F382072

General Info

Members Datasets Scaffolds Average Seq Length
277 167 554 376

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0040280|Ga0466962_0040280_751_1866
Length 371
Sequence VTLRLGSLEVATPVVLAPMAGVTNAAFRRLCAEQGAGLYVCEMITSRGLVEGDETTKRMLVFDDAEQVRSVQLYGTDPTYVAKAVAILCEEYDVRHVDLNFGCPVPKVTRKGGGGALPWKRGLLGRILEGAVAAAAPYDVPVTMKTRKGIDEGHLTYLDAGRIAQEAGVAAIALHGRTVAQAYSGTADWDAIAELKQTVTEIPVLGNGDIWALRMVEETGVDGVVIGRGCLGRPWLFRDLAAAFAGEPVTTLPNLGQVAAMMRRHAELLSEHMGEERGCKEFRKHVTWYLKGFPAGGDLRRTLGLIDSLATLDELLDSLDHSAPFPVSELGAPRGRQGAPRDKVVLPEGWLDDADGSQIHLTEDVSETTGG

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
143 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2643221561 Nocardioides sp. Root151 Isolate Unclassified
148 2643221576 Nocardioides sp. Root614 Isolate Unclassified
149 2643221590 Nocardioides sp. Root682 Isolate Unclassified
150 2643221604 Nocardioides sp. Root190 Isolate Unclassified
151 2643221615 Nocardioides sp. Root224 Isolate Unclassified
152 2643221617 Nocardioides sp. Root79 Isolate Unclassified
153 2643221620 Nocardioides sp. Root240 Isolate Unclassified
154 2643221641 Nocardioides sp. Root122 Isolate Unclassified
155 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
156 2643221696 Nocardioides sp. Root140 Isolate Unclassified
157 2739367898 Nocardioides sp. CF479 Isolate Unclassified
158 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
159 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
160 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
161 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
162 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
163 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
164 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
165 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
166 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
167 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.7
Metatranscriptomes 0.72
Isolates 7.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 14.8
Nodule 0.36
Rhizoplane 9.75
Rhizosphere 67.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0040280 3300061719 Bacteria 2237
2 LJQas_1004803 3300000549 Bacteria 1742
3 Ga0070683_100009309 3300005329 Bacteria 8394
4 Ga0070683_100103541 3300005329 Bacteria 2682
5 Ga0070683_100242359 3300005329 Bacteria 1715
6 Ga0070682_100006751 3300005337 Bacteria 6437
7 Ga0070660_100040821 3300005339 Bacteria 3534
8 Ga0070692_10039388 3300005345 Bacteria 2413
9 Ga0070674_100054684 3300005356 Bacteria 2762
10 Ga0070659_100019975 3300005366 Bacteria 5085
11 Ga0070667_100012594 3300005367 Bacteria 6995
12 Ga0070667_100173945 3300005367 Bacteria 1902
13 Ga0070714_100022216 3300005435 Bacteria 5200
14 Ga0070681_10340884 3300005458 Bacteria 1409
15 Ga0070698_100002288 3300005471 Bacteria 21210
16 Ga0070679_100081580 3300005530 Bacteria 3223
