F382007

General Info

Members Datasets Scaffolds Average Seq Length
277 174 554 258

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0209232|Ga0496109_0209232_825_1697
Length 290
Sequence MLMAGRRYDIGRKGQKQDNSALGRAMAMVRDLRRRCPWDRAQTRETLRPYLVEEALELDQALADGRQELIRDELSDLLLHLAFQLVIAEEQNEFSADQVAAQLEAKMRRRHPHLFDLGEAEPWEAIKRRERKGRLLDGLVPTLPTLLLAYRMQERAASVGFDWPDTKGPLEKVREEIAEVEEQLSMPTARPSEPLIDEIGDLLFAVINLARKAGVQPGPALDRANRKFGRRFERIEQLAAQRRIDIETAGLEVLDDLWNEAKKMERTETGDTADRDNRSLNRPDRKLGEG

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
149 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
150 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
151 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.86
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 11.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0209232 3300048912 Bacteria 1834
2 rootH1_10131485 3300003316 Unclassified 1222
3 rootL2_10220792 3300003322 Bacteria 3194
4 rootL2_10382120 3300003322 Bacteria 1166
5 rootH1_10399625 3300003323 Bacteria 1217
6 Ga0065715_10146073 3300005293 Unclassified 1787
7 Ga0070676_10003795 3300005328 Bacteria 7927
8 Ga0068869_100011063 3300005334 Bacteria 5909
9 Ga0068869_100281298 3300005334 Bacteria 1338
10 Ga0070666_10011121 3300005335 Bacteria 5640
11 Ga0070680_100049604 3300005336 Bacteria 3423
12 Ga0070689_100132468 3300005340 Unclassified 1999
13 Ga0070691_10020927 3300005341 Bacteria 3025
14 Ga0070669_100041204 3300005353 Bacteria 3358
15 Ga0070674_100004984 3300005356 Bacteria 7613
16 Ga0070673_100078031 3300005364 Bacteria 2678
17 Ga0070659_100121113 3300005366 Bacteria 2119
18 Ga0070711_100001482 3300005439 Bacteria 12864
19 Ga0070705_100016111 3300005440 Bacteria 3878
20 Ga0070705_100068336 3300005440 Unclassified 2138
21 Ga0070705_100127947 3300005440 Bacteria 1652
22 Ga0070700_100078550 3300005441 Bacteria 2125
23 Ga0070694_100073479 3300005444 Bacteria 2362
24 Ga0070694_100156056 3300005444 Unclassified 1671
25 Ga0070708_100089589 3300005445 Bacteria 2799
26 Ga0070708_100384495 3300005445 Bacteria 1323
27 Ga0070663_100327639 3300005455 Bacteria 1233
28 Ga0070663_100483980 3300005455 Bacteria 1025
29 Ga0070678_100462787 3300005456 Unclassified 1113
30 Ga0070662_100000813 3300005457 Bacteria 19207
31 Ga0070681_10032514 3300005458 Bacteria 5236
32 Ga0068867_100004349 3300005459 Bacteria 9973
33 Ga0070706_100019178 3300005467 Bacteria 6310
34 Ga0070707_100006681 3300005468 Bacteria 10686
35 Ga0070707_100011696 3300005468 Bacteria 8189
36 Ga0070707_100801581 3300005468 Bacteria 906
37 Ga0070698_100005117 3300005471 Bacteria 14353
38 Ga0070698_100037646 3300005471 Bacteria 4986
39 Ga0070698_100128533 3300005471 Bacteria 2490
40 Ga0070699_100000702 3300005518 Bacteria 31001
41 Ga0070699_100001217 3300005518 Bacteria 23786
42 Ga0070699_100004136 3300005518 Bacteria 12818
43 Ga0070699_100388549 3300005518 Bacteria 1261
44 Ga0070697_100029047 3300005536 Bacteria 4431
45 Ga0070697_100030087 3300005536 Bacteria 4360
46 Ga0070697_100485082 3300005536 Bacteria 1080
47 Ga0070695_100012520 3300005545 Bacteria 5091
48 Ga0070696_100007945 3300005546 Bacteria 7084
49 Ga0070696_100013353 3300005546 Bacteria 5511
