F382054
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 277 | 208 | 276 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300050494|nmdc:mga06z11_256866_c1|nmdc:mga06z11_256866_c1_64_693 |
| Length | 209 |
| Sequence | VVRVASPRRHRPTTYRLRRDIDEHLPVDLISTEGHPVTNESETAILAGGCFWGMQDLFRRLPGVISTRVGYSGGDTVDATYRNHGGHAEALEVVFDPGVLSYRQLLEFFFQVHDPTTLNRQGNDVGDSYRSAIFYTSDEQRTVAQATVAEVDASGIWPGPVVTEVTAAGPFWEAEPEHQDYLERYPAGYTCHFVRPEWKLAPRAELPVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 | Metagenome | Unclassified |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 131 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 132 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 136 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 137 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 184 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 188 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 189 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 197 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 200 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 201 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 202 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 203 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 204 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 205 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 206 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.47 |
| Metatranscriptomes | 2.17 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.08 |
| Nodule | 1.08 |
| Rhizoplane | 4.33 |
| Rhizosphere | 71.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10177750 | 3300002067 | Bacteria | 616 |
| 2 | JGI25156J39149_1002289 | 3300002705 | Bacteria | 7027 |
| 3 | JGI25157J39369_1000068 | 3300002741 | Bacteria | 94833 |
| 4 | JGI25157J39369_1000266 | 3300002741 | Bacteria | 38247 |
| 5 | Ga0055539_1001285 | 3300003752 | Bacteria | 4970 |
| 6 | Ga0055533_1003515 | 3300003756 | Bacteria | 3117 |
| 7 | Ga0055527_1000066 | 3300003760 | Bacteria | 88276 |
| 8 | Ga0055535_1000058 | 3300003761 | Bacteria | 125370 |
| 9 | Ga0055542_1000085 | 3300003762 | Bacteria | 125370 |
| 10 | Ga0055529_1000240 | 3300003763 | Bacteria | 68255 |
| 11 | Ga0070683_100016367 | 3300005329 | Bacteria | 6539 |
| 12 | Ga0070670_100027083 | 3300005331 | Unclassified | 4930 |
| 13 | Ga0068868_100008647 | 3300005338 | Bacteria | 7290 |
| 14 | Ga0070661_100759646 | 3300005344 | Bacteria | 793 |
| 15 | Ga0070671_100243352 | 3300005355 | Bacteria | 1527 |
| 16 | Ga0070674_100398791 | 3300005356 | Bacteria | 1123 |
| 17 | Ga0070673_100352376 | 3300005364 | Bacteria | 1307 |
| 18 | Ga0070659_100006985 | 3300005366 | Bacteria | 8172 |
| 19 | Ga0070667_100005450 | 3300005367 | Bacteria | 10629 |
| 20 | Ga0070713_100012562 | 3300005436 | Bacteria | 6217 |
| 21 | Ga0070713_100624657 | 3300005436 | Bacteria | 1025 |
| 22 | Ga0070710_10090712 | 3300005437 | Bacteria | 1802 |
| 23 | Ga0070700_100311577 | 3300005441 | Bacteria | 1153 |
| 24 | Ga0070708_100251115 | 3300005445 | Bacteria | 1662 |
| 25 | Ga0070678_100002075 | 3300005456 | Bacteria | 10873 |
| 26 | Ga0070662_100237595 | 3300005457 | Bacteria | 1460 |
| 27 | Ga0070681_10082630 | 3300005458 | Bacteria | 3167 |
| 28 | Ga0070681_10526364 | 3300005458 | Bacteria | 1096 |
| 29 | Ga0070685_10021382 | 3300005466 | Bacteria | 3516 |
| 30 | Ga0070706_100055270 | 3300005467 | Bacteria | 3664 |
| 31 | Ga0070706_100062865 | 3300005467 | Bacteria | 3430 |
| 32 | Ga0070706_100306476 | 3300005467 | Bacteria | 1481 |
| 33 | Ga0070707_100062600 | 3300005468 | Bacteria | 3569 |
| 34 | Ga0070698_100002746 | 3300005471 | Bacteria | 19357 |
| 35 | Ga0070699_100105209 | 3300005518 | Bacteria | 2475 |
| 36 | Ga0070699_100400107 | 3300005518 | Bacteria | 1241 |
| 37 | Ga0070679_100301816 | 3300005530 | Bacteria | 1552 |
| 38 | Ga0070697_100696954 | 3300005536 | Bacteria | 896 |
| 39 | Ga0070697_100737363 | 3300005536 | Bacteria | 870 |
| 40 | Ga0070697_101198863 | 3300005536 | Bacteria | 676 |
| 41 | Ga0070665_100092116 | 3300005548 | Bacteria | 3036 |
| 42 | Ga0070664_100029820 | 3300005564 | Bacteria | 4548 |
| 43 | Ga0068857_100032306 | 3300005577 | Bacteria | 4628 |
| 44 | Ga0068857_100329451 | 3300005577 | Bacteria | 1411 |
| 45 | Ga0068857_100547964 | 3300005577 | Bacteria | 1089 |
| 46 | Ga0068854_100148239 | 3300005578 | Bacteria | 1806 |
| 47 | Ga0068856_100003141 | 3300005614 | Bacteria | 16842 |
| 48 | Ga0068856_100885900 | 3300005614 | Bacteria | 911 |
| 49 | Ga0068864_100401243 | 3300005618 | Bacteria | 1303 |
| 50 | Ga0068851_10235789 | 3300005834 | Bacteria | 1033 |
| 51 | Ga0068851_10465984 | 3300005834 | Bacteria | 753 |
| 52 | Ga0068870_10909229 | 3300005840 | Bacteria | 622 |
| 53 | Ga0068858_100360483 | 3300005842 | Bacteria | 1393 |
| 54 | Ga0068860_100660138 | 3300005843 | Bacteria | 1054 |
| 55 | Ga0081455_10006928 | 3300005937 | Bacteria | 12055 |
| 56 | Ga0081540_1036249 | 3300005983 | Bacteria | 2633 |