17 Ga0070684_100000608 3300005535 Bacteria 24723
18 Ga0070684_100046305 3300005535 Bacteria 3769
19 Ga0070693_100038199 3300005547 Bacteria 2682
20 Ga0070665_100000582 3300005548 Bacteria 50895
21 Ga0068855_100088340 3300005563 Bacteria 3580
22 Ga0068857_100013359 3300005577 Bacteria 7151
23 Ga0068856_100091133 3300005614 Bacteria 3033
24 Ga0068858_100043535 3300005842 Bacteria 4163
25 Ga0068860_100000669 3300005843 Bacteria 39653
26 Ga0068860_100152255 3300005843 Bacteria 2227
27 Ga0081455_10001806 3300005937 Bacteria 25821
28 Ga0075365_10001232 3300006038 Bacteria 11318
29 Ga0075365_10048892 3300006038 Bacteria 2785
30 Ga0075365_10075571 3300006038 Bacteria 2274
31 Ga0075365_10079235 3300006038 Bacteria 2223
32 Ga0075365_10094454 3300006038 Bacteria 2041
33 Ga0075365_10218899 3300006038 Bacteria 1336
34 Ga0075368_10003008 3300006042 Bacteria 5572
35 Ga0075368_10028080 3300006042 Bacteria 2173
36 Ga0075363_100004669 3300006048 Bacteria 6026
37 Ga0075363_100012452 3300006048 Bacteria 4101
38 Ga0075363_100047819 3300006048 Bacteria 2273
39 Ga0075363_100048938 3300006048 Bacteria 2249
40 Ga0075363_100094228 3300006048 Bacteria 1651
41 Ga0075363_100125953 3300006048 Bacteria 1434
42 Ga0075364_10000900 3300006051 Bacteria 15715
43 Ga0075364_10052409 3300006051 Bacteria 2666
44 Ga0075364_10058110 3300006051 Bacteria 2534
45 Ga0075364_10162610 3300006051 Bacteria 1507
46 Ga0075367_10007670 3300006178 Bacteria 5544
47 Ga0075370_10010645 3300006353 Bacteria 4819
48 Ga0075428_100081982 3300006844 Bacteria 3519
49 Ga0075430_100086937 3300006846 Bacteria 2616
50 Ga0075431_100000416 3300006847 Bacteria 34675
51 Ga0068865_100024149 3300006881 Bacteria 3986
52 Ga0105245_10001813 3300009098 Bacteria 19433
53 Ga0105245_10225742 3300009098 Bacteria 1809
54 Ga0114129_10012485 3300009147 Bacteria 12094
55 Ga0105237_10230764 3300009545 Bacteria 1852
56 Ga0105249_10090984 3300009553 Bacteria 2854
57 Ga0105239_10002393 3300010375 Bacteria 23914
58 Ga0105246_10002116 3300011119 Bacteria 11978
59 Ga0157371_10041048 3300013102 Bacteria 3303
60 Ga0163162_10023448 3300013306 Bacteria 6090
61 Ga0157372_10017185 3300013307 Bacteria 7766
62 Ga0157375_10043429 3300013308 Bacteria 4360
63 Ga0157375_10054606 3300013308 Bacteria 3935
64 Ga0163163_10021686 3300014325 Bacteria 6066
65 Ga0157379_10026932 3300014968 Bacteria 5118
66 Ga0163161_10008466 3300017792 Bacteria 7121
67 Ga0206353_10055087 3300020082 Bacteria 2128
68 Ga0206353_10681091 3300020082 Bacteria 2593
69 Ga0207647_10003080 3300025904 Bacteria 12532
70 Ga0207647_10021754 3300025904 Bacteria 4274
71 Ga0207707_10249058 3300025912 Bacteria 1543
72 Ga0207671_10124037 3300025914 Bacteria 1977
73 Ga0207657_10024839 3300025919 Bacteria 5539
74 Ga0207687_10012113 3300025927 Bacteria 5639
75 Ga0207661_10219374 3300025944 Bacteria 1680
76 Ga0207667_10081498 3300025949 Bacteria 3352
77 Ga0207667_10464718 3300025949 Bacteria 1285
