F382054

General Info

Members Datasets Scaffolds Average Seq Length
277 208 276 174

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_256866_c1|nmdc:mga06z11_256866_c1_64_693
Length 209
Sequence VVRVASPRRHRPTTYRLRRDIDEHLPVDLISTEGHPVTNESETAILAGGCFWGMQDLFRRLPGVISTRVGYSGGDTVDATYRNHGGHAEALEVVFDPGVLSYRQLLEFFFQVHDPTTLNRQGNDVGDSYRSAIFYTSDEQRTVAQATVAEVDASGIWPGPVVTEVTAAGPFWEAEPEHQDYLERYPAGYTCHFVRPEWKLAPRAELPVD

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
197 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
203 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 2.17
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.08
Nodule 1.08
Rhizoplane 4.33
Rhizosphere 71.84
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10177750 3300002067 Bacteria 616
2 JGI25156J39149_1002289 3300002705 Bacteria 7027
3 JGI25157J39369_1000068 3300002741 Bacteria 94833
4 JGI25157J39369_1000266 3300002741 Bacteria 38247
5 Ga0055539_1001285 3300003752 Bacteria 4970
6 Ga0055533_1003515 3300003756 Bacteria 3117
7 Ga0055527_1000066 3300003760 Bacteria 88276
8 Ga0055535_1000058 3300003761 Bacteria 125370
9 Ga0055542_1000085 3300003762 Bacteria 125370
10 Ga0055529_1000240 3300003763 Bacteria 68255
11 Ga0070683_100016367 3300005329 Bacteria 6539
12 Ga0070670_100027083 3300005331 Unclassified 4930
13 Ga0068868_100008647 3300005338 Bacteria 7290
14 Ga0070661_100759646 3300005344 Bacteria 793
15 Ga0070671_100243352 3300005355 Bacteria 1527
16 Ga0070674_100398791 3300005356 Bacteria 1123
17 Ga0070673_100352376 3300005364 Bacteria 1307
18 Ga0070659_100006985 3300005366 Bacteria 8172
19 Ga0070667_100005450 3300005367 Bacteria 10629
20 Ga0070713_100012562 3300005436 Bacteria 6217
21 Ga0070713_100624657 3300005436 Bacteria 1025
22 Ga0070710_10090712 3300005437 Bacteria 1802
23 Ga0070700_100311577 3300005441 Bacteria 1153
24 Ga0070708_100251115 3300005445 Bacteria 1662
25 Ga0070678_100002075 3300005456 Bacteria 10873
26 Ga0070662_100237595 3300005457 Bacteria 1460
27 Ga0070681_10082630 3300005458 Bacteria 3167
28 Ga0070681_10526364 3300005458 Bacteria 1096
29 Ga0070685_10021382 3300005466 Bacteria 3516
30 Ga0070706_100055270 3300005467 Bacteria 3664
31 Ga0070706_100062865 3300005467 Bacteria 3430
32 Ga0070706_100306476 3300005467 Bacteria 1481
33 Ga0070707_100062600 3300005468 Bacteria 3569
34 Ga0070698_100002746 3300005471 Bacteria 19357
35 Ga0070699_100105209 3300005518 Bacteria 2475
36 Ga0070699_100400107 3300005518 Bacteria 1241
37 Ga0070679_100301816 3300005530 Bacteria 1552
38 Ga0070697_100696954 3300005536 Bacteria 896
39 Ga0070697_100737363 3300005536 Bacteria 870
40 Ga0070697_101198863 3300005536 Bacteria 676
41 Ga0070665_100092116 3300005548 Bacteria 3036
42 Ga0070664_100029820 3300005564 Bacteria 4548
43 Ga0068857_100032306 3300005577 Bacteria 4628
44 Ga0068857_100329451 3300005577 Bacteria 1411
45 Ga0068857_100547964 3300005577 Bacteria 1089
46 Ga0068854_100148239 3300005578 Bacteria 1806
47 Ga0068856_100003141 3300005614 Bacteria 16842
48 Ga0068856_100885900 3300005614 Bacteria 911
49 Ga0068864_100401243 3300005618 Bacteria 1303
50 Ga0068851_10235789 3300005834 Bacteria 1033
51 Ga0068851_10465984 3300005834 Bacteria 753
52 Ga0068870_10909229 3300005840 Bacteria 622
53 Ga0068858_100360483 3300005842 Bacteria 1393
54 Ga0068860_100660138 3300005843 Bacteria 1054
55 Ga0081455_10006928 3300005937 Bacteria 12055
56 Ga0081540_1036249 3300005983 Bacteria 2633
57 Ga0070717_10109680 3300006028 Bacteria 2353
58 Ga0070717_10540521 3300006028 Bacteria 1055
59 Ga0075363_100025257 3300006048 Bacteria 3028
60 Ga0075363_100057664 3300006048 Bacteria 2085
61 Ga0075364_10377680 3300006051 Bacteria 967
62 Ga0070716_100251164 3300006173 Bacteria 1205
63 Ga0075362_10044808 3300006177 Bacteria 1963
64 Ga0075367_10090398 3300006178 Bacteria 1862
65 Ga0075367_10146372 3300006178 Bacteria 1465
66 Ga0075366_10082761 3300006195 Bacteria 1918
67 Ga0097621_100034374 3300006237 Bacteria 4044
68 Ga0075370_10028523 3300006353 Bacteria 3103
69 Ga0075370_10098036 3300006353 Bacteria 1695