| 57 | Ga0070717_10109680 | 3300006028 | Bacteria | 2353 |
| 58 | Ga0070717_10540521 | 3300006028 | Bacteria | 1055 |
| 59 | Ga0075363_100025257 | 3300006048 | Bacteria | 3028 |
| 60 | Ga0075363_100057664 | 3300006048 | Bacteria | 2085 |
| 61 | Ga0075364_10377680 | 3300006051 | Bacteria | 967 |
| 62 | Ga0070716_100251164 | 3300006173 | Bacteria | 1205 |
| 63 | Ga0075362_10044808 | 3300006177 | Bacteria | 1963 |
| 64 | Ga0075367_10090398 | 3300006178 | Bacteria | 1862 |
| 65 | Ga0075367_10146372 | 3300006178 | Bacteria | 1465 |
| 66 | Ga0075366_10082761 | 3300006195 | Bacteria | 1918 |
| 67 | Ga0097621_100034374 | 3300006237 | Bacteria | 4044 |
| 68 | Ga0075370_10028523 | 3300006353 | Bacteria | 3103 |
| 69 | Ga0075370_10098036 | 3300006353 | Bacteria | 1695 |
| 70 | Ga0068871_100032739 | 3300006358 | Bacteria | 4109 |
| 71 | Ga0075428_100590350 | 3300006844 | Bacteria | 1187 |
| 72 | Ga0075430_100386613 | 3300006846 | Bacteria | 1155 |
| 73 | Ga0075433_10005609 | 3300006852 | Bacteria | 9862 |
| 74 | Ga0075433_10099113 | 3300006852 | Bacteria | 2579 |
| 75 | Ga0075434_100026370 | 3300006871 | Bacteria | 5692 |
| 76 | Ga0075436_100084393 | 3300006914 | Bacteria | 2204 |
| 77 | Ga0099823_1026356 | 3300006944 | Bacteria | 5141 |
| 78 | Ga0075435_100003546 | 3300007076 | Bacteria | 10597 |
| 79 | Ga0099795_10095614 | 3300007788 | Bacteria | 1158 |
| 80 | Ga0105251_10019025 | 3300009011 | Bacteria | 3637 |
| 81 | Ga0105244_10001335 | 3300009036 | Bacteria | 20129 |
| 82 | Ga0105240_10147437 | 3300009093 | Bacteria | 2806 |
| 83 | Ga0105240_11155974 | 3300009093 | Bacteria | 821 |
| 84 | Ga0111539_10026113 | 3300009094 | Bacteria | 7149 |
| 85 | Ga0105243_10398597 | 3300009148 | Bacteria | 1278 |
| 86 | Ga0105242_10669536 | 3300009176 | Bacteria | 1012 |
| 87 | Ga0105237_10033579 | 3300009545 | Bacteria | 5199 |
| 88 | Ga0105238_10372533 | 3300009551 | Bacteria | 1418 |
| 89 | Ga0105239_10546687 | 3300010375 | Bacteria | 1319 |
| 90 | Ga0105239_10643037 | 3300010375 | Bacteria | 1211 |
| 91 | Ga0157373_10178050 | 3300013100 | Bacteria | 1497 |
| 92 | Ga0157371_10049207 | 3300013102 | Bacteria | 2995 |
| 93 | Ga0157369_10055533 | 3300013105 | Bacteria | 4275 |
| 94 | Ga0157369_10283389 | 3300013105 | Bacteria | 1725 |
| 95 | Ga0157369_10468601 | 3300013105 | Bacteria | 1304 |
| 96 | Ga0157372_10084164 | 3300013307 | Bacteria | 3604 |
| 97 | Ga0157372_10447983 | 3300013307 | Bacteria | 1504 |
| 98 | Ga0163163_10197322 | 3300014325 | Bacteria | 2061 |
| 99 | Ga0163163_11110245 | 3300014325 | Bacteria | 854 |
| 100 | Ga0206351_10217856 | 3300020077 | Bacteria | 892 |
| 101 | Ga0206350_10946734 | 3300020080 | Bacteria | 1197 |
| 102 | Ga0154015_1675751 | 3300020610 | Bacteria | 945 |
| 103 | Ga0213876_10006811 | 3300021384 | Bacteria | 6238 |
| 104 | Ga0213876_10460919 | 3300021384 | Bacteria | 676 |
| 105 | Ga0213875_10003100 | 3300021388 | Bacteria | 9586 |
| 106 | Ga0213875_10006148 | 3300021388 | Bacteria | 6339 |
| 107 | Ga0213875_10030009 | 3300021388 | Bacteria | 2577 |
| 108 | Ga0213875_10042004 | 3300021388 | Bacteria | 2150 |
| 109 | Ga0224712_10068479 | 3300022467 | Bacteria | 1435 |
| 110 | Ga0224712_10100390 | 3300022467 | Bacteria | 1226 |
| 111 | Ga0209674_100202 | 3300025226 | Bacteria | 61028 |
| 112 | Ga0209674_104336 | 3300025226 | Bacteria | 2331 |
| 113 | Ga0209672_100018 | 3300025228 | Bacteria | 432924 |
| 114 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 115 | Ga0209026_1000056 | 3300025250 | Bacteria | 236450 |
| 116 | Ga0209677_103753 | 3300025253 | Bacteria | 4734 |
| 117 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 118 | Ga0209759_1000317 | 3300025256 | Bacteria | 64752 |
| 119 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 120 | Ga0207643_10754950 | 3300025908 | Bacteria | 630 |
| 121 | Ga0207705_10633963 | 3300025909 | Bacteria | 831 |
| 122 | Ga0207684_10163112 | 3300025910 | Bacteria | 1919 |
| 123 | Ga0207684_10187179 | 3300025910 | Bacteria | 1785 |
| 124 | Ga0207707_10067302 | 3300025912 | Bacteria | 3120 |
| 125 | Ga0207695_10551535 | 3300025913 | Bacteria | 1034 |
| 126 | Ga0207693_10076676 | 3300025915 | Bacteria | 2618 |
| 127 | Ga0207693_10187073 | 3300025915 | Bacteria | 1630 |
| 128 | Ga0207649_10000153 | 3300025920 | Bacteria | 56646 |
| 129 | Ga0207646_10496748 | 3300025922 | Bacteria | 1099 |
| 130 | Ga0207700_10407973 | 3300025928 | Bacteria | 1191 |
| 131 | Ga0207700_10521933 | 3300025928 | Bacteria | 1052 |
| 132 | Ga0207644_10018921 | 3300025931 | Bacteria | 4669 |
| 133 | Ga0207690_10166767 | 3300025932 | Bacteria | 1646 |
| 134 | Ga0207665_10260602 | 3300025939 | Bacteria | 1284 |
| 135 | Ga0207661_10001410 | 3300025944 | Bacteria | 16200 |
| 136 | Ga0207661_10045156 | 3300025944 | Bacteria | 3485 |
| 137 | Ga0207661_10782406 | 3300025944 | Bacteria | 878 |
| 138 | Ga0207679_10102082 | 3300025945 | Bacteria | 2245 |
| 139 | Ga0207679_10921820 | 3300025945 | Bacteria | 799 |
| 140 | Ga0207667_10076890 | 3300025949 | Bacteria | 3463 |
| 141 | Ga0207658_10023473 | 3300025986 | Bacteria | 4305 |