78 Ga0207712_10205251 3300025961 Bacteria 1566
79 Ga0207658_10067139 3300025986 Bacteria 2700
80 Ga0207658_10247976 3300025986 Bacteria 1512
81 Ga0207677_10153535 3300026023 Bacteria 1780
82 Ga0207678_10092629 3300026067 Bacteria 2583
83 Ga0207674_10308855 3300026116 Bacteria 1531
84 Ga0207675_100056184 3300026118 Bacteria 3671
85 Ga0207675_100074610 3300026118 Bacteria 3174
86 Ga0268266_10018692 3300028379 Bacteria 5904
87 Ga0268264_10000510 3300028381 Bacteria 50047
88 Ga0307408_100283841 3300031548 Bacteria 1380
89 Ga0307405_10143281 3300031731 Bacteria 1670
90 Ga0307409_100065545 3300031995 Bacteria 2859
91 Ga0307416_100009657 3300032002 Bacteria 6330
92 Ga0307415_100010141 3300032126 Bacteria 5320
93 Ga0307415_100032272 3300032126 Bacteria 3385
94 Ga0307415_100138618 3300032126 Bacteria 1854
95 Ga0395899_0122436 3300037312 Bacteria 1862
96 Ga0395900_0041129 3300037418 Bacteria 4766
97 Ga0395900_0088075 3300037418 Bacteria 3191
98 Ga0395900_0191761 3300037418 Bacteria 2072
99 Ga0395898_0025428 3300037466 Bacteria 5965
100 Ga0395898_0472433 3300037466 Bacteria 1193
101 Ga0395901_0055357 3300038443 Bacteria 4125
102 Ga0451853_0314354 3300041512 Bacteria 1604
103 Ga0466969_0029754 3300044656 Bacteria 2787
104 Ga0466965_0013697 3300044683 Bacteria 3829
105 Ga0466965_0033319 3300044683 Bacteria 2517
106 Ga0466965_0088763 3300044683 Bacteria 1570
107 Ga0466966_0008737 3300044684 Bacteria 6705
108 Ga0466966_0009809 3300044684 Bacteria 6346
109 Ga0466961_0000895 3300044693 Bacteria 18517
110 Ga0466961_0009084 3300044693 Bacteria 6336
111 Ga0466961_0032928 3300044693 Bacteria 3330
112 Ga0466961_0040751 3300044693 Bacteria 2977
113 Ga0466963_0044764 3300044694 Bacteria 2913
114 Ga0466970_0002050 3300044765 Bacteria 9756
115 Ga0466970_0034778 3300044765 Bacteria 2669
116 Ga0466970_0105436 3300044765 Bacteria 1537
117 Ga0466957_0004077 3300044842 Bacteria 8090
118 Ga0466957_0005247 3300044842 Bacteria 7256
119 Ga0466957_0015884 3300044842 Bacteria 4399
120 Ga0466960_0016753 3300044901 Bacteria 3184
121 Ga0466960_0046351 3300044901 Bacteria 2081
122 Ga0466960_0064129 3300044901 Bacteria 1811
123 Ga0466959_0003598 3300045049 Bacteria 10213
124 Ga0451576_0410729 3300045051 Bacteria 1420
125 Ga0466958_0129088 3300045836 Bacteria 1586
126 Ga0466967_0011806 3300045976 Bacteria 6642
127 Ga0466967_0078176 3300045976 Bacteria 2980
128 Ga0466967_0114888 3300045976 Bacteria 2478
129 Ga0495620_0060603 3300046515 Bacteria 1577
130 Ga0495645_0078784 3300046543 Bacteria 2368
131 Ga0496100_0047952 3300048903 Bacteria 2755
132 Ga0496101_0038387 3300048904 Bacteria 3402
133 Ga0496102_0010545 3300048905 Bacteria 7957
134 Ga0496102_0021091 3300048905 Bacteria 5762
135 Ga0496102_0175168 3300048905 Bacteria 2020
136 Ga0496103_0004301 3300048906 Bacteria 8655
137 Ga0496103_0019842 3300048906 Bacteria 4036
