F382072
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 277 | 167 | 554 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300061719|Ga0466962_0040280|Ga0466962_0040280_751_1866 |
| Length | 371 |
| Sequence | VTLRLGSLEVATPVVLAPMAGVTNAAFRRLCAEQGAGLYVCEMITSRGLVEGDETTKRMLVFDDAEQVRSVQLYGTDPTYVAKAVAILCEEYDVRHVDLNFGCPVPKVTRKGGGGALPWKRGLLGRILEGAVAAAAPYDVPVTMKTRKGIDEGHLTYLDAGRIAQEAGVAAIALHGRTVAQAYSGTADWDAIAELKQTVTEIPVLGNGDIWALRMVEETGVDGVVIGRGCLGRPWLFRDLAAAFAGEPVTTLPNLGQVAAMMRRHAELLSEHMGEERGCKEFRKHVTWYLKGFPAGGDLRRTLGLIDSLATLDELLDSLDHSAPFPVSELGAPRGRQGAPRDKVVLPEGWLDDADGSQIHLTEDVSETTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 24 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 25 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 26 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 27 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 28 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 29 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 30 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 31 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 63 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 64 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 65 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 66 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 67 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 68 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 69 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 70 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 71 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 72 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 73 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 74 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 75 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 76 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 77 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 78 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 79 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 80 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 81 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 82 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 83 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 84 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 87 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 88 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 89 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 90 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 91 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 92 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 93 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 96 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 97 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 98 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 99 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 100 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 130 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 131 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 132 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 133 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 134 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 135 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 136 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 142 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 143 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 144 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 147 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 148 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 149 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 150 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 151 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 152 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 153 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 154 