| 142 | Ga0207658_10670930 | 3300025986 | Bacteria | 935 |
| 143 | Ga0207703_10130459 | 3300026035 | Bacteria | 2170 |
| 144 | Ga0207639_10742053 | 3300026041 | Bacteria | 913 |
| 145 | Ga0207678_10348232 | 3300026067 | Bacteria | 1277 |
| 146 | Ga0207702_10001228 | 3300026078 | Bacteria | 25915 |
| 147 | Ga0207641_10574091 | 3300026088 | Bacteria | 1102 |
| 148 | Ga0207676_10947023 | 3300026095 | Bacteria | 846 |
| 149 | Ga0207674_10035486 | 3300026116 | Bacteria | 5204 |
| 150 | Ga0207674_10081837 | 3300026116 | Bacteria | 3230 |
| 151 | Ga0207674_10462466 | 3300026116 | Bacteria | 1226 |
| 152 | Ga0209389_1012813 | 3300027296 | Bacteria | 7616 |
| 153 | Ga0209489_102408 | 3300027361 | Bacteria | 38192 |
| 154 | Ga0224573_1002758 | 3300028019 | Bacteria | 1308 |
| 155 | Ga0268266_10437240 | 3300028379 | Bacteria | 1242 |
| 156 | Ga0373932_0025750 | 3300035112 | Bacteria | 1595 |
| 157 | Ga0373956_0132710 | 3300035119 | Unclassified | 1167 |
| 158 | Ga0373955_0084627 | 3300035172 | Bacteria | 1799 |
| 159 | Ga0373935_0408981 | 3300035692 | Bacteria | 975 |
| 160 | Ga0373937_0096339 | 3300036401 | Bacteria | 2744 |
| 161 | Ga0373925_0069861 | 3300037068 | Bacteria | 2654 |
| 162 | Ga0436364_0152843 | 3300037853 | Bacteria | 5799 |
| 163 | Ga0436364_0273122 | 3300037853 | Bacteria | 2816 |
| 164 | Ga0436364_0854082 | 3300037853 | Bacteria | 7789 |
| 165 | Ga0436364_1200124 | 3300037853 | Bacteria | 4770 |
| 166 | Ga0436364_1460981 | 3300037853 | Bacteria | 9075 |
| 167 | Ga0395901_0197387 | 3300038443 | Bacteria | 2110 |
| 168 | Ga0436365_0094414 | 3300039437 | Bacteria | 27854 |
| 169 | Ga0436365_0209068 | 3300039437 | Bacteria | 6978 |
| 170 | Ga0436360_0161702 | 3300039438 | Bacteria | 5155 |
| 171 | Ga0436360_0579844 | 3300039438 | Bacteria | 1233 |
| 172 | Ga0436361_0595889 | 3300039447 | Bacteria | 1834 |
| 173 | Ga0436363_0544135 | 3300039450 | Bacteria | 948 |
| 174 | Ga0436363_1440963 | 3300039450 | Bacteria | 698 |
| 175 | Ga0466969_0113154 | 3300044656 | Bacteria | 1268 |
| 176 | Ga0466975_0314115 | 3300044661 | Bacteria | 1001 |
| 177 | Ga0466966_0035631 | 3300044684 | Bacteria | 3213 |
| 178 | Ga0466966_0333428 | 3300044684 | Bacteria | 911 |
| 179 | Ga0466961_0007297 | 3300044693 | Bacteria | 7033 |
| 180 | Ga0466961_0029461 | 3300044693 | Bacteria | 3528 |
| 181 | Ga0466963_0412325 | 3300044694 | Bacteria | 953 |
| 182 | Ga0466971_0281360 | 3300044719 | Bacteria | 796 |
| 183 | Ga0466970_0028026 | 3300044765 | Bacteria | 2958 |
| 184 | Ga0466970_0045527 | 3300044765 | Bacteria | 2336 |
| 185 | Ga0466959_0000007 | 3300045049 | Bacteria | 184664 |
| 186 | Ga0466959_0018268 | 3300045049 | Bacteria | 5148 |
| 187 | Ga0466959_0055920 | 3300045049 | Bacteria | 2880 |
| 188 | Ga0466958_0145458 | 3300045836 | Bacteria | 1494 |
| 189 | Ga0495629_0227769 | 3300046459 | Unclassified | 1285 |
| 190 | Ga0495580_0073331 | 3300046472 | Bacteria | 2390 |
| 191 | Ga0495639_0044922 | 3300046475 | Bacteria | 1998 |
| 192 | Ga0495662_0047688 | 3300046476 | Bacteria | 2068 |
| 193 | Ga0495664_0113577 | 3300046477 | Bacteria | 1636 |
| 194 | Ga0495608_0378706 | 3300046511 | Unclassified | 868 |
| 195 | Ga0495608_0436701 | 3300046511 | Unclassified | 798 |
| 196 | Ga0495630_0090624 | 3300046517 | Bacteria | 2310 |
| 197 | Ga0495630_0381450 | 3300046517 | Bacteria | 1080 |
| 198 | Ga0495630_0407010 | 3300046517 | Bacteria | 1042 |
| 199 | Ga0495648_0001466 | 3300046524 | Bacteria | 23072 |
| 200 | Ga0495586_0182825 | 3300046535 | Unclassified | 1186 |
| 201 | Ga0495587_0026591 | 3300046536 | Bacteria | 3528 |
| 202 | Ga0495634_0047236 | 3300046642 | Bacteria | 2902 |
| 203 | Ga0495646_0563769 | 3300046680 | Bacteria | 581 |
| 204 | Ga0495658_0796764 | 3300046683 | Unclassified | 605 |
| 205 | Ga0495613_0221307 | 3300046689 | Bacteria | 1329 |
| 206 | Ga0495624_0061655 | 3300046690 | Bacteria | 2349 |
| 207 | Ga0495604_0116739 | 3300047317 | Bacteria | 1937 |
| 208 | Ga0495604_0719566 | 3300047317 | Bacteria | 633 |
| 209 | Ga0495674_0005933 | 3300047319 | Bacteria | 11724 |
| 210 | Ga0495674_1248279 | 3300047319 | Bacteria | 560 |
| 211 | Ga0495676_0221428 | 3300047321 | Bacteria | 1304 |
| 212 | Ga0495676_0492925 | 3300047321 | Bacteria | 805 |
| 213 | Ga0495680_0535397 | 3300047322 | Bacteria | 791 |
| 214 | Ga0495673_0002107 | 3300047469 | Bacteria | 14477 |
| 215 | Ga0495673_0189358 | 3300047469 | Bacteria | 775 |
| 216 | Ga0496100_0025560 | 3300048903 | Bacteria | 3613 |
| 217 | Ga0496104_0576832 | 3300048907 | Bacteria | 1035 |
| 218 | Ga0496104_1265151 | 3300048907 | Unclassified | 641 |
| 219 | Ga0496107_0228825 | 3300048910 | Bacteria | 1383 |
| 220 | Ga0496108_1382416 | 3300048911 | Bacteria | 589 |
| 221 | Ga0496110_0452523 | 3300048913 | Bacteria | 1170 |
| 222 | Ga0496112_0046700 | 3300048915 | Bacteria | 4248 |
| 223 | Ga0496112_0296823 | 3300048915 | Bacteria | 1562 |
| 224 | Ga0496112_1237588 | 3300048915 | Bacteria | 663 |
| 225 | Ga0496113_0003323 | 3300048916 | Bacteria | 9605 |