138 Ga0496104_0001079 3300048907 Bacteria 23301
139 Ga0496104_0042622 3300048907 Bacteria 4260
140 Ga0496106_0021715 3300048909 Bacteria 4767
141 Ga0496106_0030845 3300048909 Bacteria 3996
142 Ga0496107_0003712 3300048910 Bacteria 10257
143 Ga0496107_0019714 3300048910 Bacteria 4759
144 Ga0496107_0038227 3300048910 Bacteria 3444
145 Ga0496108_0035407 3300048911 Bacteria 4150
146 Ga0496109_0005289 3300048912 Bacteria 10786
147 Ga0496109_0016338 3300048912 Bacteria 6486
148 Ga0496109_0084518 3300048912 Bacteria 2928
149 Ga0496110_0042170 3300048913 Bacteria 3983
150 Ga0496110_0190120 3300048913 Bacteria 1864
151 Ga0496111_0011190 3300048914 Bacteria 6039
152 Ga0496111_0017106 3300048914 Bacteria 5007
153 Ga0496113_0020029 3300048916 Bacteria 4694
154 Ga0496114_0009147 3300048917 Bacteria 7854
155 Ga0496114_0073400 3300048917 Bacteria 2879
156 Ga0496115_0000835 3300048918 Bacteria 22514
157 Ga0496115_0014968 3300048918 Bacteria 5880
158 Ga0501031_0034274 3300049568 Bacteria 3314
159 Ga0501031_0058614 3300049568 Bacteria 2509
160 Ga0501033_0006628 3300049570 Bacteria 9055
161 Ga0501034_0028688 3300049571 Bacteria 5662
162 Ga0501034_0035995 3300049571 Bacteria 5018
163 Ga0501036_0000176 3300049572 Bacteria 41989
164 Ga0501036_0024543 3300049572 Bacteria 5083
165 Ga0501037_0078195 3300049573 Bacteria 2400
166 Ga0501039_0001983 3300049575 Bacteria 15179
167 Ga0501039_0026142 3300049575 Bacteria 4485
168 Ga0501039_0035834 3300049575 Bacteria 3830
169 Ga0501040_0010794 3300049576 Bacteria 5971
170 Ga0501041_0003459 3300049577 Bacteria 9088
171 Ga0501041_0025987 3300049577 Bacteria 3520
172 Ga0501042_0006878 3300049578 Bacteria 7421
173 Ga0501046_0000230 3300049580 Bacteria 57666
174 Ga0501046_0140795 3300049580 Bacteria 1825
175 Ga0501047_0011024 3300049581 Bacteria 8552
176 Ga0501048_0009731 3300049582 Bacteria 7209
177 Ga0501048_0078355 3300049582 Bacteria 2332
178 Ga0501048_0096272 3300049582 Bacteria 2088
179 Ga0501048_0219467 3300049582 Bacteria 1349
180 Ga0501067_0000478 3300049583 Bacteria 21820
181 Ga0501067_0008087 3300049583 Bacteria 5843
182 Ga0501067_0040070 3300049583 Bacteria 2602
183 Ga0501068_0007869 3300049584 Bacteria 5906
184 Ga0501069_0001210 3300049585 Bacteria 12584
185 Ga0501069_0005644 3300049585 Bacteria 6516
186 Ga0501069_0012397 3300049585 Bacteria 4531
187 Ga0501070_0006559 3300049586 Bacteria 9902
188 Ga0501070_0012133 3300049586 Bacteria 7271
189 Ga0501070_0083694 3300049586 Bacteria 2641
190 Ga0501070_0115600 3300049586 Bacteria 2216
191 Ga0501071_0002795 3300049587 Bacteria 10732
192 Ga0501071_0009805 3300049587 Bacteria 6393
193 Ga0501072_0031887 3300049588 Bacteria 4125
194 Ga0501072_0057582 3300049588 Bacteria 3063
195 Ga0501072_0347288 3300049588 Bacteria 1178
196 Ga0501073_0026825 3300049589 Bacteria 4124
197 Ga0501073_0039754 3300049589 Bacteria 3331
198 Ga0501074_0002765 3300049590 Bacteria 12274