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 155 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 156 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 157 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 158 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 159 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 160 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 161 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 162 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 163 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 164 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 165 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 166 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 167 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.7 |
| Metatranscriptomes | 0.72 |
| Isolates | 7.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.72 |
| Bulb | 0 |
| Endosphere | 14.8 |
| Nodule | 0.36 |
| Rhizoplane | 9.75 |
| Rhizosphere | 67.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466962_0040280 | 3300061719 | Bacteria | 2237 |
| 2 | LJQas_1004803 | 3300000549 | Bacteria | 1742 |
| 3 | Ga0070683_100009309 | 3300005329 | Bacteria | 8394 |
| 4 | Ga0070683_100103541 | 3300005329 | Bacteria | 2682 |
| 5 | Ga0070683_100242359 | 3300005329 | Bacteria | 1715 |
| 6 | Ga0070682_100006751 | 3300005337 | Bacteria | 6437 |
| 7 | Ga0070660_100040821 | 3300005339 | Bacteria | 3534 |
| 8 | Ga0070692_10039388 | 3300005345 | Bacteria | 2413 |
| 9 | Ga0070674_100054684 | 3300005356 | Bacteria | 2762 |
| 10 | Ga0070659_100019975 | 3300005366 | Bacteria | 5085 |
| 11 | Ga0070667_100012594 | 3300005367 | Bacteria | 6995 |
| 12 | Ga0070667_100173945 | 3300005367 | Bacteria | 1902 |
| 13 | Ga0070714_100022216 | 3300005435 | Bacteria | 5200 |
| 14 | Ga0070681_10340884 | 3300005458 | Bacteria | 1409 |
| 15 | Ga0070698_100002288 | 3300005471 | Bacteria | 21210 |
| 16 | Ga0070679_100081580 | 3300005530 | Bacteria | 3223 |
| 17 | Ga0070684_100000608 | 3300005535 | Bacteria | 24723 |
| 18 | Ga0070684_100046305 | 3300005535 | Bacteria | 3769 |
| 19 | Ga0070693_100038199 | 3300005547 | Bacteria | 2682 |
| 20 | Ga0070665_100000582 | 3300005548 | Bacteria | 50895 |
| 21 | Ga0068855_100088340 | 3300005563 | Bacteria | 3580 |
| 22 | Ga0068857_100013359 | 3300005577 | Bacteria | 7151 |
| 23 | Ga0068856_100091133 | 3300005614 | Bacteria | 3033 |
| 24 | Ga0068858_100043535 | 3300005842 | Bacteria | 4163 |
| 25 | Ga0068860_100000669 | 3300005843 | Bacteria | 39653 |
| 26 | Ga0068860_100152255 | 3300005843 | Bacteria | 2227 |
| 27 | Ga0081455_10001806 | 3300005937 | Bacteria | 25821 |
| 28 | Ga0075365_10001232 | 3300006038 | Bacteria | 11318 |
| 29 | Ga0075365_10048892 | 3300006038 | Bacteria | 2785 |
| 30 | Ga0075365_10075571 | 3300006038 | Bacteria | 2274 |
| 31 | Ga0075365_10079235 | 3300006038 | Bacteria | 2223 |
| 32 | Ga0075365_10094454 | 3300006038 | Bacteria | 2041 |
| 33 | Ga0075365_10218899 | 3300006038 | Bacteria | 1336 |
| 34 | Ga0075368_10003008 | 3300006042 | Bacteria | 5572 |
| 35 | Ga0075368_10028080 | 3300006042 | Bacteria | 2173 |
| 36 | Ga0075363_100004669 | 3300006048 | Bacteria | 6026 |
| 37 | Ga0075363_100012452 | 3300006048 | Bacteria | 4101 |
| 38 | Ga0075363_100047819 | 3300006048 | Bacteria | 2273 |
| 39 | Ga0075363_100048938 | 3300006048 | Bacteria | 2249 |
| 40 | Ga0075363_100094228 | 3300006048 | Bacteria | 1651 |
| 41 | Ga0075363_100125953 | 3300006048 | Bacteria | 1434 |
| 42 | Ga0075364_10000900 | 3300006051 | Bacteria | 15715 |
| 43 | Ga0075364_10052409 | 3300006051 | Bacteria | 2666 |
| 44 | Ga0075364_10058110 | 3300006051 | Bacteria | 2534 |
| 45 | Ga0075364_10162610 | 3300006051 | Bacteria | 1507 |
| 46 | Ga0075367_10007670 | 3300006178 | Bacteria | 5544 |
| 47 | Ga0075370_10010645 | 3300006353 | Bacteria | 4819 |
| 48 | Ga0075428_100081982 | 3300006844 | Bacteria | 3519 |
| 49 | Ga0075430_100086937 | 3300006846 | Bacteria | 2616 |
| 50 | Ga0075431_100000416 | 3300006847 | Bacteria | 34675 |