| 226 | Ga0496113_0068949 | 3300048916 | Bacteria | 2685 |
| 227 | Ga0496114_0813485 | 3300048917 | Bacteria | 813 |
| 228 | Ga0496126_0086313 | 3300048929 | Bacteria | 2766 |
| 229 | Ga0496126_0295826 | 3300048929 | Bacteria | 1337 |
| 230 | Ga0501032_0085408 | 3300049569 | Bacteria | 2098 |
| 231 | Ga0501033_0017812 | 3300049570 | Bacteria | 5363 |
| 232 | Ga0501033_0032037 | 3300049570 | Bacteria | 3946 |
| 233 | Ga0501037_0047104 | 3300049573 | Bacteria | 3161 |
| 234 | Ga0501043_0018573 | 3300049579 | Bacteria | 5455 |
| 235 | Ga0501043_0492687 | 3300049579 | Bacteria | 916 |
| 236 | Ga0501047_0099865 | 3300049581 | Bacteria | 2781 |
| 237 | Ga0501069_0157499 | 3300049585 | Bacteria | 1307 |
| 238 | Ga0501070_0192890 | 3300049586 | Bacteria | 1674 |
| 239 | Ga0501071_0577365 | 3300049587 | Bacteria | 864 |
| 240 | Ga0501073_0124782 | 3300049589 | Bacteria | 1785 |
| 241 | Ga0501075_0055251 | 3300049591 | Bacteria | 2988 |
| 242 | Ga0501080_0455269 | 3300049742 | Bacteria | 1147 |
| 243 | Ga0501241_006508 | 3300049758 | Bacteria | 2151 |
| 244 | Ga0501035_0008664 | 3300049822 | Bacteria | 9468 |
| 245 | Ga0501044_0002673 | 3300049823 | Bacteria | 20286 |
| 246 | Ga0501044_0100133 | 3300049823 | Bacteria | 2916 |
| 247 | Ga0501044_0255863 | 3300049823 | Bacteria | 1690 |
| 248 | Ga0501284_00097 | 3300050005 | Bacteria | 18407 |
| 249 | nmdc:mga03683_67267_c1 | 3300050489 | Bacteria | 1525 |
| 250 | nmdc:mga03n38_136575_c1 | 3300050490 | Bacteria | 1221 |
| 251 | nmdc:mga03n38_337090_c1 | 3300050490 | Bacteria | 818 |
| 252 | nmdc:mga0yw44_167669_c1 | 3300050492 | Bacteria | 1441 |
| 253 | nmdc:mga0k408_32725_c1 | 3300050493 | Bacteria | 2970 |
| 254 | nmdc:mga06z11_238833_c1 | 3300050494 | Bacteria | 1067 |
| 255 | nmdc:mga06z11_256866_c1 | 3300050494 | Bacteria | 1030 |
| 256 | nmdc:mga07m45_105689_c1 | 3300050496 | Bacteria | 1619 |
| 257 | nmdc:mga07m45_291212_c1 | 3300050496 | Bacteria | 950 |
| 258 | nmdc:mga0qj67_371601_c1 | 3300050509 | Bacteria | 1155 |
| 259 | nmdc:mga06r32_162279_c1 | 3300050510 | Bacteria | 2217 |
| 260 | nmdc:mga08y16_45037_c1 | 3300050511 | Bacteria | 4622 |
| 261 | nmdc:mga0n895_38693_c1 | 3300050512 | Bacteria | 4623 |
| 262 | nmdc:mga0rr50_28186_c1 | 3300050513 | Bacteria | 3945 |
| 263 | nmdc:mga08x19_15931_c1 | 3300050514 | Bacteria | 4580 |
| 264 | Ga0500635_0002087 | 3300053080 | Bacteria | 4900 |
| 265 | Ga0495655_0010486 | 3300053083 | Bacteria | 1831 |
| 266 | Ga0495595_0121249 | 3300053084 | Bacteria | 1274 |
| 267 | Ga0500646_0023159 | 3300053090 | Bacteria | 1664 |
| 268 | Ga0500641_0003314 | 3300053096 | Bacteria | 5698 |
| 269 | Ga0500650_0244833 | 3300053098 | Bacteria | 806 |
| 270 | Ga0500589_002635 | 3300053147 | Bacteria | 6104 |
| 271 | Ga0500620_169862 | 3300053155 | Bacteria | 754 |
| 272 | Ga0500622_0113876 | 3300053156 | Bacteria | 1318 |
| 273 | Ga0500636_0128894 | 3300053177 | Bacteria | 1412 |
| 274 | Ga0501084_0351114 | 3300054114 | Bacteria | 1246 |
| 275 | Ga0587062_048556 | 3300059639 | Bacteria | 712 |
| 276 | Ga0530510_0686317 | 3300061734 | Bacteria | 780 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100027083 | Ga0070670_1000270837 | 162 |
| 2 | 3300005338 | Ga0068868_100008647 | Ga0068868_1000086473 | 162 |
| 3 | 3300005355 | Ga0070671_100243352 | Ga0070671_1002433523 | 162 |
| 4 | 3300005834 | Ga0068851_10235789 | Ga0068851_102357892 | 162 |
| 5 | 3300025931 | Ga0207644_10018921 | Ga0207644_100189214 | 162 |
| 6 | 3300009036 | Ga0105244_10001335 | Ga0105244_1000133514 | 165 |
| 7 | iso_pu_bacteria | 2884215851 | 2884216342 | 165 |
| 8 | 3300002705 | JGI25156J39149_1002289 | JGI25156J39149_10022896 | 166 |
| 9 | 3300002741 | JGI25157J39369_1000068 | JGI25157J39369_10000685 | 166 |
| 10 | 3300002741 | JGI25157J39369_1000266 | JGI25157J39369_100026611 | 166 |
| 11 | 3300003752 | Ga0055539_1001285 | Ga0055539_10012854 | 166 |
| 12 | 3300003756 | Ga0055533_1003515 | Ga0055533_10035153 | 166 |
| 13 | 3300003760 | Ga0055527_1000066 | Ga0055527_100006670 | 166 |
| 14 | 3300003761 | Ga0055535_1000058 | Ga0055535_100005819 | 166 |
| 15 | 3300003762 | Ga0055542_1000085 | Ga0055542_100008519 | 166 |
| 16 | 3300003763 | Ga0055529_1000240 | Ga0055529_100024049 | 166 |
| 17 | 3300009148 | Ga0105243_10398597 | Ga0105243_103985971 | 166 |
| 18 | 3300025226 | Ga0209674_100202 | Ga0209674_10020248 | 166 |
| 19 | 3300025226 | Ga0209674_104336 | Ga0209674_1043364 | 166 |
| 20 | 3300025228 | Ga0209672_100018 | Ga0209672_100018212 | 166 |
| 21 | 3300025242 | Ga0209258_100024 | Ga0209258_100024318 | 166 |
| 22 | 3300025250 | Ga0209026_1000056 | Ga0209026_100005697 | 166 |
| 23 | 3300025253 | Ga0209677_103753 | Ga0209677_1037533 | 166 |
| 24 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009646 | 166 |
| 25 | 3300025256 | Ga0209759_1000317 | Ga0209759_100031736 | 166 |
| 26 | 3300025272 | Ga0209455_1000029 | Ga0209455_1000029318 | 166 |
| 27 | 3300026078 | Ga0207702_10001228 | Ga0207702_100012285 | 166 |
| 28 | 3300044656 | Ga0466969_0113154 | Ga0466969_0113154_381_938 | 166 |