70 Ga0068871_100032739 3300006358 Bacteria 4109
71 Ga0075428_100590350 3300006844 Bacteria 1187
72 Ga0075430_100386613 3300006846 Bacteria 1155
73 Ga0075433_10005609 3300006852 Bacteria 9862
74 Ga0075433_10099113 3300006852 Bacteria 2579
75 Ga0075434_100026370 3300006871 Bacteria 5692
76 Ga0075436_100084393 3300006914 Bacteria 2204
77 Ga0099823_1026356 3300006944 Bacteria 5141
78 Ga0075435_100003546 3300007076 Bacteria 10597
79 Ga0099795_10095614 3300007788 Bacteria 1158
80 Ga0105251_10019025 3300009011 Bacteria 3637
81 Ga0105244_10001335 3300009036 Bacteria 20129
82 Ga0105240_10147437 3300009093 Bacteria 2806
83 Ga0105240_11155974 3300009093 Bacteria 821
84 Ga0111539_10026113 3300009094 Bacteria 7149
85 Ga0105243_10398597 3300009148 Bacteria 1278
86 Ga0105242_10669536 3300009176 Bacteria 1012
87 Ga0105237_10033579 3300009545 Bacteria 5199
88 Ga0105238_10372533 3300009551 Bacteria 1418
89 Ga0105239_10546687 3300010375 Bacteria 1319
90 Ga0105239_10643037 3300010375 Bacteria 1211
91 Ga0157373_10178050 3300013100 Bacteria 1497
92 Ga0157371_10049207 3300013102 Bacteria 2995
93 Ga0157369_10055533 3300013105 Bacteria 4275
94 Ga0157369_10283389 3300013105 Bacteria 1725
95 Ga0157369_10468601 3300013105 Bacteria 1304
96 Ga0157372_10084164 3300013307 Bacteria 3604
97 Ga0157372_10447983 3300013307 Bacteria 1504
98 Ga0163163_10197322 3300014325 Bacteria 2061
99 Ga0163163_11110245 3300014325 Bacteria 854
100 Ga0206351_10217856 3300020077 Bacteria 892
101 Ga0206350_10946734 3300020080 Bacteria 1197
102 Ga0154015_1675751 3300020610 Bacteria 945
103 Ga0213876_10006811 3300021384 Bacteria 6238
104 Ga0213876_10460919 3300021384 Bacteria 676
105 Ga0213875_10003100 3300021388 Bacteria 9586
106 Ga0213875_10006148 3300021388 Bacteria 6339
107 Ga0213875_10030009 3300021388 Bacteria 2577
108 Ga0213875_10042004 3300021388 Bacteria 2150
109 Ga0224712_10068479 3300022467 Bacteria 1435
110 Ga0224712_10100390 3300022467 Bacteria 1226
111 Ga0209674_100202 3300025226 Bacteria 61028
112 Ga0209674_104336 3300025226 Bacteria 2331
113 Ga0209672_100018 3300025228 Bacteria 432924
114 Ga0209258_100024 3300025242 Bacteria 542096
115 Ga0209026_1000056 3300025250 Bacteria 236450
116 Ga0209677_103753 3300025253 Bacteria 4734
117 Ga0209148_1000009 3300025254 Bacteria 1395625
118 Ga0209759_1000317 3300025256 Bacteria 64752
119 Ga0209455_1000029 3300025272 Bacteria 542096
120 Ga0207643_10754950 3300025908 Bacteria 630
121 Ga0207705_10633963 3300025909 Bacteria 831
122 Ga0207684_10163112 3300025910 Bacteria 1919
123 Ga0207684_10187179 3300025910 Bacteria 1785
124 Ga0207707_10067302 3300025912 Bacteria 3120
125 Ga0207695_10551535 3300025913 Bacteria 1034
126 Ga0207693_10076676 3300025915 Bacteria 2618
127 Ga0207693_10187073 3300025915 Bacteria 1630
128 Ga0207649_10000153 3300025920 Bacteria 56646
129 Ga0207646_10496748 3300025922 Bacteria 1099
130 Ga0207700_10407973 3300025928 Bacteria 1191
131 Ga0207700_10521933 3300025928 Bacteria 1052
132 Ga0207644_10018921 3300025931 Bacteria 4669
133 Ga0207690_10166767 3300025932 Bacteria 1646
134 Ga0207665_10260602 3300025939 Bacteria 1284
135 Ga0207661_10001410 3300025944 Bacteria 16200
136 Ga0207661_10045156 3300025944 Bacteria 3485
137 Ga0207661_10782406 3300025944 Bacteria 878
138 Ga0207679_10102082 3300025945 Bacteria 2245
139 Ga0207679_10921820 3300025945 Bacteria 799
140 Ga0207667_10076890 3300025949 Bacteria 3463
141 Ga0207658_10023473 3300025986 Bacteria 4305
142 Ga0207658_10670930 3300025986 Bacteria 935
143 Ga0207703_10130459 3300026035 Bacteria 2170
144 Ga0207639_10742053 3300026041 Bacteria 913
145 Ga0207678_10348232 3300026067 Bacteria 1277
146 Ga0207702_10001228 3300026078 Bacteria 25915
147 Ga0207641_10574091 3300026088 Bacteria 1102
148 Ga0207676_10947023 3300026095 Bacteria 846
149 Ga0207674_10035486 3300026116 Bacteria 5204
150 Ga0207674_10081837 3300026116 Bacteria 3230
151 Ga0207674_10462466 3300026116 Bacteria 1226
152 Ga0209389_1012813 3300027296 Bacteria 7616
153 Ga0209489_102408 3300027361 Bacteria 38192