50 Ga0070696_100024447 3300005546 Bacteria 4106
51 Ga0070696_100077710 3300005546 Bacteria 2346
52 Ga0070704_100025139 3300005549 Bacteria 3917
53 Ga0070704_100324597 3300005549 Unclassified 1291
54 Ga0068855_100357651 3300005563 Bacteria 1607
55 Ga0068854_100006006 3300005578 Bacteria 7691
56 Ga0070702_100002675 3300005615 Bacteria 7784
57 Ga0068859_100020024 3300005617 Bacteria 6719
58 Ga0068864_100109828 3300005618 Unclassified 2455
59 Ga0068866_10000905 3300005718 Bacteria 13049
60 Ga0068861_100025610 3300005719 Bacteria 4280
61 Ga0068870_10030889 3300005840 Bacteria 2711
62 Ga0068860_100046883 3300005843 Bacteria 4119
63 Ga0068862_100025357 3300005844 Bacteria 4978
64 Ga0068862_100065759 3300005844 Bacteria 3123
65 Ga0068862_100385018 3300005844 Bacteria 1309
66 Ga0070715_10099567 3300006163 Bacteria 1353
67 Ga0070712_100038681 3300006175 Bacteria 3261
68 Ga0075431_100002309 3300006847 Bacteria 18319
69 Ga0075431_100062767 3300006847 Bacteria 3834
70 Ga0075433_10121528 3300006852 Bacteria 2319
71 Ga0075433_10360902 3300006852 Bacteria 1283
72 Ga0075434_100015659 3300006871 Bacteria 7277
73 Ga0075434_100050554 3300006871 Bacteria 4130
74 Ga0075434_100237687 3300006871 Bacteria 1842
75 Ga0075434_100314311 3300006871 Unclassified 1587
76 Ga0075429_100021925 3300006880 Bacteria 5538
77 Ga0075429_100122629 3300006880 Bacteria 2272
78 Ga0068865_100010237 3300006881 Bacteria 5831
79 Ga0097620_100020024 3300006931 Bacteria 6719
80 Ga0075435_100070191 3300007076 Bacteria 2859
81 Ga0075435_100114387 3300007076 Bacteria 2246
82 Ga0105240_10027194 3300009093 Bacteria 7493
83 Ga0105245_10043647 3300009098 Bacteria 3999
84 Ga0114129_10222829 3300009147 Bacteria 2543
85 Ga0114129_10350615 3300009147 Unclassified 1955
86 Ga0114129_10870904 3300009147 Unclassified 1143
87 Ga0114129_11103059 3300009147 Unclassified 993
88 Ga0105243_10008073 3300009148 Bacteria 8080
89 Ga0105243_10220549 3300009148 Unclassified 1676
90 Ga0105241_10015455 3300009174 Bacteria 5591
91 Ga0105242_10011838 3300009176 Bacteria 6714
92 Ga0105248_10003151 3300009177 Bacteria 18252
93 Ga0105248_10770723 3300009177 Bacteria 1086
94 Ga0105249_10039860 3300009553 Bacteria 4264
95 Ga0105249_10630543 3300009553 Unclassified 1128
96 Ga0105239_10006267 3300010375 Bacteria 13836
97 Ga0157378_10005904 3300013297 Bacteria 10725
98 Ga0163162_10049213 3300013306 Bacteria 4224
99 Ga0163162_10189179 3300013306 Bacteria 2186
100 Ga0157375_10063022 3300013308 Bacteria 3687
101 Ga0157375_10287304 3300013308 Bacteria 1808
102 Ga0157379_10186467 3300014968 Bacteria 1875
103 Ga0157376_10303939 3300014969 Bacteria 1511
104 Ga0207642_10000439 3300025899 Bacteria 12565
105 Ga0207680_10020742 3300025903 Bacteria 3545
106 Ga0207645_10003372 3300025907 Bacteria 12145
107 Ga0207643_10045021 3300025908 Unclassified 2491
108 Ga0207654_10004444 3300025911 Bacteria 7076
109 Ga0207707_10044778 3300025912 Bacteria 3857
110 Ga0207695_10052023 3300025913 Bacteria 4294
111 Ga0207693_10124137 3300025915 Unclassified 2028
112 Ga0207660_10060407 3300025917 Bacteria 2725
113 Ga0207649_10156286 3300025920 Bacteria 1576
114 Ga0207646_10031512 3300025922 Bacteria 4799
115 Ga0207646_10230681 3300025922 Bacteria 1672
116 Ga0207646_10329036 3300025922 Bacteria 1380
117 Ga0207646_10633975 3300025922 Bacteria 958
118 Ga0207681_10054258 3300025923 Unclassified 2724
119 Ga0207706_10000154 3300025933 Bacteria 75674
120 Ga0207686_10000415 3300025934 Bacteria 29150
121 Ga0207709_10010945 3300025935 Bacteria 5000
122 Ga0207670_10126301 3300025936 Unclassified 1867
123 Ga0207669_10002949 3300025937 Bacteria 7306
124 Ga0207704_10001347 3300025938 Bacteria 10955
125 Ga0207691_10079236 3300025940 Bacteria 2956
126 Ga0207711_10005168 3300025941 Bacteria 11060
127 Ga0207689_10002396 3300025942 Bacteria 17466
128 Ga0207689_10701711 3300025942 Unclassified 853
129 Ga0207679_10063022 3300025945 Bacteria 2766
130 Ga0207679_10122430 3300025945 Bacteria 2073
131 Ga0207679_10713976 3300025945 Bacteria 910
132 Ga0207712_10020257 3300025961 Bacteria 4355
133 Ga0207712_10259529 3300025961 Unclassified 1408
134 Ga0207640_10017882 3300025981 Bacteria 4155
135 Ga0207639_10070526 3300026041 Bacteria 2730
136 Ga0207648_10000096 3300026089 Bacteria 83916
137 Ga0207674_10009181 3300026116 Bacteria 11340
138 Ga0207675_100038539 3300026118 Bacteria 4460
139 Ga0209983_1011167 3300027665 Bacteria 1838
140 Ga0209971_1018870 3300027682 Bacteria 1638
141 Ga0209974_10015441 3300027876 Bacteria 2536
142 Ga0268265_10015556 3300028380 Bacteria 5209
143 Ga0268265_10155508 3300028380 Unclassified 1934
144 Ga0268265_10418753 3300028380 Bacteria 1243
145 Ga0268264_10019847 3300028381 Bacteria 5491
146 Ga0307408_100012722 3300031548 Bacteria 5580
147 Ga0307408_100019524 3300031548 Bacteria 4565
148 Ga0307408_100019684 3300031548 Bacteria 4547
149 Ga0307408_100164518 3300031548 Bacteria 1765
150 Ga0307408_100454490 3300031548 Bacteria 1112
151 Ga0307408_100466239 3300031548 Bacteria 1099
152 Ga0307413_10026249 3300031824 Bacteria 3207
153 Ga0307413_10039678 3300031824 Bacteria 2740
154 Ga0307410_10003218 3300031852 Bacteria 8144
155 Ga0307410_10007248 3300031852 Bacteria 6057
156 Ga0307410_10008834 3300031852 Bacteria 5616
157 Ga0307410_10063356 3300031852 Bacteria 2536
158 Ga0307406_10035868 3300031901 Bacteria 3053
159 Ga0307406_10105912 3300031901 Bacteria 1925
160 Ga0307407_10047547 3300031903 Bacteria 2436
161 Ga0307407_10055739 3300031903 Bacteria 2285
162 Ga0307407_10077126 3300031903 Bacteria 2003
163 Ga0307412_10579307 3300031911 Bacteria 947
164 Ga0307409_100003727 3300031995 Bacteria 8371
165 Ga0307409_100027309 3300031995 Bacteria 4043
166 Ga0307409_100046389 3300031995 Bacteria 3289
167 Ga0307409_100066965 3300031995 Bacteria 2834
168 Ga0307409_100402206 3300031995 Bacteria 1308
169 Ga0307409_100588436 3300031995 Bacteria 1098
170 Ga0307416_100001972 3300032002 Bacteria 11504
171 Ga0307416_100004944 3300032002 Bacteria 8120
172 Ga0307416_100087447 3300032002 Unclassified 2660
173 Ga0307416_100132045 3300032002 Unclassified 2250
174 Ga0307416_100154881 3300032002 Bacteria 2108
175 Ga0307416_100243399 3300032002 Bacteria 1745
176 Ga0307416_100805204 3300032002 Bacteria 1035
177 Ga0307416_101035161 3300032002 Bacteria 925
178 Ga0307411_10028588 3300032005 Bacteria 3392
179 Ga0307411_10052089 3300032005 Bacteria 2674
180 Ga0307411_10091696 3300032005 Bacteria 2123
181 Ga0307415_100000703 3300032126 Bacteria 14900
182 Ga0307415_100004149 3300032126 Bacteria 7473
183 Ga0307415_100006810 3300032126 Bacteria 6200
184 Ga0395905_0082384 3300037471 Bacteria 3015
185 Ga0395901_0348440 3300038443 Bacteria 1529
186 Ga0451577_0008915 3300042876 Bacteria 9708
187 Ga0453683_0076604 3300044673 Unclassified 2094
188 Ga0495603_0004369 3300046455 Bacteria 8428
189 Ga0495603_0145845 3300046455 Unclassified 1376
190 Ga0495662_0025307 3300046476 Bacteria 2866
191 Ga0495664_0055367 3300046477 Bacteria 2360
192 Ga0495618_0052318 3300046514 Bacteria 2581
193 Ga0495628_0371906 3300046516 Unclassified 1048
194 Ga0495666_0002099 3300046526 Bacteria 9875
195 Ga0495640_0124279 3300046533 Unclassified 1674
196 Ga0495586_0055317 3300046535 Unclassified 2150
197 Ga0495634_0018585 3300046642 Bacteria 4945
198 Ga0495647_0065577 3300046681 Unclassified 1442
199 Ga0495674_0011131 3300047319 Bacteria 8494
200 Ga0496102_0001036 3300048905 Bacteria 25832
201 Ga0496102_0047455 3300048905 Bacteria 3903
202 Ga0496103_0004827 3300048906 Bacteria 8143
203 Ga0496104_0009890 3300048907 Bacteria 8514
204 Ga0496104_0109928 3300048907 Bacteria 2642
205 Ga0496106_0119112 3300048909 Unclassified 2062
206 Ga0496107_0036739 3300048910 Bacteria 3514
207 Ga0496107_0138604 3300048910 Bacteria 1798
208 Ga0496108_0002960 3300048911 Bacteria 13659
209 Ga0496108_0012056 3300048911 Bacteria 7027
210 Ga0496109_0103283 3300048912 Bacteria 2645
211 Ga0496110_0002414 3300048913 Bacteria 13990
212 Ga0496110_0319089 3300048913 Bacteria 1415
213 Ga0496111_0044137 3300048914 Bacteria 3204
214 Ga0496112_0064315 3300048915 Bacteria 3620
215 Ga0496113_0001788 3300048916 Bacteria 12193
216 Ga0496113_0093324 3300048916 Bacteria 2323
217 Ga0496114_0133906 3300048917 Bacteria 2142
218 Ga0501299_002711 3300049522 Bacteria 2480
219 Ga0501038_0620368 3300049574 Bacteria 817
220 Ga0501039_0045167 3300049575 Bacteria 3403
221 Ga0501040_0289554 3300049576 Archaea 1170
222 Ga0501040_0629940 3300049576 Bacteria 775
223 Ga0501046_0078420 3300049580 Bacteria 2555
224 Ga0501048_0142164 3300049582 Bacteria 1697
225 Ga0501067_0007457 3300049583 Bacteria 6078
226 Ga0501068_0037942 3300049584 Bacteria 2885
227 Ga0501072_0147014 3300049588 Bacteria 1879
228 Ga0501074_0075386 3300049590 Bacteria 2422
229 Ga0501076_0030476 3300049592 Bacteria 4201
230 Ga0501076_0050647 3300049592 Bacteria 3286
231 Ga0501076_0100121 3300049592 Bacteria 2335
232 Ga0501077_0001915 3300049593 Bacteria 12598
233 Ga0501077_0041540 3300049593 Archaea 2927
234 Ga0501077_0102287 3300049593 Bacteria 1815
235 Ga0501202_067494 3300049652 Bacteria 819
236 Ga0501216_022441 3300049660 Bacteria 1116
237 Ga0501239_019522 3300049672 Bacteria 822
238 Ga0501243_023301 3300049675 Bacteria 1029
239 Ga0501249_009664 3300049679 Bacteria 2008
240 Ga0501079_0005780 3300049741 Bacteria 9246
241 Ga0501079_0045969 3300049741 Bacteria 3369
242 Ga0501080_0151805 3300049742 Bacteria 2141
243 Ga0501081_0019318 3300049743 Bacteria 4538
244 Ga0501083_0104046 3300049744 Bacteria 1870
245 Ga0501268_001077 3300049765 Bacteria 3277
246 Ga0501035_0250582 3300049822 Bacteria 1504
247 Ga0501045_0021352 3300049824 Bacteria 4631
248 Ga0501045_0221117 3300049824 Bacteria 1410
249 Ga0501204_019313 3300049850 Bacteria 878
250 nmdc:mga05p37_118350_c1 3300050507 Bacteria 3255
251 nmdc:mga05p37_27222_c1 3300050507 Bacteria 6960
252 nmdc:mga05p37_286909_c1 3300050507 Unclassified 1960
253 nmdc:mga09592_422800_c1 3300050508 Bacteria 1151
254 nmdc:mga09592_58381_c1 3300050508 Bacteria 3262
255 nmdc:mga09592_6143_c1 3300050508 Bacteria 9780
256 nmdc:mga0qj67_74900_c1 3300050509 Bacteria 2705
257 nmdc:mga06r32_51602_c1 3300050510 Bacteria 3936
258 nmdc:mga08y16_126444_c1 3300050511 Bacteria 2659
259 nmdc:mga08y16_359306_c1 3300050511 Bacteria 1495
260 nmdc:mga0n895_14849_c1 3300050512 Bacteria 7087
261 nmdc:mga0n895_242499_c1 3300050512 Bacteria 1829
262 nmdc:mga0n895_84144_c1 3300050512 Bacteria 3174
263 nmdc:mga0rr50_127304_c1 3300050513 Unclassified 2035
264 nmdc:mga0rr50_181293_c1 3300050513 Bacteria 1721
265 nmdc:mga0a205_30510_c1 3300050515 Bacteria 5161
266 nmdc:mga0a205_38225_c1 3300050515 Bacteria 4616
267 Ga0590071_000089 3300059421 Bacteria 25178
268 Ga0590071_021502 3300059421 Bacteria 1521
269 Ga0590074_001307 3300059423 Bacteria 3968
270 Ga0590075_007503 3300059424 Bacteria 2594
271 Ga0590077_007681 3300059426 Bacteria 2204
272 Ga0590077_012020 3300059426 Bacteria 1790
273 Ga0501082_0016355 3300060353 Bacteria 6386
274 Ga0501082_0084810 3300060353 Bacteria 2732
275 Ga0501082_0537816 3300060353 Unclassified 1022
276 Ga0530510_0065033 3300061734 Bacteria 2642
277 Ga0530510_0107923 3300061734 Bacteria 2038
278 Ga0496109_0209232
279 rootH1_10131485
280 rootL2_10220792
281 rootL2_10382120
282 rootH1_10399625
283 Ga0065715_10146073
284 Ga0070676_10003795
285 Ga0068869_100011063
286 Ga0068869_100281298
287 Ga0070666_10011121
288 Ga0070680_100049604
289 Ga0070689_100132468
290 Ga0070691_10020927
291 Ga0070669_100041204
292 Ga0070674_100004984
293 Ga0070673_100078031
294 Ga0070659_100121113
295 Ga0070711_100001482
296 Ga0070705_100016111
297 Ga0070705_100068336
298 Ga0070705_100127947
299 Ga0070700_100078550
300 Ga0070694_100073479
301 Ga0070694_100156056
302 Ga0070708_100089589
303 Ga0070708_100384495
304 Ga0070663_100327639
305 Ga0070663_100483980
306 Ga0070678_100462787
307 Ga0070662_100000813
308 Ga0070681_10032514
309 Ga0068867_100004349
310 Ga0070706_100019178
311 Ga0070707_100006681
312 Ga0070707_100011696
313 Ga0070707_100801581
314 Ga0070698_100005117
315 Ga0070698_100037646
316 Ga0070698_100128533
317 Ga0070699_100000702
318 Ga0070699_100001217
319 Ga0070699_100004136
320 Ga0070699_100388549
321 Ga0070697_100029047
322 Ga0070697_100030087
323 Ga0070697_100485082
324 Ga0070695_100012520
325 Ga0070696_100007945
326 Ga0070696_100013353
327 Ga0070696_100024447
328 Ga0070696_100077710
329 Ga0070704_100025139
330 Ga0070704_100324597
331 Ga0068855_100357651
332 Ga0068854_100006006
333 Ga0070702_100002675
334 Ga0068859_100020024
335 Ga0068864_100109828
336 Ga0068866_10000905
337 Ga0068861_100025610
338 Ga0068870_10030889
339 Ga0068860_100046883
340 Ga0068862_100025357
341 Ga0068862_100065759
342 Ga0068862_100385018
343 Ga0070715_10099567
344 Ga0070712_100038681
345 Ga0075431_100002309
346 Ga0075431_100062767
347 Ga0075433_10121528
348 Ga0075433_10360902
349 Ga0075434_100015659
350 Ga0075434_100050554
351 Ga0075434_100237687
352 Ga0075434_100314311
353 Ga0075429_100021925
354 Ga0075429_100122629
355 Ga0068865_100010237
356 Ga0097620_100020024
357 Ga0075435_100070191
358 Ga0075435_100114387
359 Ga0105240_10027194
360 Ga0105245_10043647
361 Ga0114129_10222829
362 Ga0114129_10350615
363 Ga0114129_10870904
364 Ga0114129_11103059
365 Ga0105243_10008073
366 Ga0105243_10220549
367 Ga0105241_10015455
368 Ga0105242_10011838
369 Ga0105248_10003151
370 Ga0105248_10770723
371 Ga0105249_10039860
372 Ga0105249_10630543
373 Ga0105239_10006267
374 Ga0157378_10005904
375 Ga0163162_10049213
376 Ga0163162_10189179
377 Ga0157375_10063022
378 Ga0157375_10287304
379 Ga0157379_10186467
380 Ga0157376_10303939
381 Ga0207642_10000439
382 Ga0207680_10020742
383 Ga0207645_10003372
384 Ga0207643_10045021
385 Ga0207654_10004444
386 Ga0207707_10044778
387 Ga0207695_10052023
388 Ga0207693_10124137
389 Ga0207660_10060407
390 Ga0207649_10156286
391 Ga0207646_10031512
392 Ga0207646_10230681
393 Ga0207646_10329036
394 Ga0207646_10633975
395 Ga0207681_10054258
396 Ga0207706_10000154
397 Ga0207686_10000415
398 Ga0207709_10010945
399 Ga0207670_10126301
400 Ga0207669_10002949
401 Ga0207704_10001347
402 Ga0207691_10079236
403 Ga0207711_10005168
404 Ga0207689_10002396
405 Ga0207689_10701711
406 Ga0207679_10063022
407 Ga0207679_10122430
408 Ga0207679_10713976
409 Ga0207712_10020257
410 Ga0207712_10259529
411 Ga0207640_10017882
412 Ga0207639_10070526
413 Ga0207648_10000096
414 Ga0207674_10009181
415 Ga0207675_100038539
416 Ga0209983_1011167
417 Ga0209971_1018870
418 Ga0209974_10015441
419 Ga0268265_10015556
420 Ga0268265_10155508
421 Ga0268265_10418753
422 Ga0268264_10019847
423 Ga0307408_100012722
424 Ga0307408_100019524
425 Ga0307408_100019684
426 Ga0307408_100164518
427 Ga0307408_100454490
428 Ga0307408_100466239
429 Ga0307413_10026249
430 Ga0307413_10039678
431 Ga0307410_10003218
432 Ga0307410_10007248
433 Ga0307410_10008834
434 Ga0307410_10063356
435 Ga0307406_10035868
436 Ga0307406_10105912
437 Ga0307407_10047547
438 Ga0307407_10055739
439 Ga0307407_10077126
440 Ga0307412_10579307
441 Ga0307409_100003727
442 Ga0307409_100027309
443 Ga0307409_100046389
444 Ga0307409_100066965
445 Ga0307409_100402206
446 Ga0307409_100588436
447 Ga0307416_100001972
448 Ga0307416_100004944
449 Ga0307416_100087447
450 Ga0307416_100132045
451 Ga0307416_100154881
452 Ga0307416_100243399
453 Ga0307416_100805204
454 Ga0307416_101035161
455 Ga0307411_10028588
456 Ga0307411_10052089
457 Ga0307411_10091696
458 Ga0307415_100000703
459 Ga0307415_100004149
460 Ga0307415_100006810
461 Ga0395905_0082384
462 Ga0395901_0348440
463 Ga0451577_0008915
464 Ga0453683_0076604
465 Ga0495603_0004369
466 Ga0495603_0145845
467 Ga0495662_0025307
468 Ga0495664_0055367
469 Ga0495618_0052318
470 Ga0495628_0371906
471 Ga0495666_0002099
472 Ga0495640_0124279
473 Ga0495586_0055317
474 Ga0495634_0018585
475 Ga0495647_0065577
476 Ga0495674_0011131
477 Ga0496102_0001036
478 Ga0496102_0047455
479 Ga0496103_0004827
480 Ga0496104_0009890
481 Ga0496104_0109928
482 Ga0496106_0119112
483 Ga0496107_0036739
484 Ga0496107_0138604
485 Ga0496108_0002960
486 Ga0496108_0012056
487 Ga0496109_0103283
488 Ga0496110_0002414
489 Ga0496110_0319089
490 Ga0496111_0044137
491 Ga0496112_0064315
492 Ga0496113_0001788
493 Ga0496113_0093324
494 Ga0496114_0133906
495 Ga0501299_002711
496 Ga0501038_0620368
497 Ga0501039_0045167
498 Ga0501040_0289554
499 Ga0501040_0629940
500 Ga0501046_0078420
501 Ga0501048_0142164
502 Ga0501067_0007457
503 Ga0501068_0037942
504 Ga0501072_0147014
505 Ga0501074_0075386
506 Ga0501076_0030476
507 Ga0501076_0050647
508 Ga0501076_0100121
509 Ga0501077_0001915
510 Ga0501077_0041540
511 Ga0501077_0102287
512 Ga0501202_067494
513 Ga0501216_022441
514 Ga0501239_019522
515 Ga0501243_023301
516 Ga0501249_009664
517 Ga0501079_0005780
518 Ga0501079_0045969
519 Ga0501080_0151805
520 Ga0501081_0019318
521 Ga0501083_0104046
522 Ga0501268_001077
523 Ga0501035_0250582
524 Ga0501045_0021352
525 Ga0501045_0221117
526 Ga0501204_019313
527 nmdc:mga05p37_118350_c1
528 nmdc:mga05p37_27222_c1
529 nmdc:mga05p37_286909_c1
530 nmdc:mga09592_422800_c1
531 nmdc:mga09592_58381_c1
532 nmdc:mga09592_6143_c1
533 nmdc:mga0qj67_74900_c1
534 nmdc:mga06r32_51602_c1
535 nmdc:mga08y16_126444_c1
536 nmdc:mga08y16_359306_c1
537 nmdc:mga0n895_14849_c1
538 nmdc:mga0n895_242499_c1
539 nmdc:mga0n895_84144_c1
540 nmdc:mga0rr50_127304_c1
541 nmdc:mga0rr50_181293_c1
542 nmdc:mga0a205_30510_c1
543 nmdc:mga0a205_38225_c1
544 Ga0590071_000089
545 Ga0590071_021502
546 Ga0590074_001307
547 Ga0590075_007503
548 Ga0590077_007681
549 Ga0590077_012020
550 Ga0501082_0016355
551 Ga0501082_0084810
552 Ga0501082_0537816
553 Ga0530510_0065033
554 Ga0530510_0107923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

42

115

0.99

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

167

235

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yh5-assembly3.cif.gz_F-2 mazg(mycobacterium tuberculosis) 0.9051 10 91
7yh5-assembly1.cif.gz_A mazg(mycobacterium tuberculosis) 0.8795 1 92
7yh5-assembly2.cif.gz_D mazg(mycobacterium tuberculosis) 0.878 1 92
7yh5-assembly3.cif.gz_E mazg(mycobacterium tuberculosis) 0.8521 1 92
5ie9-assembly1.cif.gz_B crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase 0.8294 128 227
ID Description Score Start End Superfamily
3crcA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9185 5 97 1.10.287.1080
3craB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9069 120 264 1.10.287.1080
3crcB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9066 120 264 1.10.287.1080
3craB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9012 5 92 1.10.287.1080
3crcB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8881 5 92 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A7C5L3I3-F1-model_v4 Nucleoside triphosphate pyrophosphohydrolase 0.9546 6 99 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A522ETI2-F1-model_v4 MazG family protein 0.9543 7 100 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A7X3YDZ1-F1-model_v4 deleted 0.9527 1 87
AF-A0A2P7PYM6-F1-model_v4 Tetrapyrrole methylase 0.95 10 95 GO:0008168
GO:0017183
GO:0032259
AF-A0A6D2G556-F1-model_v4 Nucleoside triphosphate pyrophospho hydrolase MazG (EC 3.6.1.8) 0.9394 5 100 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047693

Map