| 29 | 3300044661 | Ga0466975_0314115 | Ga0466975_0314115_14_571 | 166 |
| 30 | 3300044684 | Ga0466966_0035631 | Ga0466966_0035631_15_521 | 166 |
| 31 | 3300044684 | Ga0466966_0333428 | Ga0466966_0333428_172_729 | 166 |
| 32 | 3300044693 | Ga0466961_0007297 | Ga0466961_0007297_3709_4215 | 166 |
| 33 | 3300044693 | Ga0466961_0029461 | Ga0466961_0029461_2693_3292 | 166 |
| 34 | 3300044765 | Ga0466970_0028026 | Ga0466970_0028026_2438_2944 | 166 |
| 35 | 3300044765 | Ga0466970_0045527 | Ga0466970_0045527_1290_1796 | 166 |
| 36 | 3300045049 | Ga0466959_0000007 | Ga0466959_0000007_10240_10797 | 166 |
| 37 | 3300045049 | Ga0466959_0018268 | Ga0466959_0018268_2933_3439 | 166 |
| 38 | 3300045836 | Ga0466958_0145458 | Ga0466958_0145458_61_603 | 166 |
| 39 | 3300005458 | Ga0070681_10526364 | Ga0070681_105263643 | 167 |
| 40 | 3300045049 | Ga0466959_0055920 | Ga0466959_0055920_1157_1666 | 167 |
| 41 | 3300046517 | Ga0495630_0407010 | Ga0495630_0407010_460_969 | 167 |
| 42 | 3300047469 | Ga0495673_0189358 | Ga0495673_0189358_163_672 | 167 |
| 43 | 3300049758 | Ga0501241_006508 | Ga0501241_006508_794_1345 | 167 |
| 44 | 3300050005 | Ga0501284_00097 | Ga0501284_00097_7532_8083 | 167 |
| 45 | 3300053080 | Ga0500635_0002087 | Ga0500635_0002087_4110_4619 | 167 |
| 46 | 3300053090 | Ga0500646_0023159 | Ga0500646_0023159_293_799 | 167 |
| 47 | 3300053098 | Ga0500650_0244833 | Ga0500650_0244833_123_632 | 167 |
| 48 | 3300053147 | Ga0500589_002635 | Ga0500589_002635_4500_5006 | 167 |
| 49 | 3300053155 | Ga0500620_169862 | Ga0500620_169862_211_720 | 167 |
| 50 | 3300053156 | Ga0500622_0113876 | Ga0500622_0113876_525_1031 | 167 |
| 51 | 3300002067 | JGI24735J21928_10177750 | JGI24735J21928_101777501 | 168 |
| 52 | 3300005329 | Ga0070683_100016367 | Ga0070683_1000163673 | 168 |
| 53 | 3300005344 | Ga0070661_100759646 | Ga0070661_1007596461 | 168 |
| 54 | 3300005356 | Ga0070674_100398791 | Ga0070674_1003987912 | 168 |
| 55 | 3300005364 | Ga0070673_100352376 | Ga0070673_1003523763 | 168 |
| 56 | 3300005366 | Ga0070659_100006985 | Ga0070659_1000069853 | 168 |
| 57 | 3300005367 | Ga0070667_100005450 | Ga0070667_1000054502 | 168 |
| 58 | 3300005436 | Ga0070713_100012562 | Ga0070713_1000125627 | 168 |
| 59 | 3300005436 | Ga0070713_100624657 | Ga0070713_1006246571 | 168 |
| 60 | 3300005437 | Ga0070710_10090712 | Ga0070710_100907123 | 168 |
| 61 | 3300005441 | Ga0070700_100311577 | Ga0070700_1003115771 | 168 |
| 62 | 3300005445 | Ga0070708_100251115 | Ga0070708_1002511152 | 168 |
| 63 | 3300005456 | Ga0070678_100002075 | Ga0070678_10000207513 | 168 |
| 64 | 3300005457 | Ga0070662_100237595 | Ga0070662_1002375952 | 168 |
| 65 | 3300005458 | Ga0070681_10082630 | Ga0070681_100826302 | 168 |
| 66 | 3300005466 | Ga0070685_10021382 | Ga0070685_100213823 | 168 |
| 67 | 3300005467 | Ga0070706_100055270 | Ga0070706_1000552702 | 168 |
| 68 | 3300005467 | Ga0070706_100062865 | Ga0070706_1000628654 | 168 |
| 69 | 3300005467 | Ga0070706_100306476 | Ga0070706_1003064762 | 168 |
| 70 | 3300005468 | Ga0070707_100062600 | Ga0070707_1000626007 | 168 |
| 71 | 3300005471 | Ga0070698_100002746 | Ga0070698_1000027469 | 168 |
| 72 | 3300005518 | Ga0070699_100105209 | Ga0070699_1001052092 | 168 |
| 73 | 3300005518 | Ga0070699_100400107 | Ga0070699_1004001072 | 168 |
| 74 | 3300005530 | Ga0070679_100301816 | Ga0070679_1003018161 | 168 |
| 75 | 3300005536 | Ga0070697_100696954 | Ga0070697_1006969541 | 168 |
| 76 | 3300005536 | Ga0070697_100737363 | Ga0070697_1007373632 | 168 |
| 77 | 3300005536 | Ga0070697_101198863 | Ga0070697_1011988631 | 168 |
| 78 | 3300005548 | Ga0070665_100092116 | Ga0070665_1000921163 | 168 |
| 79 | 3300005564 | Ga0070664_100029820 | Ga0070664_1000298205 | 168 |
| 80 | 3300005577 | Ga0068857_100032306 | Ga0068857_1000323066 | 168 |
| 81 | 3300005577 | Ga0068857_100329451 | Ga0068857_1003294512 | 168 |
| 82 | 3300005577 | Ga0068857_100547964 | Ga0068857_1005479642 | 168 |
| 83 | 3300005578 | Ga0068854_100148239 | Ga0068854_1001482392 | 168 |
| 84 | 3300005614 | Ga0068856_100003141 | Ga0068856_10000314115 | 168 |
| 85 | 3300005614 | Ga0068856_100885900 | Ga0068856_1008859002 | 168 |
| 86 | 3300005618 | Ga0068864_100401243 | Ga0068864_1004012432 | 168 |
| 87 | 3300005834 | Ga0068851_10465984 | Ga0068851_104659841 | 168 |
| 88 | 3300005840 | Ga0068870_10909229 | Ga0068870_109092291 | 168 |
| 89 | 3300005842 | Ga0068858_100360483 | Ga0068858_1003604832 | 168 |
| 90 | 3300005843 | Ga0068860_100660138 | Ga0068860_1006601382 | 168 |
| 91 | 3300005937 | Ga0081455_10006928 | Ga0081455_100069287 | 168 |
| 92 | 3300005983 | Ga0081540_1036249 | Ga0081540_10362492 | 168 |
| 93 | 3300006028 | Ga0070717_10109680 | Ga0070717_101096803 | 168 |
| 94 | 3300006028 | Ga0070717_10540521 | Ga0070717_105405212 | 168 |
| 95 | 3300006048 | Ga0075363_100025257 | Ga0075363_1000252573 | 168 |
| 96 | 3300006048 | Ga0075363_100057664 | Ga0075363_1000576642 | 168 |
| 97 | 3300006051 | Ga0075364_10377680 | Ga0075364_103776802 | 168 |