| 51 | Ga0068865_100024149 | 3300006881 | Bacteria | 3986 |
| 52 | Ga0105245_10001813 | 3300009098 | Bacteria | 19433 |
| 53 | Ga0105245_10225742 | 3300009098 | Bacteria | 1809 |
| 54 | Ga0114129_10012485 | 3300009147 | Bacteria | 12094 |
| 55 | Ga0105237_10230764 | 3300009545 | Bacteria | 1852 |
| 56 | Ga0105249_10090984 | 3300009553 | Bacteria | 2854 |
| 57 | Ga0105239_10002393 | 3300010375 | Bacteria | 23914 |
| 58 | Ga0105246_10002116 | 3300011119 | Bacteria | 11978 |
| 59 | Ga0157371_10041048 | 3300013102 | Bacteria | 3303 |
| 60 | Ga0163162_10023448 | 3300013306 | Bacteria | 6090 |
| 61 | Ga0157372_10017185 | 3300013307 | Bacteria | 7766 |
| 62 | Ga0157375_10043429 | 3300013308 | Bacteria | 4360 |
| 63 | Ga0157375_10054606 | 3300013308 | Bacteria | 3935 |
| 64 | Ga0163163_10021686 | 3300014325 | Bacteria | 6066 |
| 65 | Ga0157379_10026932 | 3300014968 | Bacteria | 5118 |
| 66 | Ga0163161_10008466 | 3300017792 | Bacteria | 7121 |
| 67 | Ga0206353_10055087 | 3300020082 | Bacteria | 2128 |
| 68 | Ga0206353_10681091 | 3300020082 | Bacteria | 2593 |
| 69 | Ga0207647_10003080 | 3300025904 | Bacteria | 12532 |
| 70 | Ga0207647_10021754 | 3300025904 | Bacteria | 4274 |
| 71 | Ga0207707_10249058 | 3300025912 | Bacteria | 1543 |
| 72 | Ga0207671_10124037 | 3300025914 | Bacteria | 1977 |
| 73 | Ga0207657_10024839 | 3300025919 | Bacteria | 5539 |
| 74 | Ga0207687_10012113 | 3300025927 | Bacteria | 5639 |
| 75 | Ga0207661_10219374 | 3300025944 | Bacteria | 1680 |
| 76 | Ga0207667_10081498 | 3300025949 | Bacteria | 3352 |
| 77 | Ga0207667_10464718 | 3300025949 | Bacteria | 1285 |
| 78 | Ga0207712_10205251 | 3300025961 | Bacteria | 1566 |
| 79 | Ga0207658_10067139 | 3300025986 | Bacteria | 2700 |
| 80 | Ga0207658_10247976 | 3300025986 | Bacteria | 1512 |
| 81 | Ga0207677_10153535 | 3300026023 | Bacteria | 1780 |
| 82 | Ga0207678_10092629 | 3300026067 | Bacteria | 2583 |
| 83 | Ga0207674_10308855 | 3300026116 | Bacteria | 1531 |
| 84 | Ga0207675_100056184 | 3300026118 | Bacteria | 3671 |
| 85 | Ga0207675_100074610 | 3300026118 | Bacteria | 3174 |
| 86 | Ga0268266_10018692 | 3300028379 | Bacteria | 5904 |
| 87 | Ga0268264_10000510 | 3300028381 | Bacteria | 50047 |
| 88 | Ga0307408_100283841 | 3300031548 | Bacteria | 1380 |
| 89 | Ga0307405_10143281 | 3300031731 | Bacteria | 1670 |
| 90 | Ga0307409_100065545 | 3300031995 | Bacteria | 2859 |
| 91 | Ga0307416_100009657 | 3300032002 | Bacteria | 6330 |
| 92 | Ga0307415_100010141 | 3300032126 | Bacteria | 5320 |
| 93 | Ga0307415_100032272 | 3300032126 | Bacteria | 3385 |
| 94 | Ga0307415_100138618 | 3300032126 | Bacteria | 1854 |
| 95 | Ga0395899_0122436 | 3300037312 | Bacteria | 1862 |
| 96 | Ga0395900_0041129 | 3300037418 | Bacteria | 4766 |
| 97 | Ga0395900_0088075 | 3300037418 | Bacteria | 3191 |
| 98 | Ga0395900_0191761 | 3300037418 | Bacteria | 2072 |
| 99 | Ga0395898_0025428 | 3300037466 | Bacteria | 5965 |
| 100 | Ga0395898_0472433 | 3300037466 | Bacteria | 1193 |
| 101 | Ga0395901_0055357 | 3300038443 | Bacteria | 4125 |
| 102 | Ga0451853_0314354 | 3300041512 | Bacteria | 1604 |
| 103 | Ga0466969_0029754 | 3300044656 | Bacteria | 2787 |
| 104 | Ga0466965_0013697 | 3300044683 | Bacteria | 3829 |
| 105 | Ga0466965_0033319 | 3300044683 | Bacteria | 2517 |
| 106 | Ga0466965_0088763 | 3300044683 | Bacteria | 1570 |
| 107 | Ga0466966_0008737 | 3300044684 | Bacteria | 6705 |
| 108 | Ga0466966_0009809 | 3300044684 | Bacteria | 6346 |
| 109 | Ga0466961_0000895 | 3300044693 | Bacteria | 18517 |
| 110 | Ga0466961_0009084 | 3300044693 | Bacteria | 6336 |
| 111 | Ga0466961_0032928 | 3300044693 | Bacteria | 3330 |
| 112 | Ga0466961_0040751 | 3300044693 | Bacteria | 2977 |
| 113 | Ga0466963_0044764 | 3300044694 | Bacteria | 2913 |
| 114 | Ga0466970_0002050 | 3300044765 | Bacteria | 9756 |
| 115 | Ga0466970_0034778 | 3300044765 | Bacteria | 2669 |
| 116 | Ga0466970_0105436 | 3300044765 | Bacteria | 1537 |
| 117 | Ga0466957_0004077 | 3300044842 | Bacteria | 8090 |
| 118 | Ga0466957_0005247 | 3300044842 | Bacteria | 7256 |