199 Ga0501074_0002861 3300049590 Bacteria 12083
200 Ga0501074_0005775 3300049590 Bacteria 8924
201 Ga0501076_0037422 3300049592 Bacteria 3805
202 Ga0501076_0087442 3300049592 Bacteria 2506
203 Ga0501077_0003919 3300049593 Bacteria 8964
204 Ga0501077_0051087 3300049593 Bacteria 2627
205 Ga0501079_0029146 3300049741 Bacteria 4236
206 Ga0501079_0061967 3300049741 Bacteria 2885
207 Ga0501080_0000766 3300049742 Bacteria 26090
208 Ga0501080_0003937 3300049742 Bacteria 13147
209 Ga0501080_0022702 3300049742 Bacteria 5813
210 Ga0501080_0036215 3300049742 Bacteria 4607
211 Ga0501081_0029449 3300049743 Bacteria 3710
212 Ga0501081_0038281 3300049743 Bacteria 3276
213 Ga0501083_0000725 3300049744 Bacteria 21473
214 Ga0501083_0009420 3300049744 Bacteria 6898
215 Ga0501083_0010574 3300049744 Bacteria 6497
216 Ga0501035_0039061 3300049822 Bacteria 4297
217 Ga0501044_0137833 3300049823 Bacteria 2430
218 Ga0501045_0005865 3300049824 Bacteria 8499
219 Ga0501045_0060749 3300049824 Bacteria 2771
220 nmdc:mga03683_9338_c1 3300050489 Bacteria 3482
221 nmdc:mga03n38_3714_c1 3300050490 Bacteria 4941
222 nmdc:mga03n38_6244_c1 3300050490 Bacteria 4125
223 nmdc:mga00v17_16059_c1 3300050491 Bacteria 4216
224 nmdc:mga00v17_1921_c1 3300050491 Bacteria 10733
225 nmdc:mga00v17_22893_c1 3300050491 Bacteria 3611
226 nmdc:mga0yw44_12271_c1 3300050492 Bacteria 4460
227 nmdc:mga0yw44_20182_c1 3300050492 Bacteria 3693
228 nmdc:mga0yw44_217818_c1 3300050492 Bacteria 1264
229 nmdc:mga0yw44_29759_c1 3300050492 Bacteria 3156
230 nmdc:mga0yw44_4698_c1 3300050492 Bacteria 6315
231 nmdc:mga0yw44_62668_c1 3300050492 Bacteria 2285
232 nmdc:mga06z11_18129_c1 3300050494 Bacteria 3210
233 nmdc:mga06z11_34437_c1 3300050494 Bacteria 2486
234 nmdc:mga06z11_79284_c1 3300050494 Bacteria 1758
235 nmdc:mga04h51_5610_c1 3300050495 Bacteria 3207
236 nmdc:mga07m45_35800_c1 3300050496 Bacteria 2762
237 nmdc:mga07m45_57335_c1 3300050496 Bacteria 2203
238 nmdc:mga05p37_33246_c1 3300050507 Bacteria 6316
239 nmdc:mga09592_183997_c1 3300050508 Bacteria 1808
240 nmdc:mga0qj67_20102_c1 3300050509 Bacteria 5111
241 nmdc:mga0qj67_31399_c1 3300050509 Bacteria 4137
242 nmdc:mga06r32_1205_c1 3300050510 Bacteria 23293
243 nmdc:mga06r32_28458_c1 3300050510 Bacteria 5230
244 Ga0495619_0095583 3300053085 Bacteria 2016
245 Ga0500644_0000053 3300053088 Bacteria 69275
246 Ga0500556_0001035 3300053104 Bacteria 14512
247 Ga0500593_000776 3300053117 Bacteria 11926
248 Ga0501084_0001125 3300054114 Bacteria 20859
249 Ga0501084_0017436 3300054114 Bacteria 5970
250 Ga0501084_0035886 3300054114 Bacteria 4144
251 Ga0501084_0072696 3300054114 Bacteria 2880
252 Ga0501082_0016314 3300060353 Bacteria 6394
253 Ga0466962_0006047 3300061719 Bacteria 5823
254 Ga0466962_0023864 3300061719 Bacteria 2939
255 Ga0466962_0043250 3300061719 Bacteria 2156
256 Ga0530510_0031391 3300061734 Bacteria 3820
257 2643826651 2643221561 Bacteria 4984412
258 2643892947 2643221576 Bacteria 5214352
259 2643962708 2643221590 Bacteria 5214697
260 2644034283 2643221604 Bacteria 5014917
261 2644090144 2643221615 Bacteria 5487866
262 2644098674 2643221617 Bacteria 5139111
263 2644116035 2643221620 Bacteria 5134593
264 2644230575 2643221641 Bacteria 4490190
265 2644319988 2643221657 Bacteria 5490246
266 2644532986 2643221696 Bacteria 5431823
267 2740167993 2739367898 Bacteria 4367674
268 2774397141 2773857762 Bacteria 5971770
269 2809198790 2808606439 Bacteria 5952208
270 2812333554 2811994874 Bacteria 5367947
271 2812352640 2811994878 Bacteria 5992952
272 2855389879 2855386786 Bacteria 4752232
273 2857484114 2857481737 Bacteria 4761446
274 2891969814 2891968417 Bacteria 5821697
275 2984576694 2984576629 Bacteria 4248407
276 2990258458 2990256926 Bacteria 4252839
277 8054613362 8054609563 Bacteria 5170090
278 Ga0466962_0040280
279 LJQas_1004803
280 Ga0070683_100009309
281 Ga0070683_100103541
282 Ga0070683_100242359
283 Ga0070682_100006751
284 Ga0070660_100040821
285 Ga0070692_10039388
286 Ga0070674_100054684
287 Ga0070659_100019975
288 Ga0070667_100012594
289 Ga0070667_100173945
290 Ga0070714_100022216
291 Ga0070681_10340884
292 Ga0070698_100002288
293 Ga0070679_100081580
294 Ga0070684_100000608
295 Ga0070684_100046305
296 Ga0070693_100038199
297 Ga0070665_100000582
298 Ga0068855_100088340
299 Ga0068857_100013359
300 Ga0068856_100091133
301 Ga0068858_100043535
302 Ga0068860_100000669
303 Ga0068860_100152255
304 Ga0081455_10001806
305 Ga0075365_10001232
306 Ga0075365_10048892
307 Ga0075365_10075571
308 Ga0075365_10079235
309 Ga0075365_10094454
310 Ga0075365_10218899
311 Ga0075368_10003008
312 Ga0075368_10028080
313 Ga0075363_100004669
314 Ga0075363_100012452
315 Ga0075363_100047819
316 Ga0075363_100048938
317 Ga0075363_100094228
318 Ga0075363_100125953
319 Ga0075364_10000900
320 Ga0075364_10052409
321 Ga0075364_10058110
322 Ga0075364_10162610
323 Ga0075367_10007670
324 Ga0075370_10010645
325 Ga0075428_100081982
326 Ga0075430_100086937
327 Ga0075431_100000416
328 Ga0068865_100024149
329 Ga0105245_10001813
330 Ga0105245_10225742
331 Ga0114129_10012485
332 Ga0105237_10230764
333 Ga0105249_10090984
334 Ga0105239_10002393
335 Ga0105246_10002116
336 Ga0157371_10041048
337 Ga0163162_10023448
338 Ga0157372_10017185
339 Ga0157375_10043429
340 Ga0157375_10054606
341 Ga0163163_10021686
342 Ga0157379_10026932
343 Ga0163161_10008466
344 Ga0206353_10055087
345 Ga0206353_10681091
346 Ga0207647_10003080
347 Ga0207647_10021754
348 Ga0207707_10249058
349 Ga0207671_10124037
350 Ga0207657_10024839
351 Ga0207687_10012113
352 Ga0207661_10219374
353 Ga0207667_10081498
354 Ga0207667_10464718
355 Ga0207712_10205251
356 Ga0207658_10067139
357 Ga0207658_10247976
358 Ga0207677_10153535
359 Ga0207678_10092629
360 Ga0207674_10308855
361 Ga0207675_100056184
362 Ga0207675_100074610
363 Ga0268266_10018692
364 Ga0268264_10000510
365 Ga0307408_100283841
366 Ga0307405_10143281
367 Ga0307409_100065545
368 Ga0307416_100009657
369 Ga0307415_100010141
370 Ga0307415_100032272
371 Ga0307415_100138618
372 Ga0395899_0122436
373 Ga0395900_0041129
374 Ga0395900_0088075
375 Ga0395900_0191761
376 Ga0395898_0025428
377 Ga0395898_0472433
378 Ga0395901_0055357
379 Ga0451853_0314354
380 Ga0466969_0029754
381 Ga0466965_0013697
382 Ga0466965_0033319
383 Ga0466965_0088763
384 Ga0466966_0008737
385 Ga0466966_0009809
386 Ga0466961_0000895
387 Ga0466961_0009084
388 Ga0466961_0032928
389 Ga0466961_0040751
390 Ga0466963_0044764
391 Ga0466970_0002050
392 Ga0466970_0034778
393 Ga0466970_0105436
394 Ga0466957_0004077
395 Ga0466957_0005247
396 Ga0466957_0015884
397 Ga0466960_0016753
398 Ga0466960_0046351
399 Ga0466960_0064129
400 Ga0466959_0003598
401 Ga0451576_0410729
402 Ga0466958_0129088
403 Ga0466967_0011806
404 Ga0466967_0078176
405 Ga0466967_0114888
406 Ga0495620_0060603
407 Ga0495645_0078784
408 Ga0496100_0047952
409 Ga0496101_0038387
410 Ga0496102_0010545
411 Ga0496102_0021091
412 Ga0496102_0175168
413 Ga0496103_0004301
414 Ga0496103_0019842
415 Ga0496104_0001079
416 Ga0496104_0042622
417 Ga0496106_0021715
418 Ga0496106_0030845
419 Ga0496107_0003712
420 Ga0496107_0019714
421 Ga0496107_0038227
422 Ga0496108_0035407
423 Ga0496109_0005289
424 Ga0496109_0016338
425 Ga0496109_0084518
426 Ga0496110_0042170
427 Ga0496110_0190120
428 Ga0496111_0011190
429 Ga0496111_0017106
430 Ga0496113_0020029
431 Ga0496114_0009147
432 Ga0496114_0073400
433 Ga0496115_0000835
434 Ga0496115_0014968
435 Ga0501031_0034274
436 Ga0501031_0058614
437 Ga0501033_0006628
438 Ga0501034_0028688
439 Ga0501034_0035995
440 Ga0501036_0000176
441 Ga0501036_0024543
442 Ga0501037_0078195
443 Ga0501039_0001983
444 Ga0501039_0026142
445 Ga0501039_0035834
446 Ga0501040_0010794
447 Ga0501041_0003459
448 Ga0501041_0025987
449 Ga0501042_0006878
450 Ga0501046_0000230
451 Ga0501046_0140795
452 Ga0501047_0011024
453 Ga0501048_0009731
454 Ga0501048_0078355
455 Ga0501048_0096272
456 Ga0501048_0219467
457 Ga0501067_0000478
458 Ga0501067_0008087
459 Ga0501067_0040070
460 Ga0501068_0007869
461 Ga0501069_0001210
462 Ga0501069_0005644
463 Ga0501069_0012397
464 Ga0501070_0006559
465 Ga0501070_0012133
466 Ga0501070_0083694
467 Ga0501070_0115600
468 Ga0501071_0002795
469 Ga0501071_0009805
470 Ga0501072_0031887
471 Ga0501072_0057582
472 Ga0501072_0347288
473 Ga0501073_0026825
474 Ga0501073_0039754
475 Ga0501074_0002765
476 Ga0501074_0002861
477 Ga0501074_0005775
478 Ga0501076_0037422
479 Ga0501076_0087442
480 Ga0501077_0003919
481 Ga0501077_0051087
482 Ga0501079_0029146
483 Ga0501079_0061967
484 Ga0501080_0000766
485 Ga0501080_0003937
486 Ga0501080_0022702
487 Ga0501080_0036215
488 Ga0501081_0029449
489 Ga0501081_0038281
490 Ga0501083_0000725
491 Ga0501083_0009420
492 Ga0501083_0010574
493 Ga0501035_0039061
494 Ga0501044_0137833
495 Ga0501045_0005865
496 Ga0501045_0060749
497 nmdc:mga03683_9338_c1
498 nmdc:mga03n38_3714_c1
499 nmdc:mga03n38_6244_c1
500 nmdc:mga00v17_16059_c1
501 nmdc:mga00v17_1921_c1
502 nmdc:mga00v17_22893_c1
503 nmdc:mga0yw44_12271_c1
504 nmdc:mga0yw44_20182_c1
505 nmdc:mga0yw44_217818_c1
506 nmdc:mga0yw44_29759_c1
507 nmdc:mga0yw44_4698_c1
508 nmdc:mga0yw44_62668_c1
509 nmdc:mga06z11_18129_c1
510 nmdc:mga06z11_34437_c1
511 nmdc:mga06z11_79284_c1
512 nmdc:mga04h51_5610_c1
513 nmdc:mga07m45_35800_c1
514 nmdc:mga07m45_57335_c1
515 nmdc:mga05p37_33246_c1
516 nmdc:mga09592_183997_c1
517 nmdc:mga0qj67_20102_c1
518 nmdc:mga0qj67_31399_c1
519 nmdc:mga06r32_1205_c1
520 nmdc:mga06r32_28458_c1
521 Ga0495619_0095583
522 Ga0500644_0000053
523 Ga0500556_0001035
524 Ga0500593_000776
525 Ga0501084_0001125
526 Ga0501084_0017436
527 Ga0501084_0035886
528 Ga0501084_0072696
529 Ga0501082_0016314
530 Ga0466962_0006047
531 Ga0466962_0023864
532 Ga0466962_0043250
533 Ga0530510_0031391
534 2643826651
535 2643892947
536 2643962708
537 2644034283
538 2644090144
539 2644098674
540 2644116035
541 2644230575
542 2644319988
543 2644532986
544 2740167993
545 2774397141
546 2809198790
547 2812333554
548 2812352640
549 2855389879
550 2857484114
551 2891969814
552 2984576694
553 2990258458
554 8054613362

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01207

Dus

Dihydrouridine synthase (Dus)

15

323

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.8818 5 333
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.8629 5 333
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.8526 21 335
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.8449 21 335
3w9z-assembly1.cif.gz_A crystal structure of dusc 0.7998 21 338
ID Description Score Start End Superfamily
af_P9WNS7_19_267_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9251 19 261 3.20.20.70
af_P9WNS7_19_267_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9001 19 261 3.20.20.70
af_P0ABT5_6_247_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8885 15 265 3.20.20.70
af_P0ABT5_6_247_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.885 15 265 3.20.20.70
af_Q9VIS4_253_495_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8828 20 265 3.20.20.70
ID Description Score Start End GO Terms
AF-F9P9P0-F1-model_v4 Dihydrouridine synthase domain protein 0.9314 159 332 GO:0003723
GO:0017150
AF-A0A7X7QEH7-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9263 9 263 GO:0003723
GO:0017150
GO:0050660
AF-A0A0N9SGF1-F1-model_v4 tRNA dihydrouridine synthase 0.9211 10 341 GO:0000049
GO:0017150
GO:0050660
AF-A0A7C1ZGE8-F1-model_v4 tRNA-dihydrouridine synthase (EC 1.3.1.-) 0.9197 26 333 GO:0000049
GO:0017150
GO:0050660
AF-A0A7V9GHM5-F1-model_v4 tRNA dihydrouridine synthase DusB 0.919 7 286 GO:0003723
GO:0017150
GO:0050660

Map