| 98 | 3300006173 | Ga0070716_100251164 | Ga0070716_1002511642 | 168 |
| 99 | 3300006177 | Ga0075362_10044808 | Ga0075362_100448082 | 168 |
| 100 | 3300006178 | Ga0075367_10090398 | Ga0075367_100903983 | 168 |
| 101 | 3300006178 | Ga0075367_10146372 | Ga0075367_101463721 | 168 |
| 102 | 3300006195 | Ga0075366_10082761 | Ga0075366_100827613 | 168 |
| 103 | 3300006237 | Ga0097621_100034374 | Ga0097621_1000343742 | 168 |
| 104 | 3300006353 | Ga0075370_10028523 | Ga0075370_100285233 | 168 |
| 105 | 3300006353 | Ga0075370_10098036 | Ga0075370_100980362 | 168 |
| 106 | 3300006358 | Ga0068871_100032739 | Ga0068871_1000327394 | 168 |
| 107 | 3300006844 | Ga0075428_100590350 | Ga0075428_1005903501 | 168 |
| 108 | 3300006846 | Ga0075430_100386613 | Ga0075430_1003866132 | 168 |
| 109 | 3300006852 | Ga0075433_10005609 | Ga0075433_100056099 | 168 |
| 110 | 3300006852 | Ga0075433_10099113 | Ga0075433_100991133 | 168 |
| 111 | 3300006871 | Ga0075434_100026370 | Ga0075434_10002637010 | 168 |
| 112 | 3300006914 | Ga0075436_100084393 | Ga0075436_1000843933 | 168 |
| 113 | 3300006944 | Ga0099823_1026356 | Ga0099823_10263565 | 168 |
| 114 | 3300007076 | Ga0075435_100003546 | Ga0075435_10000354612 | 168 |
| 115 | 3300007788 | Ga0099795_10095614 | Ga0099795_100956141 | 168 |
| 116 | 3300009011 | Ga0105251_10019025 | Ga0105251_100190252 | 168 |
| 117 | 3300009093 | Ga0105240_10147437 | Ga0105240_101474374 | 168 |
| 118 | 3300009093 | Ga0105240_11155974 | Ga0105240_111559741 | 168 |
| 119 | 3300009094 | Ga0111539_10026113 | Ga0111539_100261134 | 168 |
| 120 | 3300009176 | Ga0105242_10669536 | Ga0105242_106695362 | 168 |
| 121 | 3300009545 | Ga0105237_10033579 | Ga0105237_100335794 | 168 |
| 122 | 3300009551 | Ga0105238_10372533 | Ga0105238_103725332 | 168 |
| 123 | 3300010375 | Ga0105239_10546687 | Ga0105239_105466872 | 168 |
| 124 | 3300010375 | Ga0105239_10643037 | Ga0105239_106430372 | 168 |
| 125 | 3300013100 | Ga0157373_10178050 | Ga0157373_101780502 | 168 |
| 126 | 3300013102 | Ga0157371_10049207 | Ga0157371_100492073 | 168 |
| 127 | 3300013105 | Ga0157369_10055533 | Ga0157369_100555333 | 168 |
| 128 | 3300013105 | Ga0157369_10283389 | Ga0157369_102833892 | 168 |
| 129 | 3300013105 | Ga0157369_10468601 | Ga0157369_104686013 | 168 |
| 130 | 3300013307 | Ga0157372_10084164 | Ga0157372_100841644 | 168 |
| 131 | 3300013307 | Ga0157372_10447983 | Ga0157372_104479832 | 168 |
| 132 | 3300014325 | Ga0163163_10197322 | Ga0163163_101973224 | 168 |
| 133 | 3300014325 | Ga0163163_11110245 | Ga0163163_111102452 | 168 |
| 134 | 3300020077 | Ga0206351_10217856 | Ga0206351_102178562 | 168 |
| 135 | 3300020080 | Ga0206350_10946734 | Ga0206350_109467342 | 168 |
| 136 | 3300020610 | Ga0154015_1675751 | Ga0154015_16757511 | 168 |
| 137 | 3300021384 | Ga0213876_10006811 | Ga0213876_100068116 | 168 |
| 138 | 3300021384 | Ga0213876_10460919 | Ga0213876_104609191 | 168 |
| 139 | 3300021388 | Ga0213875_10003100 | Ga0213875_100031006 | 168 |
| 140 | 3300021388 | Ga0213875_10006148 | Ga0213875_100061484 | 168 |
| 141 | 3300021388 | Ga0213875_10030009 | Ga0213875_100300092 | 168 |
| 142 | 3300021388 | Ga0213875_10042004 | Ga0213875_100420043 | 168 |
| 143 | 3300022467 | Ga0224712_10068479 | Ga0224712_100684792 | 168 |
| 144 | 3300022467 | Ga0224712_10100390 | Ga0224712_101003902 | 168 |
| 145 | 3300025908 | Ga0207643_10754950 | Ga0207643_107549501 | 168 |
| 146 | 3300025909 | Ga0207705_10633963 | Ga0207705_106339632 | 168 |
| 147 | 3300025910 | Ga0207684_10163112 | Ga0207684_101631121 | 168 |
| 148 | 3300025910 | Ga0207684_10187179 | Ga0207684_101871792 | 168 |
| 149 | 3300025912 | Ga0207707_10067302 | Ga0207707_100673022 | 168 |
| 150 | 3300025913 | Ga0207695_10551535 | Ga0207695_105515352 | 168 |
| 151 | 3300025915 | Ga0207693_10076676 | Ga0207693_100766765 | 168 |
| 152 | 3300025915 | Ga0207693_10187073 | Ga0207693_101870732 | 168 |
| 153 | 3300025920 | Ga0207649_10000153 | Ga0207649_1000015339 | 168 |
| 154 | 3300025922 | Ga0207646_10496748 | Ga0207646_104967481 | 168 |
| 155 | 3300025928 | Ga0207700_10407973 | Ga0207700_104079732 | 168 |
| 156 | 3300025928 | Ga0207700_10521933 | Ga0207700_105219332 | 168 |
| 157 | 3300025932 | Ga0207690_10166767 | Ga0207690_101667673 | 168 |
| 158 | 3300025939 | Ga0207665_10260602 | Ga0207665_102606022 | 168 |
| 159 | 3300025944 | Ga0207661_10001410 | Ga0207661_1000141017 | 168 |
| 160 | 3300025944 | Ga0207661_10045156 | Ga0207661_100451562 | 168 |
| 161 | 3300025944 | Ga0207661_10782406 | Ga0207661_107824062 | 168 |
| 162 | 3300025945 | Ga0207679_10102082 | Ga0207679_101020824 | 168 |
| 163 | 3300025945 | Ga0207679_10921820 | Ga0207679_109218201 | 168 |
| 164 | 3300025949 | Ga0207667_10076890 | Ga0207667_100768903 | 168 |
| 165 | 3300025986 | Ga0207658_10023473 | Ga0207658_100234732 | 168 |
| 166 | 3300025986 | Ga0207658_10670930 | Ga0207658_106709301 | 168 |
| 167 | 3300026035 | Ga0207703_10130459 | Ga0207703_101304593 | 168 |
| 168 | 3300026041 | Ga0207639_10742053 | Ga0207639_107420532 | 168 |
| 169 | 3300026067 | Ga0207678_10348232 | Ga0207678_103482322 | 168 |