154 Ga0224573_1002758 3300028019 Bacteria 1308
155 Ga0268266_10437240 3300028379 Bacteria 1242
156 Ga0373932_0025750 3300035112 Bacteria 1595
157 Ga0373956_0132710 3300035119 Unclassified 1167
158 Ga0373955_0084627 3300035172 Bacteria 1799
159 Ga0373935_0408981 3300035692 Bacteria 975
160 Ga0373937_0096339 3300036401 Bacteria 2744
161 Ga0373925_0069861 3300037068 Bacteria 2654
162 Ga0436364_0152843 3300037853 Bacteria 5799
163 Ga0436364_0273122 3300037853 Bacteria 2816
164 Ga0436364_0854082 3300037853 Bacteria 7789
165 Ga0436364_1200124 3300037853 Bacteria 4770
166 Ga0436364_1460981 3300037853 Bacteria 9075
167 Ga0395901_0197387 3300038443 Bacteria 2110
168 Ga0436365_0094414 3300039437 Bacteria 27854
169 Ga0436365_0209068 3300039437 Bacteria 6978
170 Ga0436360_0161702 3300039438 Bacteria 5155
171 Ga0436360_0579844 3300039438 Bacteria 1233
172 Ga0436361_0595889 3300039447 Bacteria 1834
173 Ga0436363_0544135 3300039450 Bacteria 948
174 Ga0436363_1440963 3300039450 Bacteria 698
175 Ga0466969_0113154 3300044656 Bacteria 1268
176 Ga0466975_0314115 3300044661 Bacteria 1001
177 Ga0466966_0035631 3300044684 Bacteria 3213
178 Ga0466966_0333428 3300044684 Bacteria 911
179 Ga0466961_0007297 3300044693 Bacteria 7033
180 Ga0466961_0029461 3300044693 Bacteria 3528
181 Ga0466963_0412325 3300044694 Bacteria 953
182 Ga0466971_0281360 3300044719 Bacteria 796
183 Ga0466970_0028026 3300044765 Bacteria 2958
184 Ga0466970_0045527 3300044765 Bacteria 2336
185 Ga0466959_0000007 3300045049 Bacteria 184664
186 Ga0466959_0018268 3300045049 Bacteria 5148
187 Ga0466959_0055920 3300045049 Bacteria 2880
188 Ga0466958_0145458 3300045836 Bacteria 1494
189 Ga0495629_0227769 3300046459 Unclassified 1285
190 Ga0495580_0073331 3300046472 Bacteria 2390
191 Ga0495639_0044922 3300046475 Bacteria 1998
192 Ga0495662_0047688 3300046476 Bacteria 2068
193 Ga0495664_0113577 3300046477 Bacteria 1636
194 Ga0495608_0378706 3300046511 Unclassified 868
195 Ga0495608_0436701 3300046511 Unclassified 798
196 Ga0495630_0090624 3300046517 Bacteria 2310
197 Ga0495630_0381450 3300046517 Bacteria 1080
198 Ga0495630_0407010 3300046517 Bacteria 1042
199 Ga0495648_0001466 3300046524 Bacteria 23072
200 Ga0495586_0182825 3300046535 Unclassified 1186
201 Ga0495587_0026591 3300046536 Bacteria 3528
202 Ga0495634_0047236 3300046642 Bacteria 2902
203 Ga0495646_0563769 3300046680 Bacteria 581
204 Ga0495658_0796764 3300046683 Unclassified 605
205 Ga0495613_0221307 3300046689 Bacteria 1329
206 Ga0495624_0061655 3300046690 Bacteria 2349
207 Ga0495604_0116739 3300047317 Bacteria 1937
208 Ga0495604_0719566 3300047317 Bacteria 633
209 Ga0495674_0005933 3300047319 Bacteria 11724
210 Ga0495674_1248279 3300047319 Bacteria 560
211 Ga0495676_0221428 3300047321 Bacteria 1304
212 Ga0495676_0492925 3300047321 Bacteria 805
213 Ga0495680_0535397 3300047322 Bacteria 791
214 Ga0495673_0002107 3300047469 Bacteria 14477
215 Ga0495673_0189358 3300047469 Bacteria 775
216 Ga0496100_0025560 3300048903 Bacteria 3613
217 Ga0496104_0576832 3300048907 Bacteria 1035
218 Ga0496104_1265151 3300048907 Unclassified 641
219 Ga0496107_0228825 3300048910 Bacteria 1383
220 Ga0496108_1382416 3300048911 Bacteria 589
221 Ga0496110_0452523 3300048913 Bacteria 1170
222 Ga0496112_0046700 3300048915 Bacteria 4248
223 Ga0496112_0296823 3300048915 Bacteria 1562
224 Ga0496112_1237588 3300048915 Bacteria 663
225 Ga0496113_0003323 3300048916 Bacteria 9605
226 Ga0496113_0068949 3300048916 Bacteria 2685
227 Ga0496114_0813485 3300048917 Bacteria 813
228 Ga0496126_0086313 3300048929 Bacteria 2766
229 Ga0496126_0295826 3300048929 Bacteria 1337
230 Ga0501032_0085408 3300049569 Bacteria 2098
231 Ga0501033_0017812 3300049570 Bacteria 5363
232 Ga0501033_0032037 3300049570 Bacteria 3946
233 Ga0501037_0047104 3300049573 Bacteria 3161
234 Ga0501043_0018573 3300049579 Bacteria 5455
235 Ga0501043_0492687 3300049579 Bacteria 916
236 Ga0501047_0099865 3300049581 Bacteria 2781
237 Ga0501069_0157499 3300049585 Bacteria 1307
238 Ga0501070_0192890 3300049586 Bacteria 1674
239 Ga0501071_0577365 3300049587 Bacteria 864
