 129
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.8831 106 129
4v6u-assembly1.cif.gz_BP promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.8023 59 130
8hl5-assembly1.cif.gz_L18E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.7882 62 129
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.7768 59 128
ID Description Score Start End Superfamily
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9288 61 127 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9191 51 130 3.100.10.10
af_Q54PP3_103_187_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9186 55 130 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9185 59 130 3.100.10.10
af_Q6UUH5_140_226_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9179 55 130 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A355BGT0-F1-model_v4 50S ribosomal protein L15 0.9722 57 130 GO:0003735
GO:0006412
GO:0022625
AF-A0A4V1UEJ6-F1-model_v4 50S ribosomal protein L15 0.9693 75 130 GO:0003735
GO:0006412
GO:0022625
AF-A0A3C0B4P4-F1-model_v4 50S ribosomal protein L15 0.9643 51 130 GO:0003735
GO:0006412
GO:0022625
AF-A0A3M1DXY8-F1-model_v4 50S ribosomal protein L15 0.9639 75 130 GO:0003735
GO:0006412
GO:0022625
AF-A0A2W0BP79-F1-model_v4 50S ribosomal protein L15 0.9632 75 132 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map