| 170 | 3300026088 | Ga0207641_10574091 | Ga0207641_105740912 | 168 |
| 171 | 3300026095 | Ga0207676_10947023 | Ga0207676_109470232 | 168 |
| 172 | 3300026116 | Ga0207674_10035486 | Ga0207674_100354866 | 168 |
| 173 | 3300026116 | Ga0207674_10081837 | Ga0207674_100818371 | 168 |
| 174 | 3300026116 | Ga0207674_10462466 | Ga0207674_104624662 | 168 |
| 175 | 3300027296 | Ga0209389_1012813 | Ga0209389_10128135 | 168 |
| 176 | 3300027361 | Ga0209489_102408 | Ga0209489_10240852 | 168 |
| 177 | 3300028019 | Ga0224573_1002758 | Ga0224573_10027581 | 168 |
| 178 | 3300028379 | Ga0268266_10437240 | Ga0268266_104372402 | 168 |
| 179 | 3300035112 | Ga0373932_0025750 | Ga0373932_0025750_372_926 | 168 |
| 180 | 3300035119 | Ga0373956_0132710 | Ga0373956_0132710_41_547 | 168 |
| 181 | 3300035172 | Ga0373955_0084627 | Ga0373955_0084627_1065_1571 | 168 |
| 182 | 3300035692 | Ga0373935_0408981 | Ga0373935_0408981_96_602 | 168 |
| 183 | 3300036401 | Ga0373937_0096339 | Ga0373937_0096339_1048_1554 | 168 |
| 184 | 3300037068 | Ga0373925_0069861 | Ga0373925_0069861_2132_2638 | 168 |
| 185 | 3300037853 | Ga0436364_0152843 | Ga0436364_0152843_5248_5772 | 168 |
| 186 | 3300037853 | Ga0436364_0273122 | Ga0436364_0273122_1927_2451 | 168 |
| 187 | 3300037853 | Ga0436364_0854082 | Ga0436364_0854082_202_711 | 168 |
| 188 | 3300037853 | Ga0436364_1200124 | Ga0436364_1200124_2691_3203 | 168 |
| 189 | 3300037853 | Ga0436364_1460981 | Ga0436364_1460981_4781_5314 | 168 |
| 190 | 3300038443 | Ga0395901_0197387 | Ga0395901_0197387_873_1400 | 168 |
| 191 | 3300039437 | Ga0436365_0094414 | Ga0436365_0094414_13568_14077 | 168 |
| 192 | 3300039437 | Ga0436365_0209068 | Ga0436365_0209068_3902_4414 | 168 |
| 193 | 3300039438 | Ga0436360_0161702 | Ga0436360_0161702_472_993 | 168 |
| 194 | 3300039438 | Ga0436360_0579844 | Ga0436360_0579844_250_765 | 168 |
| 195 | 3300039447 | Ga0436361_0595889 | Ga0436361_0595889_157_678 | 168 |
| 196 | 3300039450 | Ga0436363_0544135 | Ga0436363_0544135_137_691 | 168 |
| 197 | 3300039450 | Ga0436363_1440963 | Ga0436363_1440963_28_540 | 168 |
| 198 | 3300044694 | Ga0466963_0412325 | Ga0466963_0412325_100_621 | 168 |
| 199 | 3300044719 | Ga0466971_0281360 | Ga0466971_0281360_236_760 | 168 |
| 200 | 3300046459 | Ga0495629_0227769 | Ga0495629_0227769_650_1156 | 168 |
| 201 | 3300046472 | Ga0495580_0073331 | Ga0495580_0073331_1579_2085 | 168 |
| 202 | 3300046475 | Ga0495639_0044922 | Ga0495639_0044922_393_899 | 168 |
| 203 | 3300046476 | Ga0495662_0047688 | Ga0495662_0047688_372_878 | 168 |
| 204 | 3300046477 | Ga0495664_0113577 | Ga0495664_0113577_79_585 | 168 |
| 205 | 3300046511 | Ga0495608_0378706 | Ga0495608_0378706_63_569 | 168 |
| 206 | 3300046511 | Ga0495608_0436701 | Ga0495608_0436701_65_571 | 168 |
| 207 | 3300046517 | Ga0495630_0090624 | Ga0495630_0090624_1680_2186 | 168 |
| 208 | 3300046517 | Ga0495630_0381450 | Ga0495630_0381450_262_768 | 168 |
| 209 | 3300046524 | Ga0495648_0001466 | Ga0495648_0001466_20777_21325 | 168 |
| 210 | 3300046535 | Ga0495586_0182825 | Ga0495586_0182825_526_1032 | 168 |
| 211 | 3300046536 | Ga0495587_0026591 | Ga0495587_0026591_1298_1804 | 168 |
| 212 | 3300046642 | Ga0495634_0047236 | Ga0495634_0047236_1840_2346 | 168 |
| 213 | 3300046680 | Ga0495646_0563769 | Ga0495646_0563769_20_541 | 168 |
| 214 | 3300046683 | Ga0495658_0796764 | Ga0495658_0796764_67_573 | 168 |
| 215 | 3300046689 | Ga0495613_0221307 | Ga0495613_0221307_332_838 | 168 |
| 216 | 3300046690 | Ga0495624_0061655 | Ga0495624_0061655_1185_1691 | 168 |
| 217 | 3300047317 | Ga0495604_0116739 | Ga0495604_0116739_337_843 | 168 |
| 218 | 3300047317 | Ga0495604_0719566 | Ga0495604_0719566_66_584 | 168 |
| 219 | 3300047319 | Ga0495674_0005933 | Ga0495674_0005933_7115_7621 | 168 |
| 220 | 3300047319 | Ga0495674_1248279 | Ga0495674_1248279_20_541 | 168 |
| 221 | 3300047321 | Ga0495676_0221428 | Ga0495676_0221428_644_1150 | 168 |
| 222 | 3300047321 | Ga0495676_0492925 | Ga0495676_0492925_66_584 | 168 |
| 223 | 3300047322 | Ga0495680_0535397 | Ga0495680_0535397_118_645 | 168 |
| 224 | 3300047469 | Ga0495673_0002107 | Ga0495673_0002107_6007_6555 | 168 |
| 225 | 3300048903 | Ga0496100_0025560 | Ga0496100_0025560_2332_2886 | 168 |
| 226 | 3300048907 | Ga0496104_0576832 | Ga0496104_0576832_332_883 | 168 |
| 227 | 3300048907 | Ga0496104_1265151 | Ga0496104_1265151_25_540 | 168 |
| 228 | 3300048910 | Ga0496107_0228825 | Ga0496107_0228825_700_1254 | 168 |
| 229 | 3300048911 | Ga0496108_1382416 | Ga0496108_1382416_39_578 | 168 |
| 230 | 3300048913 | Ga0496110_0452523 | Ga0496110_0452523_535_1086 | 168 |
| 231 | 3300048915 | Ga0496112_0046700 | Ga0496112_0046700_3144_3695 | 168 |
| 232 | 3300048915 | Ga0496112_0296823 | Ga0496112_0296823_689_1237 | 168 |
| 233 | 3300048915 | Ga0496112_1237588 | Ga0496112_1237588_13_567 | 168 |
| 234 | 3300048916 | Ga0496113_0003323 | Ga0496113_0003323_29_568 | 168 |
| 235 | 3300048916 | Ga0496113_0068949 | Ga0496113_0068949_2037_2546 | 168 |
| 236 | 3300048917 | Ga0496114_0813485 | Ga0496114_0813485_197_751 | 168 |