240 Ga0501073_0124782 3300049589 Bacteria 1785
241 Ga0501075_0055251 3300049591 Bacteria 2988
242 Ga0501080_0455269 3300049742 Bacteria 1147
243 Ga0501241_006508 3300049758 Bacteria 2151
244 Ga0501035_0008664 3300049822 Bacteria 9468
245 Ga0501044_0002673 3300049823 Bacteria 20286
246 Ga0501044_0100133 3300049823 Bacteria 2916
247 Ga0501044_0255863 3300049823 Bacteria 1690
248 Ga0501284_00097 3300050005 Bacteria 18407
249 nmdc:mga03683_67267_c1 3300050489 Bacteria 1525
250 nmdc:mga03n38_136575_c1 3300050490 Bacteria 1221
251 nmdc:mga03n38_337090_c1 3300050490 Bacteria 818
252 nmdc:mga0yw44_167669_c1 3300050492 Bacteria 1441
253 nmdc:mga0k408_32725_c1 3300050493 Bacteria 2970
254 nmdc:mga06z11_238833_c1 3300050494 Bacteria 1067
255 nmdc:mga06z11_256866_c1 3300050494 Bacteria 1030
256 nmdc:mga07m45_105689_c1 3300050496 Bacteria 1619
257 nmdc:mga07m45_291212_c1 3300050496 Bacteria 950
258 nmdc:mga0qj67_371601_c1 3300050509 Bacteria 1155
259 nmdc:mga06r32_162279_c1 3300050510 Bacteria 2217
260 nmdc:mga08y16_45037_c1 3300050511 Bacteria 4622
261 nmdc:mga0n895_38693_c1 3300050512 Bacteria 4623
262 nmdc:mga0rr50_28186_c1 3300050513 Bacteria 3945
263 nmdc:mga08x19_15931_c1 3300050514 Bacteria 4580
264 Ga0500635_0002087 3300053080 Bacteria 4900
265 Ga0495655_0010486 3300053083 Bacteria 1831
266 Ga0495595_0121249 3300053084 Bacteria 1274
267 Ga0500646_0023159 3300053090 Bacteria 1664
268 Ga0500641_0003314 3300053096 Bacteria 5698
269 Ga0500650_0244833 3300053098 Bacteria 806
270 Ga0500589_002635 3300053147 Bacteria 6104
271 Ga0500620_169862 3300053155 Bacteria 754
272 Ga0500622_0113876 3300053156 Bacteria 1318
273 Ga0500636_0128894 3300053177 Bacteria 1412
274 Ga0501084_0351114 3300054114 Bacteria 1246
275 Ga0587062_048556 3300059639 Bacteria 712
276 Ga0530510_0686317 3300061734 Bacteria 780

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100027083 Ga0070670_1000270837 162
2 3300005338 Ga0068868_100008647 Ga0068868_1000086473 162
3 3300005355 Ga0070671_100243352 Ga0070671_1002433523 162
4 3300005834 Ga0068851_10235789 Ga0068851_102357892 162
5 3300025931 Ga0207644_10018921 Ga0207644_100189214 162
6 3300009036 Ga0105244_10001335 Ga0105244_1000133514 165
7 iso_pu_bacteria 2884215851 2884216342 165
8 3300002705 JGI25156J39149_1002289 JGI25156J39149_10022896 166
9 3300002741 JGI25157J39369_1000068 JGI25157J39369_10000685 166
10 3300002741 JGI25157J39369_1000266 JGI25157J39369_100026611 166
11 3300003752 Ga0055539_1001285 Ga0055539_10012854 166
12 3300003756 Ga0055533_1003515 Ga0055533_10035153 166
13 3300003760 Ga0055527_1000066 Ga0055527_100006670 166
14 3300003761 Ga0055535_1000058 Ga0055535_100005819 166
15 3300003762 Ga0055542_1000085 Ga0055542_100008519 166
16 3300003763 Ga0055529_1000240 Ga0055529_100024049 166
17 3300009148 Ga0105243_10398597 Ga0105243_103985971 166
18 3300025226 Ga0209674_100202 Ga0209674_10020248 166
19 3300025226 Ga0209674_104336 Ga0209674_1043364 166
20 3300025228 Ga0209672_100018 Ga0209672_100018212 166
21 3300025242 Ga0209258_100024 Ga0209258_100024318 166
22 3300025250 Ga0209026_1000056 Ga0209026_100005697 166
23 3300025253 Ga0209677_103753 Ga0209677_1037533 166
24 3300025254 Ga0209148_1000009 Ga0209148_1000009646 166
25 3300025256 Ga0209759_1000317 Ga0209759_100031736 166
26 3300025272 Ga0209455_1000029 Ga0209455_1000029318 166
27 3300026078 Ga0207702_10001228 Ga0207702_100012285 166
28 3300044656 Ga0466969_0113154 Ga0466969_0113154_381_938 166
29 3300044661 Ga0466975_0314115 Ga0466975_0314115_14_571 166
30 3300044684 Ga0466966_0035631 Ga0466966_0035631_15_521 166
31 3300044684 Ga0466966_0333428 Ga0466966_0333428_172_729 166
32 3300044693 Ga0466961_0007297 Ga0466961_0007297_3709_4215 166
33 3300044693 Ga0466961_0029461 Ga0466961_0029461_2693_3292 166
34 3300044765 Ga0466970_0028026 Ga0466970_0028026_2438_2944 166
35 3300044765 Ga0466970_0045527 Ga0466970_0045527_1290_1796 166
36 3300045049 Ga0466959_0000007 Ga0466959_0000007_10240_10797 166
37 3300045049 Ga0466959_0018268 Ga0466959_0018268_2933_3439 166
38 3300045836 Ga0466958_0145458 Ga0466958_0145458_61_603 166
39 3300005458 Ga0070681_10526364 Ga0070681_105263643 167
40 3300045049 Ga0466959_0055920 Ga0466959_0055920_1157_1666 167
41 3300046517 Ga0495630_0407010 Ga0495630_0407010_460_969 167
42 3300047469 Ga0495673_0189358 Ga0495673_0189358_163_672 167
43 3300049758 Ga0501241_006508 Ga0501241_006508_794_1345 167
44 3300050005 Ga0501284_00097 Ga0501284_00097_7532_8083 167
45 3300053080 Ga0500635_0002087 Ga0500635_0002087_4110_4619 167
46 3300053090 Ga0500646_0023159 Ga0500646_0023159_293_799 167
47 3300053098 Ga0500650_0244833 Ga0500650_0244833_123_632 167
48 3300053147 Ga0500589_002635 Ga0500589_002635_4500_5006 167
49 3300053155 Ga0500620_169862 Ga0500620_169862_211_720 167
50 3300053156 Ga0500622_0113876 Ga0500622_0113876_525_1031 167
51 3300002067 JGI24735J21928_10177750 JGI24735J21928_101777501 168
52 3300005329 Ga0070683_100016367 Ga0070683_1000163673 168
53 3300005344 Ga0070661_100759646 Ga0070661_1007596461 168
54 3300005356 Ga0070674_100398791 Ga0070674_1003987912 168
55 3300005364 Ga0070673_100352376 Ga0070673_1003523763 168
56 3300005366 Ga0070659_100006985 Ga0070659_1000069853 168
57 3300005367 Ga0070667_100005450 Ga0070667_1000054502 168
58 3300005436 Ga0070713_100012562 Ga0070713_1000125627 168
59 3300005436 Ga0070713_100624657 Ga0070713_1006246571 168
60 3300005437 Ga0070710_10090712 Ga0070710_100907123 168
61 3300005441 Ga0070700_100311577 Ga0070700_1003115771 168
62 3300005445 Ga0070708_100251115 Ga0070708_1002511152 168
63 3300005456 Ga0070678_100002075 Ga0070678_10000207513 168
64 3300005457 Ga0070662_100237595 Ga0070662_1002375952 168
65 3300005458 Ga0070681_10082630 Ga0070681_100826302 168
66 3300005466 Ga0070685_10021382 Ga0070685_100213823 168
67 3300005467 Ga0070706_100055270 Ga0070706_1000552702 168
68 3300005467 Ga0070706_100062865 Ga0070706_1000628654 168
69 3300005467 Ga0070706_100306476 Ga0070706_1003064762 168
70 3300005468 Ga0070707_100062600 Ga0070707_1000626007 168
71 3300005471 Ga0070698_100002746 Ga0070698_1000027469 168
72 3300005518 Ga0070699_100105209 Ga0070699_1001052092 168
73 3300005518 Ga0070699_100400107 Ga0070699_1004001072 168
74 3300005530 Ga0070679_100301816 Ga0070679_1003018161 168
75 3300005536 Ga0070697_100696954 Ga0070697_1006969541 168
76 3300005536 Ga0070697_100737363 Ga0070697_1007373632 168
77 3300005536 Ga0070697_101198863 Ga0070697_1011988631 168
78 3300005548 Ga0070665_100092116 Ga0070665_1000921163 168
79 3300005564 Ga0070664_100029820 Ga0070664_1000298205 168
80 3300005577 Ga0068857_100032306 Ga0068857_1000323066 168
81 3300005577 Ga0068857_100329451 Ga0068857_1003294512 168
82 3300005577 Ga0068857_100547964 Ga0068857_1005479642 168
83 3300005578 Ga0068854_100148239 Ga0068854_1001482392 168
84 3300005614 Ga0068856_100003141 Ga0068856_10000314115 168
85 3300005614 Ga0068856_100885900 Ga0068856_1008859002 168
86 3300005618 Ga0068864_100401243 Ga0068864_1004012432 168
87 3300005834 Ga0068851_10465984 Ga0068851_104659841 168
88 3300005840 Ga0068870_10909229 Ga0068870_109092291 168
89 3300005842 Ga0068858_100360483 Ga0068858_1003604832 168
90 3300005843 Ga0068860_100660138 Ga0068860_1006601382 168
91 3300005937 Ga0081455_10006928 Ga0081455_100069287 168
92 3300005983 Ga0081540_1036249 Ga0081540_10362492 168
93 3300006028 Ga0070717_10109680 Ga0070717_101096803 168
94 3300006028 Ga0070717_10540521 Ga0070717_105405212 168
95 3300006048 Ga0075363_100025257 Ga0075363_1000252573 168
96 3300006048 Ga0075363_100057664 Ga0075363_1000576642 168
97 3300006051 Ga0075364_10377680 Ga0075364_103776802 168
98 3300006173 Ga0070716_100251164 Ga0070716_1002511642 168
99 3300006177 Ga0075362_10044808 Ga0075362_100448082 168
100 3300006178 Ga0075367_10090398 Ga0075367_100903983 168
101 3300006178 Ga0075367_10146372 Ga0075367_101463721 168
102 3300006195 Ga0075366_10082761 Ga0075366_100827613 168
103 3300006237 Ga0097621_100034374 Ga0097621_1000343742 168
104 3300006353 Ga0075370_10028523 Ga0075370_100285233 168
105 3300006353 Ga0075370_10098036 Ga0075370_100980362 168
106 3300006358 Ga0068871_100032739 Ga0068871_1000327394 168
107 3300006844 Ga0075428_100590350 Ga0075428_1005903501 168
108 3300006846 Ga0075430_100386613 Ga0075430_1003866132 168
109 3300006852 Ga0075433_10005609 Ga0075433_100056099 168
110 3300006852 Ga0075433_10099113 Ga0075433_100991133 168
111 3300006871 Ga0075434_100026370 Ga0075434_10002637010 168
112 3300006914 Ga0075436_100084393 Ga0075436_1000843933 168
113 3300006944 Ga0099823_1026356 Ga0099823_10263565 168
114 3300007076 Ga0075435_100003546 Ga0075435_10000354612 168
115 3300007788 Ga0099795_10095614 Ga0099795_100956141 168
116 3300009011 Ga0105251_10019025 Ga0105251_100190252 168
117 3300009093 Ga0105240_10147437 Ga0105240_101474374 168
118 3300009093 Ga0105240_11155974 Ga0105240_111559741 168
119 3300009094 Ga0111539_10026113 Ga0111539_100261134 168
120 3300009176 Ga0105242_10669536 Ga0105242_106695362 168
121 3300009545 Ga0105237_10033579 Ga0105237_100335794 168
122 3300009551 Ga0105238_10372533 Ga0105238_103725332 168
123 3300010375 Ga0105239_10546687 Ga0105239_105466872 168
124 3300010375 Ga0105239_10643037 Ga0105239_106430372 168
125 3300013100 Ga0157373_10178050 Ga0157373_101780502 168
126 3300013102 Ga0157371_10049207 Ga0157371_100492073 168
127 3300013105 Ga0157369_10055533 Ga0157369_100555333 168
128 3300013105 Ga0157369_10283389 Ga0157369_102833892 168
129 3300013105 Ga0157369_10468601 Ga0157369_104686013 168
130 3300013307 Ga0157372_10084164 Ga0157372_100841644 168
131 3300013307 Ga0157372_10447983 Ga0157372_104479832 168
132 3300014325 Ga0163163_10197322 Ga0163163_101973224 168
133 3300014325 Ga0163163_11110245 Ga0163163_111102452 168
134 3300020077 Ga0206351_10217856 Ga0206351_102178562 168
135 3300020080 Ga0206350_10946734 Ga0206350_109467342 168
136 3300020610 Ga0154015_1675751 Ga0154015_16757511 168
137 3300021384 Ga0213876_10006811 Ga0213876_100068116 168
138 3300021384 Ga0213876_10460919 Ga0213876_104609191 168
139 3300021388 Ga0213875_10003100 Ga0213875_100031006 168
140 3300021388 Ga0213875_10006148 Ga0213875_100061484 168
141 3300021388 Ga0213875_10030009 Ga0213875_100300092 168
142 3300021388 Ga0213875_10042004 Ga0213875_100420043 168
143 3300022467 Ga0224712_10068479 Ga0224712_100684792 168
144 3300022467 Ga0224712_10100390 Ga0224712_101003902 168
145 3300025908 Ga0207643_10754950 Ga0207643_107549501 168
146 3300025909 Ga0207705_10633963 Ga0207705_106339632 168
147 3300025910 Ga0207684_10163112 Ga0207684_101631121 168
148 3300025910 Ga0207684_10187179 Ga0207684_101871792 168
149 3300025912 Ga0207707_10067302 Ga0207707_100673022 168
150 3300025913 Ga0207695_10551535 Ga0207695_105515352 168
151 3300025915 Ga0207693_10076676 Ga0207693_100766765 168
152 3300025915 Ga0207693_10187073 Ga0207693_101870732 168
153 3300025920 Ga0207649_10000153 Ga0207649_1000015339 168
154 3300025922 Ga0207646_10496748 Ga0207646_104967481 168
155 3300025928 Ga0207700_10407973 Ga0207700_104079732 168
156 3300025928 Ga0207700_10521933 Ga0207700_105219332 168
157 3300025932 Ga0207690_10166767 Ga0207690_101667673 168
158 3300025939 Ga0207665_10260602 Ga0207665_102606022 168
159 3300025944 Ga0207661_10001410 Ga0207661_1000141017 168
160 3300025944 Ga0207661_10045156 Ga0207661_100451562 168
161 3300025944 Ga0207661_10782406 Ga0207661_107824062 168
162 3300025945 Ga0207679_10102082 Ga0207679_101020824 168
163 3300025945 Ga0207679_10921820 Ga0207679_109218201 168
164 3300025949 Ga0207667_10076890 Ga0207667_100768903 168
165 3300025986 Ga0207658_10023473 Ga0207658_100234732 168
166 3300025986 Ga0207658_10670930 Ga0207658_106709301 168
167 3300026035 Ga0207703_10130459 Ga0207703_101304593 168
168 3300026041 Ga0207639_10742053 Ga0207639_107420532 168
169 3300026067 Ga0207678_10348232 Ga0207678_103482322 168
170 3300026088 Ga0207641_10574091 Ga0207641_105740912 168
171 3300026095 Ga0207676_10947023 Ga0207676_109470232 168
172 3300026116 Ga0207674_10035486 Ga0207674_100354866 168
173 3300026116 Ga0207674_10081837 Ga0207674_100818371 168
174 3300026116 Ga0207674_10462466 Ga0207674_104624662 168
175 3300027296 Ga0209389_1012813 Ga0209389_10128135 168
176 3300027361 Ga0209489_102408 Ga0209489_10240852 168
177 3300028019 Ga0224573_1002758 Ga0224573_10027581 168
178 3300028379 Ga0268266_10437240 Ga0268266_104372402 168
179 3300035112 Ga0373932_0025750 Ga0373932_0025750_372_926 168
180 3300035119 Ga0373956_0132710 Ga0373956_0132710_41_547 168
181 3300035172 Ga0373955_0084627 Ga0373955_0084627_1065_1571 168
182 3300035692 Ga0373935_0408981 Ga0373935_0408981_96_602 168
183 3300036401 Ga0373937_0096339 Ga0373937_0096339_1048_1554 168
184 3300037068 Ga0373925_0069861 Ga0373925_0069861_2132_2638 168
185 3300037853 Ga0436364_0152843 Ga0436364_0152843_5248_5772 168
186 3300037853 Ga0436364_0273122 Ga0436364_0273122_1927_2451 168
187 3300037853 Ga0436364_0854082 Ga0436364_0854082_202_711 168
188 3300037853 Ga0436364_1200124 Ga0436364_1200124_2691_3203 168
189 3300037853 Ga0436364_1460981 Ga0436364_1460981_4781_5314 168
190 3300038443 Ga0395901_0197387 Ga0395901_0197387_873_1400 168
191 3300039437 Ga0436365_0094414 Ga0436365_0094414_13568_14077 168
192 3300039437 Ga0436365_0209068 Ga0436365_0209068_3902_4414 168
193 3300039438 Ga0436360_0161702 Ga0436360_0161702_472_993 168
194 3300039438 Ga0436360_0579844 Ga0436360_0579844_250_765 168
195 3300039447 Ga0436361_0595889 Ga0436361_0595889_157_678 168
196 3300039450 Ga0436363_0544135 Ga0436363_0544135_137_691 168
197 3300039450 Ga0436363_1440963 Ga0436363_1440963_28_540 168
198 3300044694 Ga0466963_0412325 Ga0466963_0412325_100_621 168
199 3300044719 Ga0466971_0281360 Ga0466971_0281360_236_760 168
200 3300046459 Ga0495629_0227769 Ga0495629_0227769_650_1156 168
201 3300046472 Ga0495580_0073331 Ga0495580_0073331_1579_2085 168
202 3300046475 Ga0495639_0044922 Ga0495639_0044922_393_899 168
203 3300046476 Ga0495662_0047688 Ga0495662_0047688_372_878 168
204 3300046477 Ga0495664_0113577 Ga0495664_0113577_79_585 168
205 3300046511 Ga0495608_0378706 Ga0495608_0378706_63_569 168
206 3300046511 Ga0495608_0436701 Ga0495608_0436701_65_571 168
207 3300046517 Ga0495630_0090624 Ga0495630_0090624_1680_2186 168
208 3300046517 Ga0495630_0381450 Ga0495630_0381450_262_768 168
209 3300046524 Ga0495648_0001466 Ga0495648_0001466_20777_21325 168
210 3300046535 Ga0495586_0182825 Ga0495586_0182825_526_1032 168
211 3300046536 Ga0495587_0026591 Ga0495587_0026591_1298_1804 168
212 3300046642 Ga0495634_0047236 Ga0495634_0047236_1840_2346 168
213 3300046680 Ga0495646_0563769 Ga0495646_0563769_20_541 168
214 3300046683 Ga0495658_0796764 Ga0495658_0796764_67_573 168
215 3300046689 Ga0495613_0221307 Ga0495613_0221307_332_838 168
216 3300046690 Ga0495624_0061655 Ga0495624_0061655_1185_1691 168
217 3300047317 Ga0495604_0116739 Ga0495604_0116739_337_843 168
218 3300047317 Ga0495604_0719566 Ga0495604_0719566_66_584 168
219 3300047319 Ga0495674_0005933 Ga0495674_0005933_7115_7621 168
220 3300047319 Ga0495674_1248279 Ga0495674_1248279_20_541 168
221 3300047321 Ga0495676_0221428 Ga0495676_0221428_644_1150 168
222 3300047321 Ga0495676_0492925 Ga0495676_0492925_66_584 168
223 3300047322 Ga0495680_0535397 Ga0495680_0535397_118_645 168
224 3300047469 Ga0495673_0002107 Ga0495673_0002107_6007_6555 168
225 3300048903 Ga0496100_0025560 Ga0496100_0025560_2332_2886 168
226 3300048907 Ga0496104_0576832 Ga0496104_0576832_332_883 168
227 3300048907 Ga0496104_1265151 Ga0496104_1265151_25_540 168
228 3300048910 Ga0496107_0228825 Ga0496107_0228825_700_1254 168
229 3300048911 Ga0496108_1382416 Ga0496108_1382416_39_578 168
230 3300048913 Ga0496110_0452523 Ga0496110_0452523_535_1086 168
231 3300048915 Ga0496112_0046700 Ga0496112_0046700_3144_3695 168
232 3300048915 Ga0496112_0296823 Ga0496112_0296823_689_1237 168
233 3300048915 Ga0496112_1237588 Ga0496112_1237588_13_567 168
234 3300048916 Ga0496113_0003323 Ga0496113_0003323_29_568 168
235 3300048916 Ga0496113_0068949 Ga0496113_0068949_2037_2546 168
236 3300048917 Ga0496114_0813485 Ga0496114_0813485_197_751 168
237 3300048929 Ga0496126_0086313 Ga0496126_0086313_1896_2423 168
238 3300048929 Ga0496126_0295826 Ga0496126_0295826_608_1123 168
239 3300049569 Ga0501032_0085408 Ga0501032_0085408_1232_1741 168
240 3300049570 Ga0501033_0017812 Ga0501033_0017812_4444_4965 168
241 3300049570 Ga0501033_0032037 Ga0501033_0032037_2193_2702 168
242 3300049573 Ga0501037_0047104 Ga0501037_0047104_2215_2724 168
243 3300049579 Ga0501043_0018573 Ga0501043_0018573_2235_2744 168
244 3300049579 Ga0501043_0492687 Ga0501043_0492687_73_594 168
245 3300049581 Ga0501047_0099865 Ga0501047_0099865_870_1379 168
246 3300049585 Ga0501069_0157499 Ga0501069_0157499_612_1139 168
247 3300049586 Ga0501070_0192890 Ga0501070_0192890_1124_1633 168
248 3300049587 Ga0501071_0577365 Ga0501071_0577365_252_761 168
249 3300049589 Ga0501073_0124782 Ga0501073_0124782_312_830 168
250 3300049591 Ga0501075_0055251 Ga0501075_0055251_148_708 168
251 3300049742 Ga0501080_0455269 Ga0501080_0455269_89_607 168
252 3300049822 Ga0501035_0008664 Ga0501035_0008664_4493_5002 168
253 3300049823 Ga0501044_0002673 Ga0501044_0002673_16059_16577 168
254 3300049823 Ga0501044_0100133 Ga0501044_0100133_1244_1753 168
255 3300049823 Ga0501044_0255863 Ga0501044_0255863_37_564 168
256 3300050489 nmdc:mga03683_67267_c1 nmdc:mga03683_67267_c1_935_1462 168
257 3300050490 nmdc:mga03n38_136575_c1 nmdc:mga03n38_136575_c1_352_903 168
258 3300050490 nmdc:mga03n38_337090_c1 nmdc:mga03n38_337090_c1_285_806 168
259 3300050492 nmdc:mga0yw44_167669_c1 nmdc:mga0yw44_167669_c1_753_1280 168
260 3300050493 nmdc:mga0k408_32725_c1 nmdc:mga0k408_32725_c1_1672_2199 168
261 3300050494 nmdc:mga06z11_238833_c1 nmdc:mga06z11_238833_c1_406_933 168
262 3300050494 nmdc:mga06z11_256866_c1 nmdc:mga06z11_256866_c1_64_693 168
263 3300050496 nmdc:mga07m45_105689_c1 nmdc:mga07m45_105689_c1_405_926 168
264 3300050496 nmdc:mga07m45_291212_c1 nmdc:mga07m45_291212_c1_223_750 168
265 3300050509 nmdc:mga0qj67_371601_c1 nmdc:mga0qj67_371601_c1_209_724 168
266 3300050510 nmdc:mga06r32_162279_c1 nmdc:mga06r32_162279_c1_1396_1911 168
267 3300050511 nmdc:mga08y16_45037_c1 nmdc:mga08y16_45037_c1_4088_4609 168
268 3300050512 nmdc:mga0n895_38693_c1 nmdc:mga0n895_38693_c1_1058_1579 168
269 3300050513 nmdc:mga0rr50_28186_c1 nmdc:mga0rr50_28186_c1_45_584 168
270 3300050514 nmdc:mga08x19_15931_c1 nmdc:mga08x19_15931_c1_3187_3708 168
271 3300053083 Ga0495655_0010486 Ga0495655_0010486_353_904 168
272 3300053084 Ga0495595_0121249 Ga0495595_0121249_339_860 168
273 3300053096 Ga0500641_0003314 Ga0500641_0003314_434_943 168
274 3300053177 Ga0500636_0128894 Ga0500636_0128894_651_1181 168
275 3300054114 Ga0501084_0351114 Ga0501084_0351114_396_956 168
276 3300059639 Ga0587062_048556 Ga0587062_048556_129_650 168
277 3300061734 Ga0530510_0686317 Ga0530510_0686317_106_666 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

43

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9741 2 165
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.967 4 166
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9556 4 166
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9455 3 144
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.9452 2 151
ID Description Score Start End Superfamily
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9768 1 165 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9653 1 165 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.96 1 149 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9429 1 149 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9423 4 157 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A3D1CN08-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9824 32 163 GO:0008113
AF-A0A654U1B2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.982 27 165 GO:0008113
GO:0033744
AF-A0A1I7EE99-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9811 17 168 GO:0008113
GO:0033744
GO:0036211
AF-A0A4Q3HS60-F1-model_v4 deleted 0.9793 1 155
AF-A0A0Q5L8H3-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9792 3 151 GO:0008113
GO:0033744

Feature Viewer

pLDDT pTM Quality
93.73 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map