| 119 | Ga0466957_0015884 | 3300044842 | Bacteria | 4399 |
| 120 | Ga0466960_0016753 | 3300044901 | Bacteria | 3184 |
| 121 | Ga0466960_0046351 | 3300044901 | Bacteria | 2081 |
| 122 | Ga0466960_0064129 | 3300044901 | Bacteria | 1811 |
| 123 | Ga0466959_0003598 | 3300045049 | Bacteria | 10213 |
| 124 | Ga0451576_0410729 | 3300045051 | Bacteria | 1420 |
| 125 | Ga0466958_0129088 | 3300045836 | Bacteria | 1586 |
| 126 | Ga0466967_0011806 | 3300045976 | Bacteria | 6642 |
| 127 | Ga0466967_0078176 | 3300045976 | Bacteria | 2980 |
| 128 | Ga0466967_0114888 | 3300045976 | Bacteria | 2478 |
| 129 | Ga0495620_0060603 | 3300046515 | Bacteria | 1577 |
| 130 | Ga0495645_0078784 | 3300046543 | Bacteria | 2368 |
| 131 | Ga0496100_0047952 | 3300048903 | Bacteria | 2755 |
| 132 | Ga0496101_0038387 | 3300048904 | Bacteria | 3402 |
| 133 | Ga0496102_0010545 | 3300048905 | Bacteria | 7957 |
| 134 | Ga0496102_0021091 | 3300048905 | Bacteria | 5762 |
| 135 | Ga0496102_0175168 | 3300048905 | Bacteria | 2020 |
| 136 | Ga0496103_0004301 | 3300048906 | Bacteria | 8655 |
| 137 | Ga0496103_0019842 | 3300048906 | Bacteria | 4036 |
| 138 | Ga0496104_0001079 | 3300048907 | Bacteria | 23301 |
| 139 | Ga0496104_0042622 | 3300048907 | Bacteria | 4260 |
| 140 | Ga0496106_0021715 | 3300048909 | Bacteria | 4767 |
| 141 | Ga0496106_0030845 | 3300048909 | Bacteria | 3996 |
| 142 | Ga0496107_0003712 | 3300048910 | Bacteria | 10257 |
| 143 | Ga0496107_0019714 | 3300048910 | Bacteria | 4759 |
| 144 | Ga0496107_0038227 | 3300048910 | Bacteria | 3444 |
| 145 | Ga0496108_0035407 | 3300048911 | Bacteria | 4150 |
| 146 | Ga0496109_0005289 | 3300048912 | Bacteria | 10786 |
| 147 | Ga0496109_0016338 | 3300048912 | Bacteria | 6486 |
| 148 | Ga0496109_0084518 | 3300048912 | Bacteria | 2928 |
| 149 | Ga0496110_0042170 | 3300048913 | Bacteria | 3983 |
| 150 | Ga0496110_0190120 | 3300048913 | Bacteria | 1864 |
| 151 | Ga0496111_0011190 | 3300048914 | Bacteria | 6039 |
| 152 | Ga0496111_0017106 | 3300048914 | Bacteria | 5007 |
| 153 | Ga0496113_0020029 | 3300048916 | Bacteria | 4694 |
| 154 | Ga0496114_0009147 | 3300048917 | Bacteria | 7854 |
| 155 | Ga0496114_0073400 | 3300048917 | Bacteria | 2879 |
| 156 | Ga0496115_0000835 | 3300048918 | Bacteria | 22514 |
| 157 | Ga0496115_0014968 | 3300048918 | Bacteria | 5880 |
| 158 | Ga0501031_0034274 | 3300049568 | Bacteria | 3314 |
| 159 | Ga0501031_0058614 | 3300049568 | Bacteria | 2509 |
| 160 | Ga0501033_0006628 | 3300049570 | Bacteria | 9055 |
| 161 | Ga0501034_0028688 | 3300049571 | Bacteria | 5662 |
| 162 | Ga0501034_0035995 | 3300049571 | Bacteria | 5018 |
| 163 | Ga0501036_0000176 | 3300049572 | Bacteria | 41989 |
| 164 | Ga0501036_0024543 | 3300049572 | Bacteria | 5083 |
| 165 | Ga0501037_0078195 | 3300049573 | Bacteria | 2400 |
| 166 | Ga0501039_0001983 | 3300049575 | Bacteria | 15179 |
| 167 | Ga0501039_0026142 | 3300049575 | Bacteria | 4485 |
| 168 | Ga0501039_0035834 | 3300049575 | Bacteria | 3830 |
| 169 | Ga0501040_0010794 | 3300049576 | Bacteria | 5971 |
| 170 | Ga0501041_0003459 | 3300049577 | Bacteria | 9088 |
| 171 | Ga0501041_0025987 | 3300049577 | Bacteria | 3520 |
| 172 | Ga0501042_0006878 | 3300049578 | Bacteria | 7421 |
| 173 | Ga0501046_0000230 | 3300049580 | Bacteria | 57666 |
| 174 | Ga0501046_0140795 | 3300049580 | Bacteria | 1825 |
| 175 | Ga0501047_0011024 | 3300049581 | Bacteria | 8552 |
| 176 | Ga0501048_0009731 | 3300049582 | Bacteria | 7209 |
| 177 | Ga0501048_0078355 | 3300049582 | Bacteria | 2332 |
| 178 | Ga0501048_0096272 | 3300049582 | Bacteria | 2088 |
| 179 | Ga0501048_0219467 | 3300049582 | Bacteria | 1349 |
| 180 | Ga0501067_0000478 | 3300049583 | Bacteria | 21820 |
| 181 | Ga0501067_0008087 | 3300049583 | Bacteria | 5843 |
| 182 | Ga0501067_0040070 | 3300049583 | Bacteria | 2602 |
| 183 | Ga0501068_0007869 | 3300049584 | Bacteria | 5906 |
| 184 | Ga0501069_0001210 | 3300049585 | Bacteria | 12584 |
| 185 | Ga0501069_0005644 | 3300049585 | Bacteria | 6516 |
| 186 | Ga0501069_0012397 | 3300049585 | Bacteria | 4531 |
| 187 | Ga0501070_0006559 | 3300049586 | Bacteria | 9902 |
| 188 | Ga0501070_0012133 | 3300049586 | Bacteria | 7271 |
| 189 | Ga0501070_0083694 | 3300049586 | Bacteria | 2641 |
| 190 | Ga0501070_0115600 | 3300049586 | Bacteria | 2216 |
| 191 | Ga0501071_0002795 | 3300049587 | Bacteria | 10732 |
| 192 | Ga0501071_0009805 | 3300049587 | Bacteria | 6393 |
| 193 | Ga0501072_0031887 | 3300049588 | Bacteria | 4125 |
| 194 | Ga0501072_0057582 | 3300049588 | Bacteria | 3063 |
| 195 | Ga0501072_0347288 | 3300049588 | Bacteria | 1178 |
| 196 | Ga0501073_0026825 | 3300049589 | Bacteria | 4124 |
| 197 | Ga0501073_0039754 | 3300049589 | Bacteria | 3331 |
| 198 | Ga0501074_0002765 | 3300049590 | Bacteria | 12274 |
| 199 | Ga0501074_0002861 | 3300049590 | Bacteria | 12083 |
| 200 | Ga0501074_0005775 | 3300049590 | Bacteria | 8924 |
| 201 | Ga0501076_0037422 | 3300049592 | Bacteria | 3805 |
| 202 | Ga0501076_0087442 | 3300049592 | Bacteria | 2506 |
| 203 | Ga0501077_0003919 | 3300049593 | Bacteria | 8964 |
| 204 | Ga0501077_0051087 | 3300049593 | Bacteria | 2627 |
| 205 | Ga0501079_0029146 | 3300049741 | Bacteria | 4236 |
| 206 | Ga0501079_0061967 | 3300049741 | Bacteria | 2885 |
| 207 | Ga0501080_0000766 | 3300049742 | Bacteria | 26090 |
| 208 | Ga0501080_0003937 | 3300049742 | Bacteria | 13147 |
| 209 | Ga0501080_0022702 | 3300049742 | Bacteria | 5813 |
| 210 | Ga0501080_0036215 | 3300049742 | Bacteria | 4607 |
| 211 | Ga0501081_0029449 | 3300049743 | Bacteria | 3710 |
| 212 | Ga0501081_0038281 | 3300049743 | Bacteria | 3276 |
| 213 | Ga0501083_0000725 | 3300049744 | Bacteria | 21473 |
| 214 | Ga0501083_0009420 | 3300049744 | Bacteria | 6898 |
| 215 | Ga0501083_0010574 | 3300049744 | Bacteria | 6497 |
| 216 | Ga0501035_0039061 | 3300049822 | Bacteria | 4297 |
| 217 | Ga0501044_0137833 | 3300049823 | Bacteria | 2430 |
| 218 | Ga0501045_0005865 | 3300049824 | Bacteria | 8499 |
| 219 | Ga0501045_0060749 | 3300049824 | Bacteria | 2771 |
| 220 | nmdc:mga03683_9338_c1 | 3300050489 | Bacteria | 3482 |
| 221 | nmdc:mga03n38_3714_c1 | 3300050490 | Bacteria | 4941 |
| 222 | nmdc:mga03n38_6244_c1 | 3300050490 | Bacteria | 4125 |
| 223 | nmdc:mga00v17_16059_c1 | 3300050491 | Bacteria | 4216 |
| 224 | nmdc:mga00v17_1921_c1 | 3300050491 | Bacteria | 10733 |
| 225 | nmdc:mga00v17_22893_c1 | 3300050491 | Bacteria | 3611 |
| 226 | nmdc:mga0yw44_12271_c1 | 3300050492 | Bacteria | 4460 |
| 227 | nmdc:mga0yw44_20182_c1 | 3300050492 | Bacteria | 3693 |
| 228 | nmdc:mga0yw44_217818_c1 | 3300050492 | Bacteria | 1264 |
| 229 | nmdc:mga0yw44_29759_c1 | 3300050492 | Bacteria | 3156 |
| 230 | nmdc:mga0yw44_4698_c1 | 3300050492 | Bacteria | 6315 |
| 231 | nmdc:mga0yw44_62668_c1 | 3300050492 | Bacteria | 2285 |
| 232 | nmdc:mga06z11_18129_c1 | 3300050494 | Bacteria | 3210 |
| 233 | nmdc:mga06z11_34437_c1 | 3300050494 | Bacteria | 2486 |
| 234 | nmdc:mga06z11_79284_c1 | 3300050494 | Bacteria | 1758 |
| 235 | nmdc:mga04h51_5610_c1 | 3300050495 | Bacteria | 3207 |
| 236 | nmdc:mga07m45_35800_c1 | 3300050496 | Bacteria | 2762 |
| 237 | nmdc:mga07m45_57335_c1 | 3300050496 | Bacteria | 2203 |
| 238 | nmdc:mga05p37_33246_c1 | 3300050507 | Bacteria | 6316 |
| 239 | nmdc:mga09592_183997_c1 | 3300050508 | Bacteria | 1808 |
| 240 | nmdc:mga0qj67_20102_c1 | 3300050509 | Bacteria | 5111 |
| 241 | nmdc:mga0qj67_31399_c1 | 3300050509 | Bacteria | 4137 |
| 242 | nmdc:mga06r32_1205_c1 | 3300050510 | Bacteria | 23293 |
| 243 | nmdc:mga06r32_28458_c1 | 3300050510 | Bacteria | 5230 |
| 244 | Ga0495619_0095583 | 3300053085 | Bacteria | 2016 |
| 245 | Ga0500644_0000053 | 3300053088 | Bacteria | 69275 |
| 246 | Ga0500556_0001035 | 3300053104 | Bacteria | 14512 |
| 247 | Ga0500593_000776 | 3300053117 | Bacteria | 11926 |
| 248 | Ga0501084_0001125 | 3300054114 | Bacteria | 20859 |
| 249 | Ga0501084_0017436 | 3300054114 | Bacteria | 5970 |
| 250 | Ga0501084_0035886 | 3300054114 | Bacteria | 4144 |
| 251 | Ga0501084_0072696 | 3300054114 | Bacteria | 2880 |
| 252 | Ga0501082_0016314 | 3300060353 | Bacteria | 6394 |
| 253 | Ga0466962_0006047 | 3300061719 | Bacteria | 5823 |
| 254 | Ga0466962_0023864 | 3300061719 | Bacteria | 2939 |
| 255 | Ga0466962_0043250 | 3300061719 | Bacteria | 2156 |
| 256 | Ga0530510_0031391 | 3300061734 | Bacteria | 3820 |
| 257 | 2643826651 | 2643221561 | Bacteria | 4984412 |
| 258 | 2643892947 | 2643221576 | Bacteria | 5214352 |
| 259 | 2643962708 | 2643221590 | Bacteria | 5214697 |
| 260 | 2644034283 | 2643221604 | Bacteria | 5014917 |
| 261 | 2644090144 | 2643221615 | Bacteria | 5487866 |
| 262 | 2644098674 | 2643221617 | Bacteria | 5139111 |
| 263 | 2644116035 | 2643221620 | Bacteria | 5134593 |
| 264 | 2644230575 | 2643221641 | Bacteria | 4490190 |
| 265 | 2644319988 | 2643221657 | Bacteria | 5490246 |
| 266 | 2644532986 | 2643221696 | Bacteria | 5431823 |
| 267 | 2740167993 | 2739367898 | Bacteria | 4367674 |
| 268 | 2774397141 | 2773857762 | Bacteria | 5971770 |
| 269 | 2809198790 | 2808606439 | Bacteria | 5952208 |
| 270 | 2812333554 | 2811994874 | Bacteria | 5367947 |
| 271 | 2812352640 | 2811994878 | Bacteria | 5992952 |
| 272 | 2855389879 | 2855386786 | Bacteria | 4752232 |
| 273 | 2857484114 | 2857481737 | Bacteria | 4761446 |
| 274 | 2891969814 | 2891968417 | Bacteria | 5821697 |
| 275 | 2984576694 | 2984576629 | Bacteria | 4248407 |
| 276 | 2990258458 | 2990256926 | Bacteria | 4252839 |
| 277 | 8054613362 | 8054609563 | Bacteria | 5170090 |
| 278 | Ga0466962_0040280 | |||
| 279 | LJQas_1004803 | |||
| 280 | Ga0070683_100009309 | |||
| 281 | Ga0070683_100103541 | |||
| 282 | Ga0070683_100242359 | |||
| 283 | Ga0070682_100006751 | |||
| 284 | Ga0070660_100040821 | |||
| 285 | Ga0070692_10039388 | |||
| 286 | Ga0070674_100054684 | |||
| 287 | Ga0070659_100019975 | |||
| 288 | Ga0070667_100012594 | |||
| 289 | Ga0070667_100173945 | |||
| 290 | Ga0070714_100022216 | |||
| 291 | Ga0070681_10340884 | |||
| 292 | Ga0070698_100002288 | |||
| 293 | Ga0070679_100081580 | |||
| 294 | Ga0070684_100000608 | |||
| 295 | Ga0070684_100046305 | |||
| 296 | Ga0070693_100038199 | |||
| 297 | Ga0070665_100000582 | |||
| 298 | Ga0068855_100088340 | |||
| 299 | Ga0068857_100013359 | |||
| 300 | Ga0068856_100091133 | |||
| 301 | Ga0068858_100043535 | |||
| 302 | Ga0068860_100000669 | |||
| 303 | Ga0068860_100152255 | |||
| 304 | Ga0081455_10001806 | |||
| 305 | Ga0075365_10001232 | |||
| 306 | Ga0075365_10048892 | |||
| 307 | Ga0075365_10075571 | |||
| 308 | Ga0075365_10079235 | |||
| 309 | Ga0075365_10094454 | |||
| 310 | Ga0075365_10218899 | |||
| 311 | Ga0075368_10003008 | |||
| 312 | Ga0075368_10028080 | |||
| 313 | Ga0075363_100004669 | |||
| 314 | Ga0075363_100012452 | |||
| 315 | Ga0075363_100047819 | |||
| 316 | Ga0075363_100048938 | |||
| 317 | Ga0075363_100094228 | |||
| 318 | Ga0075363_100125953 | |||
| 319 | Ga0075364_10000900 | |||
| 320 | Ga0075364_10052409 | |||
| 321 | Ga0075364_10058110 | |||
| 322 | Ga0075364_10162610 | |||
| 323 | Ga0075367_10007670 | |||
| 324 | Ga0075370_10010645 | |||
| 325 | Ga0075428_100081982 | |||
| 326 | Ga0075430_100086937 | |||
| 327 | Ga0075431_100000416 | |||
| 328 | Ga0068865_100024149 | |||
| 329 | Ga0105245_10001813 | |||
| 330 | Ga0105245_10225742 | |||
| 331 | Ga0114129_10012485 | |||
| 332 | Ga0105237_10230764 | |||
| 333 | Ga0105249_10090984 | |||
| 334 | Ga0105239_10002393 | |||
| 335 | Ga0105246_10002116 | |||
| 336 | Ga0157371_10041048 | |||
| 337 | Ga0163162_10023448 | |||
| 338 | Ga0157372_10017185 | |||
| 339 | Ga0157375_10043429 | |||
| 340 | Ga0157375_10054606 | |||
| 341 | Ga0163163_10021686 | |||
| 342 | Ga0157379_10026932 | |||
| 343 | Ga0163161_10008466 | |||
| 344 | Ga0206353_10055087 | |||
| 345 | Ga0206353_10681091 | |||
| 346 | Ga0207647_10003080 | |||
| 347 | Ga0207647_10021754 | |||
| 348 | Ga0207707_10249058 | |||
| 349 | Ga0207671_10124037 | |||
| 350 | Ga0207657_10024839 | |||
| 351 | Ga0207687_10012113 | |||
| 352 | Ga0207661_10219374 | |||
| 353 | Ga0207667_10081498 | |||
| 354 | Ga0207667_10464718 | |||
| 355 | Ga0207712_10205251 | |||
| 356 | Ga0207658_10067139 | |||
| 357 | Ga0207658_10247976 | |||
| 358 | Ga0207677_10153535 | |||
| 359 | Ga0207678_10092629 | |||
| 360 | Ga0207674_10308855 | |||
| 361 | Ga0207675_100056184 | |||
| 362 | Ga0207675_100074610 | |||
| 363 | Ga0268266_10018692 | |||
| 364 | Ga0268264_10000510 | |||
| 365 | Ga0307408_100283841 | |||
| 366 | Ga0307405_10143281 | |||
| 367 | Ga0307409_100065545 | |||
| 368 | Ga0307416_100009657 | |||
| 369 | Ga0307415_100010141 | |||
| 370 | Ga0307415_100032272 | |||
| 371 | Ga0307415_100138618 | |||
| 372 | Ga0395899_0122436 | |||
| 373 | Ga0395900_0041129 | |||
| 374 | Ga0395900_0088075 | |||
| 375 | Ga0395900_0191761 | |||
| 376 | Ga0395898_0025428 | |||
| 377 | Ga0395898_0472433 | |||
| 378 | Ga0395901_0055357 | |||
| 379 | Ga0451853_0314354 | |||
| 380 | Ga0466969_0029754 | |||
| 381 | Ga0466965_0013697 | |||
| 382 | Ga0466965_0033319 | |||
| 383 | Ga0466965_0088763 | |||
| 384 | Ga0466966_0008737 | |||
| 385 | Ga0466966_0009809 | |||
| 386 | Ga0466961_0000895 | |||
| 387 | Ga0466961_0009084 | |||
| 388 | Ga0466961_0032928 | |||
| 389 | Ga0466961_0040751 | |||
| 390 | Ga0466963_0044764 | |||
| 391 | Ga0466970_0002050 | |||
| 392 | Ga0466970_0034778 | |||
| 393 | Ga0466970_0105436 | |||
| 394 | Ga0466957_0004077 | |||
| 395 | Ga0466957_0005247 | |||
| 396 | Ga0466957_0015884 | |||
| 397 | Ga0466960_0016753 | |||
| 398 | Ga0466960_0046351 | |||
| 399 | Ga0466960_0064129 | |||
| 400 | Ga0466959_0003598 | |||
| 401 | Ga0451576_0410729 | |||
| 402 | Ga0466958_0129088 | |||
| 403 | Ga0466967_0011806 | |||
| 404 | Ga0466967_0078176 | |||
| 405 | Ga0466967_0114888 | |||
| 406 | Ga0495620_0060603 | |||
| 407 | Ga0495645_0078784 | |||
| 408 | Ga0496100_0047952 | |||
| 409 | Ga0496101_0038387 | |||
| 410 | Ga0496102_0010545 | |||
| 411 | Ga0496102_0021091 | |||
| 412 | Ga0496102_0175168 | |||
| 413 | Ga0496103_0004301 | |||
| 414 | Ga0496103_0019842 | |||
| 415 | Ga0496104_0001079 | |||
| 416 | Ga0496104_0042622 | |||
| 417 | Ga0496106_0021715 | |||
| 418 | Ga0496106_0030845 | |||
| 419 | Ga0496107_0003712 | |||
| 420 | Ga0496107_0019714 | |||
| 421 | Ga0496107_0038227 | |||
| 422 | Ga0496108_0035407 | |||
| 423 | Ga0496109_0005289 | |||
| 424 | Ga0496109_0016338 | |||
| 425 | Ga0496109_0084518 | |||
| 426 | Ga0496110_0042170 | |||
| 427 | Ga0496110_0190120 | |||
| 428 | Ga0496111_0011190 | |||
| 429 | Ga0496111_0017106 | |||
| 430 | Ga0496113_0020029 | |||
| 431 | Ga0496114_0009147 | |||
| 432 | Ga0496114_0073400 | |||
| 433 | Ga0496115_0000835 | |||
| 434 | Ga0496115_0014968 | |||
| 435 | Ga0501031_0034274 | |||
| 436 | Ga0501031_0058614 | |||
| 437 | Ga0501033_0006628 | |||
| 438 | Ga0501034_0028688 | |||
| 439 | Ga0501034_0035995 | |||
| 440 | Ga0501036_0000176 | |||
| 441 | Ga0501036_0024543 | |||
| 442 | Ga0501037_0078195 | |||
| 443 | Ga0501039_0001983 | |||
| 444 | Ga0501039_0026142 | |||
| 445 | Ga0501039_0035834 | |||
| 446 | Ga0501040_0010794 | |||
| 447 | Ga0501041_0003459 | |||
| 448 | Ga0501041_0025987 | |||
| 449 | Ga0501042_0006878 | |||
| 450 | Ga0501046_0000230 | |||
| 451 | Ga0501046_0140795 | |||
| 452 | Ga0501047_0011024 | |||
| 453 | Ga0501048_0009731 | |||
| 454 | Ga0501048_0078355 | |||
| 455 | Ga0501048_0096272 | |||
| 456 | Ga0501048_0219467 | |||
| 457 | Ga0501067_0000478 | |||
| 458 | Ga0501067_0008087 | |||
| 459 | Ga0501067_0040070 | |||
| 460 | Ga0501068_0007869 | |||
| 461 | Ga0501069_0001210 | |||
| 462 | Ga0501069_0005644 | |||
| 463 | Ga0501069_0012397 | |||
| 464 | Ga0501070_0006559 | |||
| 465 | Ga0501070_0012133 | |||
| 466 | Ga0501070_0083694 | |||
| 467 | Ga0501070_0115600 | |||
| 468 | Ga0501071_0002795 | |||
| 469 | Ga0501071_0009805 | |||
| 470 | Ga0501072_0031887 | |||
| 471 | Ga0501072_0057582 | |||
| 472 | Ga0501072_0347288 | |||
| 473 | Ga0501073_0026825 | |||
| 474 | Ga0501073_0039754 | |||
| 475 | Ga0501074_0002765 | |||
| 476 | Ga0501074_0002861 | |||
| 477 | Ga0501074_0005775 | |||
| 478 | Ga0501076_0037422 | |||
| 479 | Ga0501076_0087442 | |||
| 480 | Ga0501077_0003919 | |||
| 481 | Ga0501077_0051087 | |||
| 482 | Ga0501079_0029146 | |||
| 483 | Ga0501079_0061967 | |||
| 484 | Ga0501080_0000766 | |||
| 485 | Ga0501080_0003937 | |||
| 486 | Ga0501080_0022702 | |||
| 487 | Ga0501080_0036215 | |||
| 488 | Ga0501081_0029449 | |||
| 489 | Ga0501081_0038281 | |||
| 490 | Ga0501083_0000725 | |||
| 491 | Ga0501083_0009420 | |||
| 492 | Ga0501083_0010574 | |||
| 493 | Ga0501035_0039061 | |||
| 494 | Ga0501044_0137833 | |||
| 495 | Ga0501045_0005865 | |||
| 496 | Ga0501045_0060749 | |||
| 497 | nmdc:mga03683_9338_c1 | |||
| 498 | nmdc:mga03n38_3714_c1 | |||
| 499 | nmdc:mga03n38_6244_c1 | |||
| 500 | nmdc:mga00v17_16059_c1 | |||
| 501 | nmdc:mga00v17_1921_c1 | |||
| 502 | nmdc:mga00v17_22893_c1 | |||
| 503 | nmdc:mga0yw44_12271_c1 | |||
| 504 | nmdc:mga0yw44_20182_c1 | |||
| 505 | nmdc:mga0yw44_217818_c1 | |||
| 506 | nmdc:mga0yw44_29759_c1 | |||
| 507 | nmdc:mga0yw44_4698_c1 | |||
| 508 | nmdc:mga0yw44_62668_c1 | |||
| 509 | nmdc:mga06z11_18129_c1 | |||
| 510 | nmdc:mga06z11_34437_c1 | |||
| 511 | nmdc:mga06z11_79284_c1 | |||
| 512 | nmdc:mga04h51_5610_c1 | |||
| 513 | nmdc:mga07m45_35800_c1 | |||
| 514 | nmdc:mga07m45_57335_c1 | |||
| 515 | nmdc:mga05p37_33246_c1 | |||
| 516 | nmdc:mga09592_183997_c1 | |||
| 517 | nmdc:mga0qj67_20102_c1 | |||
| 518 | nmdc:mga0qj67_31399_c1 | |||
| 519 | nmdc:mga06r32_1205_c1 | |||
| 520 | nmdc:mga06r32_28458_c1 | |||
| 521 | Ga0495619_0095583 | |||
| 522 | Ga0500644_0000053 | |||
| 523 | Ga0500556_0001035 | |||
| 524 | Ga0500593_000776 | |||
| 525 | Ga0501084_0001125 | |||
| 526 | Ga0501084_0017436 | |||
| 527 | Ga0501084_0035886 | |||
| 528 | Ga0501084_0072696 | |||
| 529 | Ga0501082_0016314 | |||
| 530 | Ga0466962_0006047 | |||
| 531 | Ga0466962_0023864 | |||
| 532 | Ga0466962_0043250 | |||
| 533 | Ga0530510_0031391 | |||
| 534 | 2643826651 | |||
| 535 | 2643892947 | |||
| 536 | 2643962708 | |||
| 537 | 2644034283 | |||
| 538 | 2644090144 | |||
| 539 | 2644098674 | |||
| 540 | 2644116035 | |||
| 541 | 2644230575 | |||
| 542 | 2644319988 | |||
| 543 | 2644532986 | |||
| 544 | 2740167993 | |||
| 545 | 2774397141 | |||
| 546 | 2809198790 | |||
| 547 | 2812333554 | |||
| 548 | 2812352640 | |||
| 549 | 2855389879 | |||
| 550 | 2857484114 | |||
| 551 | 2891969814 | |||
| 552 | 2984576694 | |||
| 553 | 2990258458 | |||
| 554 | 8054613362 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ei9-assembly2.cif.gz_B | crystal structure of e. coli trna-dihydrouridine synthase b (dusb) | 0.8818 | 5 | 333 |
| 6ei9-assembly2.cif.gz_B | crystal structure of e. coli trna-dihydrouridine synthase b (dusb) | 0.8629 | 5 | 333 |
| 1vhn-assembly1.cif.gz_A | crystal structure of a putative flavin oxidoreductase with flavin | 0.8526 | 21 | 335 |
| 1vhn-assembly1.cif.gz_A | crystal structure of a putative flavin oxidoreductase with flavin | 0.8449 | 21 | 335 |
| 3w9z-assembly1.cif.gz_A | crystal structure of dusc | 0.7998 | 21 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNS7_19_267_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9251 | 19 | 261 | 3.20.20.70 |
| af_P9WNS7_19_267_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9001 | 19 | 261 | 3.20.20.70 |
| af_P0ABT5_6_247_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8885 | 15 | 265 | 3.20.20.70 |
| af_P0ABT5_6_247_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.885 | 15 | 265 | 3.20.20.70 |
| af_Q9VIS4_253_495_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8828 | 20 | 265 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F9P9P0-F1-model_v4 | Dihydrouridine synthase domain protein | 0.9314 | 159 | 332 |
GO:0003723
GO:0017150 |
| AF-A0A7X7QEH7-F1-model_v4 | tRNA dihydrouridine synthase DusB | 0.9263 | 9 | 263 |
GO:0003723
GO:0017150 GO:0050660 |
| AF-A0A0N9SGF1-F1-model_v4 | tRNA dihydrouridine synthase | 0.9211 | 10 | 341 |
GO:0000049
GO:0017150 GO:0050660 |
| AF-A0A7C1ZGE8-F1-model_v4 | tRNA-dihydrouridine synthase (EC 1.3.1.-) | 0.9197 | 26 | 333 |
GO:0000049
GO:0017150 GO:0050660 |
| AF-A0A7V9GHM5-F1-model_v4 | tRNA dihydrouridine synthase DusB | 0.919 | 7 | 286 |
GO:0003723
GO:0017150 GO:0050660 |