| 237 | 3300048929 | Ga0496126_0086313 | Ga0496126_0086313_1896_2423 | 168 |
| 238 | 3300048929 | Ga0496126_0295826 | Ga0496126_0295826_608_1123 | 168 |
| 239 | 3300049569 | Ga0501032_0085408 | Ga0501032_0085408_1232_1741 | 168 |
| 240 | 3300049570 | Ga0501033_0017812 | Ga0501033_0017812_4444_4965 | 168 |
| 241 | 3300049570 | Ga0501033_0032037 | Ga0501033_0032037_2193_2702 | 168 |
| 242 | 3300049573 | Ga0501037_0047104 | Ga0501037_0047104_2215_2724 | 168 |
| 243 | 3300049579 | Ga0501043_0018573 | Ga0501043_0018573_2235_2744 | 168 |
| 244 | 3300049579 | Ga0501043_0492687 | Ga0501043_0492687_73_594 | 168 |
| 245 | 3300049581 | Ga0501047_0099865 | Ga0501047_0099865_870_1379 | 168 |
| 246 | 3300049585 | Ga0501069_0157499 | Ga0501069_0157499_612_1139 | 168 |
| 247 | 3300049586 | Ga0501070_0192890 | Ga0501070_0192890_1124_1633 | 168 |
| 248 | 3300049587 | Ga0501071_0577365 | Ga0501071_0577365_252_761 | 168 |
| 249 | 3300049589 | Ga0501073_0124782 | Ga0501073_0124782_312_830 | 168 |
| 250 | 3300049591 | Ga0501075_0055251 | Ga0501075_0055251_148_708 | 168 |
| 251 | 3300049742 | Ga0501080_0455269 | Ga0501080_0455269_89_607 | 168 |
| 252 | 3300049822 | Ga0501035_0008664 | Ga0501035_0008664_4493_5002 | 168 |
| 253 | 3300049823 | Ga0501044_0002673 | Ga0501044_0002673_16059_16577 | 168 |
| 254 | 3300049823 | Ga0501044_0100133 | Ga0501044_0100133_1244_1753 | 168 |
| 255 | 3300049823 | Ga0501044_0255863 | Ga0501044_0255863_37_564 | 168 |
| 256 | 3300050489 | nmdc:mga03683_67267_c1 | nmdc:mga03683_67267_c1_935_1462 | 168 |
| 257 | 3300050490 | nmdc:mga03n38_136575_c1 | nmdc:mga03n38_136575_c1_352_903 | 168 |
| 258 | 3300050490 | nmdc:mga03n38_337090_c1 | nmdc:mga03n38_337090_c1_285_806 | 168 |
| 259 | 3300050492 | nmdc:mga0yw44_167669_c1 | nmdc:mga0yw44_167669_c1_753_1280 | 168 |
| 260 | 3300050493 | nmdc:mga0k408_32725_c1 | nmdc:mga0k408_32725_c1_1672_2199 | 168 |
| 261 | 3300050494 | nmdc:mga06z11_238833_c1 | nmdc:mga06z11_238833_c1_406_933 | 168 |
| 262 | 3300050494 | nmdc:mga06z11_256866_c1 | nmdc:mga06z11_256866_c1_64_693 | 168 |
| 263 | 3300050496 | nmdc:mga07m45_105689_c1 | nmdc:mga07m45_105689_c1_405_926 | 168 |
| 264 | 3300050496 | nmdc:mga07m45_291212_c1 | nmdc:mga07m45_291212_c1_223_750 | 168 |
| 265 | 3300050509 | nmdc:mga0qj67_371601_c1 | nmdc:mga0qj67_371601_c1_209_724 | 168 |
| 266 | 3300050510 | nmdc:mga06r32_162279_c1 | nmdc:mga06r32_162279_c1_1396_1911 | 168 |
| 267 | 3300050511 | nmdc:mga08y16_45037_c1 | nmdc:mga08y16_45037_c1_4088_4609 | 168 |
| 268 | 3300050512 | nmdc:mga0n895_38693_c1 | nmdc:mga0n895_38693_c1_1058_1579 | 168 |
| 269 | 3300050513 | nmdc:mga0rr50_28186_c1 | nmdc:mga0rr50_28186_c1_45_584 | 168 |
| 270 | 3300050514 | nmdc:mga08x19_15931_c1 | nmdc:mga08x19_15931_c1_3187_3708 | 168 |
| 271 | 3300053083 | Ga0495655_0010486 | Ga0495655_0010486_353_904 | 168 |
| 272 | 3300053084 | Ga0495595_0121249 | Ga0495595_0121249_339_860 | 168 |
| 273 | 3300053096 | Ga0500641_0003314 | Ga0500641_0003314_434_943 | 168 |
| 274 | 3300053177 | Ga0500636_0128894 | Ga0500636_0128894_651_1181 | 168 |
| 275 | 3300054114 | Ga0501084_0351114 | Ga0501084_0351114_396_956 | 168 |
| 276 | 3300059639 | Ga0587062_048556 | Ga0587062_048556_129_650 | 168 |
| 277 | 3300061734 | Ga0530510_0686317 | Ga0530510_0686317_106_666 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nwa-assembly1.cif.gz_A | structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine | 0.9741 | 2 | 165 |
| 4gwb-assembly1.cif.gz_A-2 | crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 | 0.967 | 4 | 166 |
| 4gwb-assembly1.cif.gz_A-2 | crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 | 0.9556 | 4 | 166 |
| 2j89-assembly1.cif.gz_A | functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases | 0.9455 | 3 | 144 |
| 5fa9-assembly1.cif.gz_A | bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola | 0.9452 | 2 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJM5_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9768 | 1 | 165 | 3.30.1060.10 |
| af_P9WJM5_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9653 | 1 | 165 | 3.30.1060.10 |
| af_P0A086_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.96 | 1 | 149 | 3.30.1060.10 |
| af_P0A084_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9429 | 1 | 149 | 3.30.1060.10 |
| af_Q09859_1_167_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9423 | 4 | 157 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1CN08-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9824 | 32 | 163 |
GO:0008113
|
| AF-A0A654U1B2-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.982 | 27 | 165 |
GO:0008113
GO:0033744 |
| AF-A0A1I7EE99-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9811 | 17 | 168 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-A0A4Q3HS60-F1-model_v4 | deleted | 0.9793 | 1 | 155 |
|
| AF-A0A0Q5L8H3-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9792 | 3 | 151 |
GO:0008113
GO:0033744 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar